SimulationCraft 1000-01

for World of Warcraft 10.0.2.46801 Live (hotfix 2022-11-29/46801, git build 064d9ccf0f)

Current simulator hotfixes

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2022-11-14 Ebonbolt is slower than spell data suggests.
Ebonbolt prj_speed 20.00 30.00
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

T29_Death_Knight_Frost : 87078 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
87078.1 87078.1 97.3 / 0.112% 16702.4 / 19.2% 6334.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.5 13.8 Runic Power 8.09% 51.4 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T29_Death_Knight_Frost 87078
Abomination Limb 0 (874) 0.0% (1.0%) 3.0 120.60sec 86797 73599

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 0.00 1.1795 0.0000 0.00 0.00 0.00% 73598.58 73598.58

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [Z]:0.10
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    cooldowns
    [a]:2.89
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
    Abomination Limb (_damage) 874 1.0% 38.2 6.90sec 6788 0 Direct 38.2 4789 9615 6788 41.4% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.24 38.24 0.00 0.00 0.00 0.0000 0.0000 259582.21 259582.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.58% 22.40 9 36 4788.75 3125 8942 4789.45 3859 5754 107273 107273 0.00%
crit 41.42% 15.84 3 27 9614.83 6251 18100 9616.94 7629 12031 152309 152309 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 4375 5.0% 200.2 1.75sec 6552 3771 Direct 200.2 5222 10448 6552 41.8% 16.3%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 200.16 200.16 0.00 0.00 0.00 1.7375 0.0000 1311429.56 1873518.57 30.00% 3770.96 3770.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 41.86% 83.80 41 125 5221.81 3335 9991 5222.39 4812 5687 437572 625119 30.00%
crit 41.79% 83.64 46 123 10448.11 6671 19982 10448.13 9715 11553 873857 1248399 30.00%
miss 16.35% 32.73 11 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 2132 2.4% 195.6 1.75sec 3268 1881 Direct 195.6 2610 5224 3268 41.8% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 195.55 195.55 0.00 0.00 0.00 1.7373 0.0000 638967.45 912833.91 30.00% 1880.78 1880.78
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 41.49% 81.13 49 118 2610.34 1668 4941 2610.74 2396 2839 211781 302552 30.00%
crit 41.82% 81.78 49 121 5223.66 3335 9991 5223.42 4797 5776 427186 610281 30.00%
miss 16.69% 32.64 12 55 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Breath of Sindragosa 0 (23040) 0.0% (26.5%) 2.9 125.92sec 2413068 0

Stats Details: Breath Of Sindragosa

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Breath Of Sindragosa

  • id:152279
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r

Action Priority List

    cooldowns
    [d]:2.86
  • if_expr:!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
    Breath of Sindragosa (_tick) 23040 26.5% 226.6 1.25sec 30499 0 Direct 226.6 21516 42976 30499 41.9% 0.0%

Stats Details: Breath Of Sindragosa Tick

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 226.61 226.61 0.00 0.00 0.00 0.0000 0.0000 6911303.65 6911303.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.14% 131.75 61 212 21515.62 11278 45360 21527.34 19878 23804 2834651 2834651 0.00%
crit 41.86% 94.86 47 151 42976.12 22556 90720 43002.86 39603 47230 4076652 4076652 0.00%

Action Details: Breath Of Sindragosa Tick

  • id:155166
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:12.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:155166
  • name:Breath of Sindragosa
  • school:frost
  • tooltip:
  • description:{$@spelldesc152279=Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r}
Burnout Wave 1222 1.4% 2.9 119.96sec 124433 0 Direct 2.8 93496 186518 132183 41.6% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.77 0.00 0.00 0.00 0.0000 0.0000 366712.11 366712.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.41% 1.62 0 3 93496.03 52572 105144 84976.34 0 105144 151521 151521 0.00%
crit 41.59% 1.15 0 3 186517.92 70096 210288 144503.63 0 210288 215191 215191 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16070.92
  • base_dd_max:16070.92
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=25627} Fire damage split between all nearby enemies, based on the strength of your binding.}
Death and Decay 29 0.0% 1.0 107.09sec 9073 7155 Direct 10.4 591 1181 837 41.7% 0.0%

Stats Details: Death And Decay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.96 10.37 0.00 0.00 0.00 1.2691 0.0000 8678.64 8678.64 0.00% 7154.69 7154.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.27% 6.04 0 27 590.67 419 939 418.98 0 806 3570 3570 0.00%
crit 41.73% 4.33 0 20 1180.52 837 1878 835.70 0 1630 5109 5109 0.00%

Action Details: Death And Decay

  • id:43265
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing {$=}{{$341340m1=0}*11} Shadow damage over {$d=10 seconds} to targets within the area.{$?=}!c2[ While you remain within the area, your ][]{$?s223829=false}&!c2[Necrotic Strike and ][]{$?=}c1[ Heart Strike will hit up to {$188290m3=0} additional targets.]?s207311&!c2[ Clawing Shadows will hit up to {$=}{{$55090s4=8}-1} enemies near the target.]?!c2[ Scourge Strike will hit up to {$=}{{$55090s4=8}-1} enemies near the target.][ While you remain within the area, your Obliterate will hit up to {$315442s2=1} additional target.]

Action Priority List

    breath
    [R]:0.96
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
Frost Fever 3453 4.0% 72.5 4.12sec 14295 0 Periodic 98.7 7405 14782 10495 41.9% 0.0% 98.7%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 72.48 0.00 98.72 98.72 71.47 0.0000 3.0000 1036031.60 1036031.60 0.00% 3498.31 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 58.12% 57.37 32 83 7405.29 593 15198 7405.09 6865 8069 424871 424871 0.00%
crit 41.88% 41.34 21 65 14782.00 288 31964 14781.60 13158 16534 611161 611161 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 1086 (1628) 1.3% (1.9%) 17.2 6.83sec 28580 22477 Direct 17.2 (34.3) 13450 26892 19055 41.7% (41.7%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.15 17.15 0.00 0.00 0.00 1.2715 0.0000 326851.08 326851.08 0.00% 22477.10 22477.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.30% 10.00 0 32 13449.56 8251 24416 13100.40 0 20829 134486 134486 0.00%
crit 41.70% 7.15 0 25 26891.79 17095 48765 25962.27 0 41815 192365 192365 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [C]:10.66
  • if_expr:active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
    single_target
    [i]:2.23
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [m]:4.27
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 543 0.6% 17.2 6.83sec 9525 0 Direct 17.2 6726 13442 9525 41.7% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.15 17.15 0.00 0.00 0.00 0.0000 0.0000 163374.48 163374.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.33% 10.00 0 30 6726.13 4305 12208 6566.25 0 10454 67294 67294 0.00%
crit 41.67% 7.15 0 25 13442.09 8251 23034 13006.77 0 20829 96080 96080 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Howling Blast 13046 (15777) 15.0% (18.1%) 72.5 4.12sec 65222 55800 Direct 72.5 (144.8) 38032 76036 53931 41.8% (41.8%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 72.48 72.48 0.00 0.00 0.00 1.1689 0.0000 3908755.92 3908755.92 0.00% 55800.16 55800.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.16% 42.15 21 67 38032.17 6298 80781 38034.71 33935 42689 1603243 1603243 0.00%
crit 41.84% 30.32 14 53 76035.89 12597 159754 76031.52 61245 88530 2305513 2305513 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    breath
    [N]:59.86
  • if_expr:variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
    breath
    [S]:0.50
  • if_expr:runic_power<32&rune.time_to_2>runic_power%16
    breath
    [U]:0.69
  • if_expr:buff.rime.react
    single_target
    [h]:11.43
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 2731 3.1% 72.3 4.13sec 11317 0 Direct 72.3 7988 15953 11317 41.8% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 72.31 72.31 0.00 0.00 0.00 0.0000 0.0000 818298.87 818298.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.21% 42.09 21 68 7988.13 4061 16781 7988.76 7174 9363 336207 336207 0.00%
crit 41.79% 30.22 12 52 15952.56 8122 33937 15952.81 13831 18063 482092 482092 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Obliterate 2115 (21472) 2.4% (24.7%) 48.0 6.14sec 134040 46686 Direct 48.0 (234.8) 9317 18640 13207 41.7% (76.2%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.02 48.02 0.00 0.00 0.00 2.8711 0.0000 634146.52 787779.74 19.50% 46686.29 46686.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.28% 27.98 11 50 9316.95 5927 18104 9322.72 8221 10698 260717 323881 19.50%
crit 41.72% 20.03 6 37 18639.67 11855 35808 18642.31 15683 23157 373429 463899 19.50%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    breath
    [P]:46.98
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [Q]:40.12
  • if_expr:runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    breath
    [T]:9.43
  • if_expr:runic_power.deficit>25
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [g]:13.39
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [j]:7.47
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 1059 1.2% 48.0 6.14sec 6610 0 Direct 48.0 4656 9326 6610 41.8% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 48.02 48.02 0.00 0.00 0.00 0.0000 0.0000 317407.70 394305.33 19.50% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.16% 27.92 11 51 4656.29 2964 9052 4658.71 4030 5384 130024 161525 19.50%
crit 41.84% 20.09 5 39 9325.90 5927 17904 9325.19 8091 11288 187383 232780 19.50%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 12199 14.0% 69.4 4.28sec 52704 0 Direct 69.4 0 52704 52704 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.38 69.38 0.00 0.00 0.00 0.0000 0.0000 3656474.37 3179542.93 -15.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 69.38 42 101 52704.20 27065 115592 52681.50 48425 57323 3656474 3179543 -15.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 6099 7.0% 69.4 4.28sec 26352 0 Direct 69.4 0 26352 26352 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 69.38 69.38 0.00 0.00 0.00 0.0000 0.0000 1828237.18 1589771.46 -15.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 69.38 42 101 26352.10 13533 57796 26340.75 24213 28662 1828237 1589771 -15.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Remorseless Winter 0 (10698) 0.0% (12.3%) 15.0 20.57sec 213241 178071

Stats Details: Remorseless Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.04 0.00 0.00 0.00 0.00 1.1975 0.0000 0.00 0.00 0.00% 178071.22 178071.22

Action Details: Remorseless Winter

  • id:196770
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:196770
  • name:Remorseless Winter
  • school:frost
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.

Action Priority List

    breath
    [M]:10.81
  • if_expr:variable.rw_buffs|variable.adds_remain
    single_target
    [f]:4.23
  • if_expr:variable.rw_buffs|variable.adds_remain
    Remorseless Winter (_damage) 10698 12.3% 258.6 1.16sec 12403 0 Direct 258.6 8747 17493 12403 41.8% 0.0%

Stats Details: Remorseless Winter Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 258.56 258.56 0.00 0.00 0.00 0.0000 0.0000 3206884.55 3206884.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.20% 150.48 95 208 8747.02 1636 21939 8744.62 7334 10004 1316271 1316271 0.00%
crit 41.80% 108.08 68 158 17492.62 3273 44367 17488.46 14700 19902 1890614 1890614 0.00%

Action Details: Remorseless Winter Damage

  • id:196771
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:196771
  • name:Remorseless Winter
  • school:frost
  • tooltip:
  • description:{$@spelldesc196770=Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.}
Strike Twice 372 0.4% 21.2 13.74sec 5249 0 Direct 21.2 3699 7398 5249 41.9% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.24 21.24 0.00 0.00 0.00 0.0000 0.0000 111490.37 159276.02 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.09% 12.34 2 29 3698.80 3699 3699 3698.80 3699 3699 45633 65192 30.00%
crit 41.91% 8.90 1 22 7397.61 7398 7398 7397.61 7398 7398 65857 94084 30.00%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4845.70
  • base_dd_max:4845.70
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 372 0.4% 21.2 13.76sec 5251 0 Direct 21.2 3699 7398 5251 42.0% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.23 21.23 0.00 0.00 0.00 0.0000 0.0000 111451.40 159220.35 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.04% 12.32 2 26 3698.80 3699 3699 3698.80 3699 3699 45565 65095 30.00%
crit 41.96% 8.91 1 23 7397.61 7398 7398 7397.61 7398 7398 65886 94125 30.00%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4845.70
  • base_dd_max:4845.70
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 2997 / 1635
Claw 975 0.6% 53.8 5.21sec 2960 2960 Direct 53.8 2086 4175 2960 41.9% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 53.85 53.85 0.00 0.00 0.00 1.0000 0.0000 159396.47 227715.05 30.00% 2960.12 2960.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.14% 31.31 13 46 2085.86 1317 3917 2087.51 1861 2376 65309 93300 30.00%
crit 41.86% 22.54 7 37 4174.54 2634 7920 4177.89 3603 4970 94088 134415 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:53.85
  • if_expr:energy>70
Gnaw 2 0.0% 2.9 120.72sec 103 103 Direct 2.9 73 146 103 41.0% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 301.08 430.13 30.00% 102.93 102.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.95% 1.72 0 3 72.91 47 102 67.31 0 101 126 180 27.69%
crit 41.05% 1.20 0 3 146.03 93 209 114.63 0 209 175 251 23.56%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
main_hand 2019 1.3% 99.5 2.78sec 3319 2228 Direct 99.5 2338 4678 3319 41.9% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 99.49 99.49 0.00 0.00 0.00 1.4898 0.0000 330212.03 471743.51 30.00% 2227.75 2227.75
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.09% 57.80 29 82 2338.24 1464 4448 2340.49 2128 2651 135140 193062 30.00%
crit 41.91% 41.70 20 66 4678.11 2927 8897 4683.29 4161 5407 195072 278682 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
T29_Death_Knight_Frost
Arcane Torrent 1.9 140.38sec

Stats Details: Arcane Torrent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.90 0.00 0.00 0.00 0.00 1.2367 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Torrent

  • id:50613
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Spelldata

  • id:50613
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within {$=}A1 yards and restore {$=}{{$m2=200}/10} Runic Power.

Action Priority List

    breath
    [V]:1.49
  • if_expr:runic_power<60
    single_target
    [l]:0.41
  • if_expr:runic_power.deficit>20
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Empower Rune Weapon 3.9 86.98sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [X]:0.46
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
    cooldowns
    [Y]:3.49
  • if_expr:buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Horn of Winter 5.0 59.23sec

Stats Details: Horn Of Winter

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 4.96 0.00 0.00 0.00 0.00 1.1794 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Horn Of Winter

  • id:57330
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:2.0

Spelldata

  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:
  • description:Blow the Horn of Winter, gaining {$s1=2} {$=}LRune:Runes; and generating {$=}{{$s2=250}/10} Runic Power.

Action Priority List

    breath
    [O]:4.74
  • if_expr:rune<2&runic_power.deficit>25
    single_target
    [k]:0.22
  • if_expr:rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
Pillar of Frost 8.9 35.14sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.89 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [b]:0.35
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
    cooldowns
    [c]:8.54
  • if_expr:talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
Elemental Potion of Ultimate Power 1.5 305.80sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [W]:1.45
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.73sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [e]:2.98
Unholy Strength 21.3 13.72sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 21.27 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 120.5sec 120.6sec 11.8sec 11.88% 0.00% 32.4 (32.4) 2.9

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 125.1s
  • trigger_min/max:120.0s / 125.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.88%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 13.3 56.0 23.0sec 4.3sec 18.5sec 82.13% 0.00% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.3s / 54.5s
  • trigger_min/max:0.8s / 32.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.3s

Stack Uptimes

  • bonegrinder_crit_1:18.90%
  • bonegrinder_crit_2:17.52%
  • bonegrinder_crit_3:16.26%
  • bonegrinder_crit_4:15.20%
  • bonegrinder_crit_5:14.24%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 10.0 0.0 29.0sec 29.0sec 9.8sec 32.97% 47.61% 0.0 (0.0) 9.7

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 188.7s
  • trigger_min/max:7.7s / 188.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bonegrinder_frost_1:32.97%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.9 13.9 120.8sec 15.7sec 19.4sec 19.17% 0.00% 1.5 (1.5) 2.8

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:410.31
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:410.31

Trigger Details

  • interval_min/max:120.0s / 137.6s
  • trigger_min/max:0.0s / 124.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:1.34%
  • bound_by_fire_and_blaze_2:4.41%
  • bound_by_fire_and_blaze_3:4.25%
  • bound_by_fire_and_blaze_4:3.75%
  • bound_by_fire_and_blaze_5:2.69%
  • bound_by_fire_and_blaze_6:2.74%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=25627} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Breath of Sindragosa 2.8 0.0 126.0sec 126.1sec 79.8sec 75.59% 0.00% 226.0 (226.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_breath_of_sindragosa
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 268.1s
  • trigger_min/max:120.0s / 268.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 291.9s

Stack Uptimes

  • breath_of_sindragosa_1:75.59%

Spelldata

  • id:152279
  • name:Breath of Sindragosa
  • tooltip:Continuously dealing Frost damage every {$t1=1} sec to enemies in a cone in front of you.
  • description:Continuously deal {$=}{{$155166s2=0}*{$=}<CAP>/{$=}AP} Frost damage every {$t1=1} sec to enemies in a cone in front of you, until your Runic Power is exhausted. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$303753s1=2} {$=}lRune:Runes; at the start and end.|r
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Earth 7.6 3.5 37.8sec 25.0sec 14.3sec 36.21% 0.00% 3.5 (3.5) 7.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_elemental_lariat__empowered_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 128.6s
  • trigger_min/max:0.0s / 103.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.7s

Stack Uptimes

  • elemental_lariat__empowered_earth_1:36.21%

Spelldata

  • id:375345
  • name:Elemental Lariat - Empowered Earth
  • tooltip:Mastery increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 305.8sec 305.8sec 27.0sec 12.84% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.2s
  • trigger_min/max:300.0s / 328.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.84%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 3.9 0.0 87.0sec 87.0sec 19.5sec 25.87% 0.00% 11.6 (11.6) 3.5

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 215.6s
  • trigger_min/max:20.0s / 215.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:25.87%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 8.5 0.0 35.2sec 35.2sec 14.3sec 40.66% 0.00% 0.0 (0.0) 8.1

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:26.0s / 54.5s
  • trigger_min/max:26.0s / 54.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 26.0s

Stack Uptimes

  • enduring_strength_1:40.66%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 8.8 28.8 35.2sec 7.7sec 10.5sec 30.83% 99.51% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:21.8s / 81.1s
  • trigger_min/max:0.8s / 72.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:8.46%
  • enduring_strength_builder_2:8.39%
  • enduring_strength_builder_3:6.87%
  • enduring_strength_builder_4:4.30%
  • enduring_strength_builder_5:1.92%
  • enduring_strength_builder_6:0.64%
  • enduring_strength_builder_7:0.20%
  • enduring_strength_builder_8:0.04%
  • enduring_strength_builder_9:0.00%
  • enduring_strength_builder_10:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gathering Storm 12.4 151.2 25.1sec 1.8sec 18.2sec 74.99% 89.49% 93.1 (146.3) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_gathering_storm
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.6s / 104.8s
  • trigger_min/max:0.8s / 24.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 100.1s

Stack Uptimes

  • gathering_storm_1:1.91%
  • gathering_storm_2:4.31%
  • gathering_storm_3:4.30%
  • gathering_storm_4:2.81%
  • gathering_storm_5:4.69%
  • gathering_storm_6:3.44%
  • gathering_storm_7:3.33%
  • gathering_storm_8:3.59%
  • gathering_storm_9:3.03%
  • gathering_storm_10:43.59%

Spelldata

  • id:211805
  • name:Gathering Storm
  • tooltip:Remorseless Winter damage increased by {$s1=10}%.
  • description:{$@spelldesc194912=Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194912
  • name:Gathering Storm
  • tooltip:
  • description:Each Rune spent during Remorseless Winter increases its damage by {$211805s1=10}%, and extends its duration by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Icy Talons 5.6 237.5 52.8sec 1.2sec 51.0sec 95.73% 83.54% 226.5 (226.5) 4.7

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 324.3s
  • trigger_min/max:1.0s / 17.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 348.3s

Stack Uptimes

  • icy_talons_1:2.97%
  • icy_talons_2:2.62%
  • icy_talons_3:90.13%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Inspired by Fire and Earth 7.6 3.6 37.8sec 24.8sec 14.4sec 36.24% 0.00% 3.6 (3.6) 7.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_inspired_by_fire_and_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:277.19

Trigger Details

  • interval_min/max:12.0s / 120.6s
  • trigger_min/max:0.0s / 105.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.8s

Stack Uptimes

  • inspired_by_fire_and_earth_1:36.24%

Spelldata

  • id:394461
  • name:Inspired by Fire and Earth
  • tooltip:Haste and Versatility increased by {$=}w1.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 69.8 22.8 4.3sec 3.2sec 1.7sec 39.47% 40.97% 22.8 (22.8) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 33.5s
  • trigger_min/max:0.0s / 30.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.6s

Stack Uptimes

  • killing_machine_1:39.47%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 8.9 0.0 35.1sec 35.1sec 11.8sec 34.85% 33.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.6s / 54.5s
  • trigger_min/max:25.6s / 54.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:34.85%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 8.9 69.0 35.2sec 3.7sec 11.6sec 34.29% 54.07% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:25.5s / 54.9s
  • trigger_min/max:0.8s / 43.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:1.99%
  • pillar_of_frost_bonus_2:2.49%
  • pillar_of_frost_bonus_3:3.10%
  • pillar_of_frost_bonus_4:2.41%
  • pillar_of_frost_bonus_5:2.80%
  • pillar_of_frost_bonus_6:3.00%
  • pillar_of_frost_bonus_7:2.69%
  • pillar_of_frost_bonus_8:2.62%
  • pillar_of_frost_bonus_9:2.48%
  • pillar_of_frost_bonus_10:2.21%
  • pillar_of_frost_bonus_11:1.98%
  • pillar_of_frost_bonus_12:1.75%
  • pillar_of_frost_bonus_13:1.45%
  • pillar_of_frost_bonus_14:1.12%
  • pillar_of_frost_bonus_15:0.76%
  • pillar_of_frost_bonus_16:0.44%
  • pillar_of_frost_bonus_17:0.30%
  • pillar_of_frost_bonus_18:0.21%
  • pillar_of_frost_bonus_19:0.18%
  • pillar_of_frost_bonus_20:0.16%
  • pillar_of_frost_bonus_21:0.11%
  • pillar_of_frost_bonus_22:0.04%
  • pillar_of_frost_bonus_23:0.01%
  • pillar_of_frost_bonus_24:0.00%
  • pillar_of_frost_bonus_25:0.00%
Remorseless Winter 12.5 2.6 25.0sec 20.6sec 19.6sec 81.45% 0.00% 240.3 (240.3) 11.7

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_remorseless_winter
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:20.0s / 104.4s
  • trigger_min/max:20.0s / 27.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 101.1s

Stack Uptimes

  • remorseless_winter_1:81.45%

Spelldata

  • id:196770
  • name:Remorseless Winter
  • tooltip:Dealing {$196771s1=0} Frost damage to enemies within {$196771=}A1 yards each second.
  • description:Drain the warmth of life from all nearby enemies within {$196771=}A1 yards, dealing {$=}{9*{$196771s1=0}*{$=}<CAP>/{$=}AP} Frost damage over {$d=8 seconds} and reducing their movement speed by {$211793s1=20}%.
  • max_stacks:0
  • duration:8.00
  • cooldown:20.00
  • default_chance:0.00%
Rime 72.6 6.6 4.1sec 3.8sec 1.4sec 34.58% 99.77% 6.6 (6.6) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:60.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 43.6s
  • trigger_min/max:0.0s / 43.6s
  • trigger_pct:62.86%
  • duration_min/max:0.0s / 20.5s

Stack Uptimes

  • rime_1:34.58%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.6 17.4 22.2sec 9.5sec 12.7sec 57.39% 0.00% 17.4 (17.4) 13.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 133.8s
  • trigger_min/max:0.8s / 115.3s
  • trigger_pct:15.05%
  • duration_min/max:0.0s / 92.0s

Stack Uptimes

  • rune_mastery_1:57.39%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Rune of Hysteria 13.1 8.2 22.8sec 13.7sec 10.4sec 45.19% 44.78% 8.2 (8.2) 12.6

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_rune_of_hysteria
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.24
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 83.9s
  • trigger_min/max:0.0s / 57.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 62.2s

Stack Uptimes

  • rune_of_hysteria_1:45.19%

Spelldata

  • id:326918
  • name:Rune of Hysteria
  • tooltip:Runic Power generation increased by {$s1=20}%.
  • description:{$@spelldesc326913=Increases maximum Runic Power by {$=}{{$s2=200}/10}. Your attacks have a chance to increase Runic Power generation by $326918s2% for {$326918d=8 seconds}. }
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.5 12.8 35.8sec 13.7sec 24.2sec 68.54% 0.00% 12.8 (12.8) 7.8

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 179.2s
  • trigger_min/max:0.0s / 59.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 162.1s

Stack Uptimes

  • unholy_strength_1:68.54%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 5.6 237.5 52.8sec 1.2sec 51.0sec 95.73% 91.17% 226.5 (226.5) 4.7

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 324.3s
  • trigger_min/max:1.0s / 17.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 348.3s

Stack Uptimes

  • unleashed_frenzy_1:2.97%
  • unleashed_frenzy_2:2.62%
  • unleashed_frenzy_3:90.13%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=6 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Zone of Focus 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_zone_of_focus
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:220.30

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • zone_of_focus_1:100.00%

Spelldata

  • id:387336
  • name:Zone of Focus
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc387335=Greatly improves the comfort of your gear, allowing you to enter a Zone of Focus while over {$396377s1=90}% health, granting you {$s1=92} Mastery.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Incarnate's Mark of Frost

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_incarnates_mark_of_frost
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:567.88

Spelldata

  • id:382079
  • name:Incarnate's Mark of Frost
  • tooltip:Critical Strike increased by {$=}w1. Dealing harmful spells and abilities has a chance to grant you an additional {$377452=}w2 Versatility or Haste if any nearby allies are Marked by Earth or Fire.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 27.9 11.0 50.0 10.5s 1.2s 140.8s
windfury_totem_extra_attack_oh 23.3 7.0 42.0 12.5s 1.2s 179.9s
Killing Machine spent on Obliterate 69.4 42.0 101.0 4.3s 0.8s 32.1s
Killing Machine: Critical auto attacks 59.4 38.0 86.0 5.0s 1.2s 33.5s
Killing Machine: T29 4pc 10.4 1.0 28.0 25.9s 0.8s 281.4s
Killing Machine wasted: Critical auto attacks 22.8 5.0 45.0 13.5s 1.2s 133.7s
Rune ready 247.0 176.0 322.0 1.3s 0.0s 11.5s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.73% 0.11% 14.80% 0.6s 0.0s 6.6s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=415864)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0631.194 / 0.9852.96420.749
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
16.14535.46866.184 / 64.686102.458172.715

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Remorseless Winter0.7510.0017.3787.9571.55820.841
Horn of Winter15.7880.001128.79156.5420.000164.472
Death and Decay76.7090.077232.10518.8520.000232.105
Empower Rune Weapon19.5136.34632.6790.0050.00032.679
Abomination Limb0.7610.0015.1340.9750.0005.715
Pillar of Frost1.1250.00115.3867.5040.13231.080
Breath of Sindragosa7.3510.001148.08411.4340.000148.084
Raise Dead0.7890.0014.9511.4340.2586.015

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
T29_Death_Knight_Frost
Breath of SindragosaRune10.059.974.03%0.990.080.79%
Empower Rune WeaponRunic Power19.0386.682.09%4.568.458.89%
Empower Rune WeaponRune19.0318.937.66%0.990.100.50%
Frost FeverRunic Power33.67163.143.93%4.855.223.10%
Horn of WinterRunic Power4.96123.982.99%25.000.000.00%
Horn of WinterRune9.929.924.01%1.000.000.01%
Murderous EfficiencyRune34.6134.6114.01%1.000.000.00%
Rage of the Frozen ChampionRunic Power72.31559.9013.50%7.7418.563.21%
Rune RegenerationRune93.0693.0637.67%1.000.000.00%
Rune of HysteriaRunic Power184.97369.688.92%2.0045.5910.98%
Runic AttenuationRunic Power75.12358.588.65%4.7717.004.53%
Runic EmpowermentRune80.9280.5332.60%1.000.390.49%
Arcane TorrentRunic Power1.9037.910.91%20.000.000.00%
Death and DecayRunic Power0.969.570.23%10.000.000.00%
Howling BlastRunic Power72.481.680.04%0.020.000.00%
ObliterateRunic Power117.402287.4755.17%19.4960.462.57%
Remorseless WinterRunic Power15.04147.883.57%9.832.501.66%
pet - ghoul
energy_regenEnergy1099.472012.48100.00%1.83180.088.21%
Usage Type Count Total Avg RPE APR
T29_Death_Knight_Frost
Breath of Sindragosa (_tick)Runic Power 225.953615.1316.0015.951911.77
Death and DecayRune 0.960.961.001.009072.96
Frost StrikeRunic Power 17.15428.8225.0025.001143.20
Howling BlastRune 72.480.170.000.0028185721.74
ObliterateRune 117.40234.792.004.8927412.52
Remorseless WinterRune 15.0415.041.001.00213240.79
pet - ghoul
ClawEnergy 53.852154.0040.0040.0074.00
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 13.82 13.48 157.8 102.5 0.1 144.0
Rune 6.0 0.82 0.84 0.0 2.1 0.0 6.0

Statistics & Data Analysis

Fight Length
T29_Death_Knight_Frost Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
T29_Death_Knight_Frost Damage Per Second
Count 7499
Mean 87078.14
Minimum 71158.76
Maximum 104744.94
Spread ( max - min ) 33586.18
Range [ ( max - min ) / 2 * 100% ] 19.29%
Standard Deviation 4299.1065
5th Percentile 80227.68
95th Percentile 94242.25
( 95th Percentile - 5th Percentile ) 14014.57
Mean Distribution
Standard Deviation 49.6451
95.00% Confidence Interval ( 86980.83 - 87175.44 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 94
0.1% Error 9364
0.1 Scale Factor Error with Delta=300 157776
0.05 Scale Factor Error with Delta=300 631103
0.01 Scale Factor Error with Delta=300 15777569
Priority Target DPS
T29_Death_Knight_Frost Priority Target Damage Per Second
Count 7499
Mean 87078.14
Minimum 71158.76
Maximum 104744.94
Spread ( max - min ) 33586.18
Range [ ( max - min ) / 2 * 100% ] 19.29%
Standard Deviation 4299.1065
5th Percentile 80227.68
95th Percentile 94242.25
( 95th Percentile - 5th Percentile ) 14014.57
Mean Distribution
Standard Deviation 49.6451
95.00% Confidence Interval ( 86980.83 - 87175.44 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 94
0.1% Error 9364
0.1 Scale Factor Error with Delta=300 157776
0.05 Scale Factor Error with Delta=300 631103
0.01 Scale Factor Error with Delta=300 15777569
DPS(e)
T29_Death_Knight_Frost Damage Per Second (Effective)
Count 7499
Mean 87078.14
Minimum 71158.76
Maximum 104744.94
Spread ( max - min ) 33586.18
Range [ ( max - min ) / 2 * 100% ] 19.29%
Damage
T29_Death_Knight_Frost Damage
Count 7499
Mean 25616077.64
Minimum 17398323.66
Maximum 34860002.79
Spread ( max - min ) 17461679.14
Range [ ( max - min ) / 2 * 100% ] 34.08%
DTPS
T29_Death_Knight_Frost Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
T29_Death_Knight_Frost Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
T29_Death_Knight_Frost Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
T29_Death_Knight_Frost Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
T29_Death_Knight_Frost Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
T29_Death_Knight_Frost Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
T29_Death_Knight_FrostTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
T29_Death_Knight_Frost Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
5 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
6 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Estimates a trinkets value by comparing the cooldown of the trinket, divided by the duration of the buff it provides. Has a strength modifier to give a higher priority to strength trinkets, as well as a modifier for if a trinket will or will not sync with cooldowns.
7 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
8 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
9 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
A 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
C 10.66 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
D 0.00 call_action_list,name=trinkets
Choose Action list to run
E 0.00 call_action_list,name=cooldowns
F 0.00 call_action_list,name=racials
G 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
H 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
I 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
J 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
L 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.breath
# count action,conditions
M 10.81 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Breath Active Rotation
N 59.86 howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
O 4.74 horn_of_winter,if=rune<2&runic_power.deficit>25
P 46.98 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
0.00 frostscythe,if=variable.frostscythe_priority&runic_power>45
Q 40.12 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
R 0.96 death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
0.00 remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
S 0.50 howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
T 9.43 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
U 0.69 howling_blast,if=buff.rime.react
V 1.49 arcane_torrent,if=runic_power<60
actions.cooldowns
# count action,conditions
W 1.45 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
X 0.46 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
Y 3.49 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
Z 0.10 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
a 2.89 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
b 0.35 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
c 8.54 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
d 2.86 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
e 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.single_target
# count action,conditions
f 4.23 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
g 13.39 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
h 11.43 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
i 2.23 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
j 7.47 obliterate,if=!variable.pooling_runes
k 0.22 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
l 0.41 arcane_torrent,if=runic_power.deficit>20
m 4.27 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
n 2.17 use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
o 0.78 use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
0.00 use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABaefghgdnYcWPQNPPOQNPNPNPNPNPNMPTNPNPNTTNPNPcNPNPNMPQNQNYQQOPNPPPMQPNQNPcQNQNQNQQNPMNQQNPNPNPNQNVPNMQNcQOQQPNQNQNQaeMPQYnNQNPQPNQNPcNQNQMPNQQNPQNOPNQNQPMNQPPcRghjdNPNPPMNPPNPQNQPQNOPMQQcQPNPPUPQSVQPMPQUPNgjmmgmcaegfCCngChjmhmjhjmmgfmjhmgmmjhcjmgXgimfjhijijhghidPNPT

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask T29_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food T29_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 2 augmentation T29_Death_Knight_Frost 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 4 trinket_1_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 5 trinket_2_sync Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 6 trinket_priority Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 7 rw_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 8 2h_check Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 9 trinket_1_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat A trinket_2_buffs Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
0:00.000 default B auto_attack Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 static_empowerment
0:00.000 cooldowns a abomination_limb Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 bloodlust, killing_machine, static_empowerment
0:00.987 cooldowns e raise_dead Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, killing_machine, rime, static_empowerment
0:00.987 single_target f remorseless_winter Fluffy_Pillow 0.0/144: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, killing_machine, rime, static_empowerment
0:01.975 single_target g obliterate Fluffy_Pillow 15.0/144: 10% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, killing_machine, remorseless_winter, rime, static_empowerment(2)
0:02.961 single_target h howling_blast Fluffy_Pillow 35.0/144: 24% runic_power
3.0/6: 50% rune		 bloodlust, abomination_limb, gathering_storm(2), remorseless_winter, rime, bonegrinder_crit, static_empowerment(3)
0:03.948 single_target g obliterate Fluffy_Pillow 43.0/144: 30% runic_power
3.0/6: 50% rune		 bloodlust, abomination_limb, gathering_storm(3), killing_machine, remorseless_winter, bonegrinder_crit, static_empowerment(4)
0:04.934 cooldowns d breath_of_sindragosa Fluffy_Pillow 63.0/144: 44% runic_power
2.0/6: 33% rune		 bloodlust, abomination_limb, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(2), static_empowerment(5)
0:04.934 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 63.0/144: 44% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(2), static_empowerment(5)
0:04.934 cooldowns Y empower_rune_weapon Fluffy_Pillow 63.0/144: 44% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, breath_of_sindragosa, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(2), bound_by_fire_and_blaze, static_empowerment(5)
0:04.934 cooldowns c pillar_of_frost Fluffy_Pillow 68.0/144: 47% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), killing_machine, remorseless_winter, bonegrinder_crit(2), bound_by_fire_and_blaze, static_empowerment(5)
0:04.934 cooldowns W potion Fluffy_Pillow 68.0/144: 47% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(2), bound_by_fire_and_blaze, static_empowerment(5)
0:04.934 breath P obliterate Fluffy_Pillow 68.0/144: 47% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(2), bound_by_fire_and_blaze, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.794 breath Q obliterate Fluffy_Pillow 93.0/144: 65% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, bound_by_fire_and_blaze, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.654 breath N howling_blast Fluffy_Pillow 97.0/144: 67% runic_power
2.0/6: 33% rune		 bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(9), icy_talons, killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy, bound_by_fire_and_blaze, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.513 breath P obliterate Fluffy_Pillow 89.0/144: 62% runic_power
2.0/6: 33% rune		 bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze, inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.359 breath P obliterate Fluffy_Pillow 93.0/144: 65% runic_power
2.0/6: 33% rune		 bloodlust, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze, inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.207 breath O horn_of_winter Fluffy_Pillow 102.0/144: 71% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze, inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.054 breath Q obliterate Fluffy_Pillow 116.0/144: 81% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze, inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.899 breath N howling_blast Fluffy_Pillow 141.0/144: 98% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze, inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.747 breath P obliterate Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.596 Waiting     0.101 sec 133.0/144: 92% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.697 breath N howling_blast Fluffy_Pillow 133.0/144: 92% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.545 Waiting     0.195 sec 125.0/144: 87% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.740 breath P obliterate Fluffy_Pillow 125.0/144: 87% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.587 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(17), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.434 Waiting     0.298 sec 130.0/144: 90% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.732 breath P obliterate Fluffy_Pillow 130.0/144: 90% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(18), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.580 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(20), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(6), unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.427 breath P obliterate Fluffy_Pillow 120.0/144: 83% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.277 breath N howling_blast Fluffy_Pillow 124.0/144: 86% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.123 Waiting     0.191 sec 121.0/144: 84% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.314 breath P obliterate Fluffy_Pillow 121.0/144: 84% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.163 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:21.023 breath M remorseless_winter Fluffy_Pillow 125.0/144: 87% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:21.882 breath P obliterate Fluffy_Pillow 135.0/144: 94% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.741 Waiting     0.198 sec 128.0/144: 89% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.939 breath T obliterate Fluffy_Pillow 112.0/144: 78% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.798 breath N howling_blast Fluffy_Pillow 136.8/144: 95% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.657 breath P obliterate Fluffy_Pillow 134.2/144: 93% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.518 breath N howling_blast Fluffy_Pillow 134.2/144: 93% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.506 breath P obliterate Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.492 breath N howling_blast Fluffy_Pillow 134.2/144: 93% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.479 Waiting     0.532 sec 128.0/144: 89% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.011 breath T obliterate Fluffy_Pillow 112.0/144: 78% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.997 Waiting     1.053 sec 120.8/144: 84% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.050 breath T obliterate Fluffy_Pillow 104.8/144: 73% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.039 breath N howling_blast Fluffy_Pillow 108.8/144: 76% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.013 breath P obliterate Fluffy_Pillow 100.8/144: 70% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.986 breath N howling_blast Fluffy_Pillow 109.8/144: 76% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:34.959 breath P obliterate Fluffy_Pillow 101.8/144: 71% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:35.933 cooldowns c pillar_of_frost Fluffy_Pillow 121.8/144: 85% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:35.933 breath N howling_blast Fluffy_Pillow 121.8/144: 85% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:36.908 breath P obliterate Fluffy_Pillow 123.8/144: 86% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
0:37.881 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
0:38.855 breath P obliterate Fluffy_Pillow 128.1/144: 89% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
0:39.829 breath N howling_blast Fluffy_Pillow 140.4/144: 97% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
0:40.804 breath M remorseless_winter Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
0:42.289 breath P obliterate Fluffy_Pillow 114.6/144: 80% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
0:43.555 breath Q obliterate Fluffy_Pillow 123.4/144: 86% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
0:44.820 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
0.0/6: 0% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
0:46.103 Waiting     0.949 sec 110.9/144: 77% runic_power
0.0/6: 0% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
0:47.052 breath Q obliterate Fluffy_Pillow 99.9/144: 69% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
0:48.335 breath N howling_blast Fluffy_Pillow 103.9/144: 72% runic_power
0.0/6: 0% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:49.619 Waiting     1.362 sec 95.9/144: 67% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:50.981 cooldowns Y empower_rune_weapon Fluffy_Pillow 63.9/144: 44% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:50.981 breath Q obliterate Fluffy_Pillow 68.9/144: 48% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:52.098 breath Q obliterate Fluffy_Pillow 72.9/144: 51% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:53.214 Waiting     0.767 sec 76.9/144: 53% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:53.981 breath O horn_of_winter Fluffy_Pillow 60.9/144: 42% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:55.325 breath P obliterate Fluffy_Pillow 74.9/144: 52% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:56.440 breath N howling_blast Fluffy_Pillow 83.9/144: 58% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:57.558 breath P obliterate Fluffy_Pillow 80.9/144: 56% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:58.658 breath P obliterate Fluffy_Pillow 84.9/144: 59% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:59.757 breath P obliterate Fluffy_Pillow 88.9/144: 62% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:00.857 breath M remorseless_winter Fluffy_Pillow 102.9/144: 71% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:02.124 breath Q obliterate Fluffy_Pillow 85.9/144: 60% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:03.224 breath P obliterate Fluffy_Pillow 94.9/144: 66% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:04.325 breath N howling_blast Fluffy_Pillow 98.9/144: 69% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:05.427 breath Q obliterate Fluffy_Pillow 92.8/144: 64% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:06.526 breath N howling_blast Fluffy_Pillow 107.8/144: 75% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:07.626 breath P obliterate Fluffy_Pillow 108.0/144: 75% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:08.726 cooldowns c pillar_of_frost Fluffy_Pillow 116.8/144: 81% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:08.726 breath Q obliterate Fluffy_Pillow 116.8/144: 81% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:09.827 breath N howling_blast Fluffy_Pillow 125.6/144: 87% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:10.929 breath Q obliterate Fluffy_Pillow 125.7/144: 87% runic_power
5.0/6: 83% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:12.029 breath N howling_blast Fluffy_Pillow 123.2/144: 86% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:13.295 breath Q obliterate Fluffy_Pillow 115.2/144: 80% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:14.561 breath N howling_blast Fluffy_Pillow 119.2/144: 83% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:15.843 breath Q obliterate Fluffy_Pillow 121.2/144: 84% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:17.125 breath Q obliterate Fluffy_Pillow 109.2/144: 76% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:18.408 breath N howling_blast Fluffy_Pillow 118.2/144: 82% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), remorseless_winter, rime, enduring_strength_builder(4), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:19.672 breath P obliterate Fluffy_Pillow 110.2/144: 77% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, enduring_strength_builder(4), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:20.937 breath M remorseless_winter Fluffy_Pillow 98.2/144: 68% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:22.289 breath N howling_blast Fluffy_Pillow 97.2/144: 68% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:23.554 breath Q obliterate Fluffy_Pillow 89.2/144: 62% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:24.822 breath Q obliterate Fluffy_Pillow 93.2/144: 65% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:26.087 breath N howling_blast Fluffy_Pillow 81.2/144: 56% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:27.352 breath P obliterate Fluffy_Pillow 83.2/144: 58% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:28.616 breath N howling_blast Fluffy_Pillow 87.2/144: 61% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:29.881 Waiting     0.093 sec 84.2/144: 58% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:29.974 breath P obliterate Fluffy_Pillow 68.2/144: 47% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:31.257 breath N howling_blast Fluffy_Pillow 72.2/144: 50% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:32.541 breath P obliterate Fluffy_Pillow 69.2/144: 48% runic_power
2.0/6: 33% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:33.824 breath N howling_blast Fluffy_Pillow 78.0/144: 54% runic_power
1.0/6: 17% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:35.106 breath Q obliterate Fluffy_Pillow 62.1/144: 43% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:36.389 breath N howling_blast Fluffy_Pillow 77.1/144: 54% runic_power
1.0/6: 17% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:37.673 Waiting     0.316 sec 71.0/144: 49% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:37.989 breath V arcane_torrent Fluffy_Pillow 55.0/144: 38% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:39.256 breath P obliterate Fluffy_Pillow 63.8/144: 44% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:40.520 breath N howling_blast Fluffy_Pillow 72.6/144: 50% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:41.788 breath M remorseless_winter Fluffy_Pillow 64.6/144: 45% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:43.052 breath Q obliterate Fluffy_Pillow 47.6/144: 33% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, icy_talons(3), remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:44.317 breath N howling_blast Fluffy_Pillow 51.6/144: 36% runic_power
2.0/6: 33% rune		 breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
1:45.583 cooldowns c pillar_of_frost Fluffy_Pillow 53.6/144: 37% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:45.583 breath Q obliterate Fluffy_Pillow 53.6/144: 37% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:46.848 breath O horn_of_winter Fluffy_Pillow 62.4/144: 43% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:48.114 breath Q obliterate Fluffy_Pillow 67.6/144: 47% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
1:49.380 breath Q obliterate Fluffy_Pillow 76.4/144: 53% runic_power
2.0/6: 33% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
1:50.662 Waiting     0.881 sec 85.2/144: 59% runic_power
1.0/6: 17% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
1:51.543 breath P obliterate Fluffy_Pillow 69.2/144: 48% runic_power
2.0/6: 33% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:52.825 breath N howling_blast Fluffy_Pillow 78.0/144: 54% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
1:54.106 breath Q obliterate Fluffy_Pillow 61.0/144: 42% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), static_empowerment(5)
1:55.390 breath N howling_blast Fluffy_Pillow 65.0/144: 45% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(5), unleashed_frenzy(3), static_empowerment(5)
1:56.671 breath Q obliterate Fluffy_Pillow 62.0/144: 43% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:57.955 breath N howling_blast Fluffy_Pillow 50.0/144: 35% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:59.239 breath Q obliterate Fluffy_Pillow 42.0/144: 29% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:00.522 cooldowns a abomination_limb Fluffy_Pillow 56.0/144: 39% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:01.803 cooldowns e raise_dead Fluffy_Pillow 40.0/144: 28% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:01.803 breath M remorseless_winter Fluffy_Pillow 40.0/144: 28% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:03.086 breath P obliterate Fluffy_Pillow 18.0/144: 12% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:04.353 breath Q obliterate Fluffy_Pillow 33.0/144: 23% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:04.935 cooldowns Y empower_rune_weapon Fluffy_Pillow 41.8/144: 29% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:05.620 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 48.0/144: 33% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:05.620 breath N howling_blast Fluffy_Pillow 48.0/144: 33% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:06.719 breath Q obliterate Fluffy_Pillow 41.9/144: 29% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:07.820 breath N howling_blast Fluffy_Pillow 56.9/144: 39% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(7), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:08.922 breath P obliterate Fluffy_Pillow 50.8/144: 35% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:10.023 breath Q obliterate Fluffy_Pillow 56.0/144: 39% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:11.121 breath P obliterate Fluffy_Pillow 64.8/144: 45% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:12.220 Waiting     1.371 sec 79.8/144: 55% runic_power
0.0/6: 0% rune		 unholy_strength, abomination_limb, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5)
2:13.591 breath N howling_blast Fluffy_Pillow 68.8/144: 48% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5)
2:14.692 breath Q obliterate Fluffy_Pillow 65.8/144: 46% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
2:15.810 breath N howling_blast Fluffy_Pillow 74.8/144: 52% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
2:16.926 breath P obliterate Fluffy_Pillow 66.8/144: 46% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
2:18.042 cooldowns c pillar_of_frost Fluffy_Pillow 64.8/144: 45% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:18.042 breath N howling_blast Fluffy_Pillow 64.8/144: 45% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:19.158 breath Q obliterate Fluffy_Pillow 61.8/144: 43% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:20.275 breath N howling_blast Fluffy_Pillow 70.8/144: 49% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5)
2:21.375 breath Q obliterate Fluffy_Pillow 62.8/144: 44% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit, enduring_strength_builder, unleashed_frenzy(3), bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5)
2:22.476 breath M remorseless_winter Fluffy_Pillow 71.8/144: 50% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5)
2:23.576 breath P obliterate Fluffy_Pillow 65.8/144: 46% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit, enduring_strength_builder(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5)
2:24.675 breath N howling_blast Fluffy_Pillow 74.8/144: 52% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5)
2:25.775 breath Q obliterate Fluffy_Pillow 76.8/144: 53% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(2), enduring_strength_builder(3), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:27.042 breath Q obliterate Fluffy_Pillow 64.8/144: 45% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(4), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:28.308 breath N howling_blast Fluffy_Pillow 73.8/144: 51% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:29.573 breath P obliterate Fluffy_Pillow 65.8/144: 46% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(5), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:30.838 breath Q obliterate Fluffy_Pillow 69.8/144: 48% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:32.105 breath N howling_blast Fluffy_Pillow 57.8/144: 40% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:33.370 breath O horn_of_winter Fluffy_Pillow 54.8/144: 38% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:34.637 breath P obliterate Fluffy_Pillow 63.8/144: 44% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:35.902 breath N howling_blast Fluffy_Pillow 67.8/144: 47% runic_power
4.0/6: 67% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:37.168 breath Q obliterate Fluffy_Pillow 48.8/144: 34% runic_power
5.0/6: 83% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:38.433 breath N howling_blast Fluffy_Pillow 57.6/144: 40% runic_power
5.0/6: 83% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:39.699 breath Q obliterate Fluffy_Pillow 51.5/144: 36% runic_power
5.0/6: 83% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:40.963 breath P obliterate Fluffy_Pillow 44.3/144: 31% runic_power
4.0/6: 67% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:42.246 breath M remorseless_winter Fluffy_Pillow 65.5/144: 45% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:43.742 breath N howling_blast Fluffy_Pillow 61.9/144: 43% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
2:45.006 breath Q obliterate Fluffy_Pillow 46.0/144: 32% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm, icy_talons(3), remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:46.272 breath P obliterate Fluffy_Pillow 50.0/144: 35% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:47.538 Waiting     0.664 sec 54.0/144: 38% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:48.202 breath P obliterate Fluffy_Pillow 38.0/144: 26% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:49.468 Waiting     0.378 sec 42.0/144: 29% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:49.846 cooldowns c pillar_of_frost Fluffy_Pillow 42.0/144: 29% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:50.042 Waiting     0.843 sec 26.0/144: 18% runic_power
0.0/6: 0% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:50.885 breath R death_and_decay Fluffy_Pillow 26.0/144: 18% runic_power
1.0/6: 17% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, pillar_of_frost, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:52.150 single_target g obliterate Fluffy_Pillow 9.0/144: 6% runic_power
3.0/6: 50% rune		 unholy_strength, gathering_storm(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:53.417 single_target h howling_blast Fluffy_Pillow 34.0/144: 24% runic_power
1.0/6: 17% rune		 unholy_strength, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:54.684 single_target j obliterate Fluffy_Pillow 47.0/144: 33% runic_power
2.0/6: 33% rune		 unholy_strength, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder, unleashed_frenzy(3), static_empowerment(5)
2:55.966 cooldowns d breath_of_sindragosa Fluffy_Pillow 67.0/144: 47% runic_power
0.0/6: 0% rune		 rune_mastery, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:55.966 breath N howling_blast Fluffy_Pillow 67.0/144: 47% runic_power
2.0/6: 33% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:57.250 breath P obliterate Fluffy_Pillow 73.4/144: 51% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(3), enduring_strength_builder(2), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:58.533 breath N howling_blast Fluffy_Pillow 82.2/144: 57% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), rime, bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
2:59.816 breath P obliterate Fluffy_Pillow 82.3/144: 57% runic_power
5.0/6: 83% rune		 rune_mastery, breath_of_sindragosa, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), bonegrinder_crit(4), enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:01.098 breath P obliterate Fluffy_Pillow 75.1/144: 52% runic_power
4.0/6: 67% rune		 rune_mastery, breath_of_sindragosa, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), bonegrinder_crit(5), enduring_strength_builder(4), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:02.363 breath M remorseless_winter Fluffy_Pillow 83.9/144: 58% runic_power
2.0/6: 33% rune		 rune_mastery, breath_of_sindragosa, icy_talons(3), killing_machine, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:03.742 breath N howling_blast Fluffy_Pillow 80.3/144: 56% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:05.007 Waiting     0.102 sec 58.2/144: 40% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:05.109 breath P obliterate Fluffy_Pillow 58.2/144: 40% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm, icy_talons(3), killing_machine, remorseless_winter, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:06.374 Waiting     1.923 sec 73.2/144: 51% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:08.297 breath P obliterate Fluffy_Pillow 46.2/144: 32% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:09.564 breath N howling_blast Fluffy_Pillow 50.2/144: 35% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:10.829 breath P obliterate Fluffy_Pillow 42.2/144: 29% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(6), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:12.095 breath Q obliterate Fluffy_Pillow 40.2/144: 28% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:13.360 breath N howling_blast Fluffy_Pillow 44.2/144: 31% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:14.624 breath Q obliterate Fluffy_Pillow 36.2/144: 25% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:15.889 breath P obliterate Fluffy_Pillow 45.2/144: 31% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:17.155 breath Q obliterate Fluffy_Pillow 33.2/144: 23% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:18.421 breath N howling_blast Fluffy_Pillow 42.2/144: 29% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:19.687 breath O horn_of_winter Fluffy_Pillow 34.2/144: 24% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
3:20.970 breath P obliterate Fluffy_Pillow 27.2/144: 19% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
3:22.252 breath M remorseless_winter Fluffy_Pillow 31.2/144: 22% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), rime, bonegrinder_crit(5), unleashed_frenzy(3), static_empowerment(5)
3:23.757 breath Q obliterate Fluffy_Pillow 30.2/144: 21% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, icy_talons(3), remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:25.024 breath Q obliterate Fluffy_Pillow 18.2/144: 13% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(5), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:26.290 cooldowns c pillar_of_frost Fluffy_Pillow 22.2/144: 15% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:26.290 breath Q obliterate Fluffy_Pillow 22.2/144: 15% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(4), icy_talons(3), pillar_of_frost, remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:27.554 breath P obliterate Fluffy_Pillow 36.2/144: 25% runic_power
3.0/6: 50% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), remorseless_winter, rime, bonegrinder_frost, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:28.820 breath N howling_blast Fluffy_Pillow 46.4/144: 32% runic_power
2.0/6: 33% rune		 unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:30.087 breath P obliterate Fluffy_Pillow 24.3/144: 17% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder, unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:31.353 Waiting     0.641 sec 33.1/144: 23% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:31.994 breath P obliterate Fluffy_Pillow 17.1/144: 12% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:33.258 breath U howling_blast Fluffy_Pillow 32.1/144: 22% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:34.523 Waiting     0.194 sec 26.0/144: 18% runic_power
1.0/6: 17% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:34.717 breath P obliterate Fluffy_Pillow 26.0/144: 18% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:36.000 breath Q obliterate Fluffy_Pillow 18.8/144: 13% runic_power
2.0/6: 33% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), remorseless_winter, bonegrinder_crit(4), enduring_strength_builder(4), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:37.283 breath S howling_blast Fluffy_Pillow 27.6/144: 19% runic_power
0.0/6: 0% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), remorseless_winter, rime, bonegrinder_crit(4), enduring_strength_builder(5), unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:38.566 breath V arcane_torrent Fluffy_Pillow 27.8/144: 19% runic_power
1.0/6: 17% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:39.849 breath Q obliterate Fluffy_Pillow 36.6/144: 25% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:41.132 breath P obliterate Fluffy_Pillow 29.4/144: 20% runic_power
3.0/6: 50% rune		 rune_mastery, breath_of_sindragosa, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:42.415 breath M remorseless_winter Fluffy_Pillow 33.4/144: 23% runic_power
2.0/6: 33% rune		 rune_mastery, breath_of_sindragosa, icy_talons(3), killing_machine, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:43.760 breath P obliterate Fluffy_Pillow 29.8/144: 21% runic_power
4.0/6: 67% rune		 rune_mastery, breath_of_sindragosa, icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:45.042 breath Q obliterate Fluffy_Pillow 22.6/144: 16% runic_power
3.0/6: 50% rune		 breath_of_sindragosa, gathering_storm(2), icy_talons(3), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:46.323 breath U howling_blast Fluffy_Pillow 31.4/144: 22% runic_power
1.0/6: 17% rune		 breath_of_sindragosa, gathering_storm(4), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:47.606 breath P obliterate Fluffy_Pillow 31.5/144: 22% runic_power
2.0/6: 33% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(5), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:48.888 breath N howling_blast Fluffy_Pillow 40.3/144: 28% runic_power
0.0/6: 0% rune		 rune_mastery, breath_of_sindragosa, gathering_storm(7), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), rune_of_hysteria, static_empowerment(5)
3:50.171 Waiting     0.865 sec 18.2/144: 13% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, breath_of_sindragosa, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:51.036 single_target g obliterate Fluffy_Pillow 7.2/144: 5% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:52.319 single_target j obliterate Fluffy_Pillow 27.2/144: 19% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:53.601 single_target m frost_strike Fluffy_Pillow 52.2/144: 36% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:54.868 single_target m frost_strike Fluffy_Pillow 33.4/144: 23% runic_power
0.0/6: 0% rune		 unholy_strength, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:56.134 single_target g obliterate Fluffy_Pillow 8.4/144: 6% runic_power
2.0/6: 33% rune		 unholy_strength, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:57.400 single_target m frost_strike Fluffy_Pillow 39.4/144: 27% runic_power
1.0/6: 17% rune		 unholy_strength, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
3:58.667 Waiting     1.454 sec 14.4/144: 10% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:00.121 cooldowns c pillar_of_frost Fluffy_Pillow 14.4/144: 10% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:00.290 cooldowns a abomination_limb Fluffy_Pillow 20.6/144: 14% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:01.787 cooldowns e raise_dead Fluffy_Pillow 20.6/144: 14% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:01.803 single_target g obliterate Fluffy_Pillow 20.6/144: 14% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:03.070 single_target f remorseless_winter Fluffy_Pillow 40.6/144: 28% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:04.336 default C frost_strike Fluffy_Pillow 50.6/144: 35% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, inspired_by_fire_and_earth, static_empowerment(5)
4:05.601 default C frost_strike Fluffy_Pillow 25.6/144: 18% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, icy_talons, killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy, static_empowerment(5)
4:06.884 trinkets n use_item_blazebinders_hoof Fluffy_Pillow 5.6/144: 4% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(2), static_empowerment(5)
4:06.884 single_target g obliterate Fluffy_Pillow 5.6/144: 4% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), remorseless_winter, rime, bonegrinder_crit(5), enduring_strength_builder, unleashed_frenzy(2), bound_by_fire_and_blaze, static_empowerment(5)
4:08.166 default C frost_strike Fluffy_Pillow 25.6/144: 18% runic_power
0.0/6: 0% rune		 unholy_strength, abomination_limb, gathering_storm(2), icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(2), bound_by_fire_and_blaze(3), static_empowerment(5)
4:09.449 single_target h howling_blast Fluffy_Pillow 0.6/144: 0% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), remorseless_winter, rime, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(3), static_empowerment(5)
4:10.731 single_target j obliterate Fluffy_Pillow 13.6/144: 9% runic_power
2.0/6: 33% rune		 unholy_strength, abomination_limb, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), remorseless_winter, bonegrinder_frost, enduring_strength_builder(2), unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), static_empowerment(5)
4:12.013 single_target m frost_strike Fluffy_Pillow 43.6/144: 30% runic_power
0.0/6: 0% rune		 unholy_strength, abomination_limb, gathering_storm(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), static_empowerment(5)
4:13.296 Waiting     0.103 sec 18.6/144: 13% runic_power
1.0/6: 17% rune		 unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), static_empowerment(5)
4:13.399 single_target h howling_blast Fluffy_Pillow 18.6/144: 13% runic_power
1.0/6: 17% rune		 unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), static_empowerment(5)
4:14.680 single_target m frost_strike Fluffy_Pillow 31.6/144: 22% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:15.963 single_target j obliterate Fluffy_Pillow 6.6/144: 5% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:17.246 single_target h howling_blast Fluffy_Pillow 31.4/144: 22% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:18.529 single_target j obliterate Fluffy_Pillow 53.7/144: 37% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:19.812 single_target m frost_strike Fluffy_Pillow 78.5/144: 55% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:21.096 single_target m frost_strike Fluffy_Pillow 59.7/144: 41% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:22.379 single_target g obliterate Fluffy_Pillow 34.7/144: 24% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), rune_of_hysteria, static_empowerment(5)
4:23.661 single_target f remorseless_winter Fluffy_Pillow 64.5/144: 45% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
4:24.943 single_target m frost_strike Fluffy_Pillow 79.5/144: 55% runic_power
0.0/6: 0% rune		 rune_mastery, icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:26.226 single_target j obliterate Fluffy_Pillow 54.5/144: 38% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
4:27.507 single_target h howling_blast Fluffy_Pillow 79.5/144: 55% runic_power
1.0/6: 17% rune		 rune_mastery, gathering_storm(2), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:28.789 single_target m frost_strike Fluffy_Pillow 92.5/144: 64% runic_power
1.0/6: 17% rune		 rune_mastery, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:30.055 single_target g obliterate Fluffy_Pillow 67.5/144: 47% runic_power
3.0/6: 50% rune		 rune_mastery, gathering_storm(3), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:31.322 single_target m frost_strike Fluffy_Pillow 92.3/144: 64% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:32.589 single_target m frost_strike Fluffy_Pillow 67.3/144: 47% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:33.853 single_target j obliterate Fluffy_Pillow 42.3/144: 29% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:35.119 single_target h howling_blast Fluffy_Pillow 67.1/144: 47% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, gathering_storm(7), icy_talons(3), remorseless_winter, rime, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:36.383 cooldowns c pillar_of_frost Fluffy_Pillow 83.2/144: 58% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:36.383 single_target j obliterate Fluffy_Pillow 83.2/144: 58% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, rune_of_hysteria, static_empowerment(5)
4:37.648 single_target m frost_strike Fluffy_Pillow 108.0/144: 75% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:38.915 single_target g obliterate Fluffy_Pillow 88.0/144: 61% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(4), enduring_strength_builder, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:40.181 cooldowns X empower_rune_weapon Fluffy_Pillow 108.0/144: 75% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
4:40.181 single_target g obliterate Fluffy_Pillow 113.0/144: 78% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(5), enduring_strength_builder(2), unleashed_frenzy(3), static_empowerment(5)
4:41.296 single_target i frost_strike Fluffy_Pillow 133.0/144: 92% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
4:42.413 single_target m frost_strike Fluffy_Pillow 113.0/144: 79% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
4:43.529 single_target f remorseless_winter Fluffy_Pillow 88.0/144: 61% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), static_empowerment(5)
4:44.777 single_target j obliterate Fluffy_Pillow 103.0/144: 72% runic_power
2.0/6: 33% rune		 unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), remorseless_winter, bonegrinder_frost, enduring_strength_builder(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:45.891 single_target h howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
3.0/6: 50% rune		 empower_rune_weapon, gathering_storm(2), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(9), remorseless_winter, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:47.009 single_target i frost_strike Fluffy_Pillow 136.0/144: 94% runic_power
3.0/6: 50% rune		 empower_rune_weapon, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:48.127 single_target j obliterate Fluffy_Pillow 116.0/144: 81% runic_power
4.0/6: 67% rune		 empower_rune_weapon, gathering_storm(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:49.242 single_target i frost_strike Fluffy_Pillow 136.0/144: 94% runic_power
2.0/6: 33% rune		 empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:50.360 single_target j obliterate Fluffy_Pillow 116.0/144: 81% runic_power
4.0/6: 67% rune		 empower_rune_weapon, gathering_storm(5), icy_talons(3), remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:51.477 single_target h howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 empower_rune_weapon, gathering_storm(7), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
4:52.592 single_target g obliterate Fluffy_Pillow 144.0/144: 100% runic_power
2.0/6: 33% rune		 empower_rune_weapon, gathering_storm(8), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
4:53.709 single_target h howling_blast Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
4:54.826 single_target i frost_strike Fluffy_Pillow 144.0/144: 100% runic_power
1.0/6: 17% rune		 empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
4:55.943 cooldowns d breath_of_sindragosa Fluffy_Pillow 125.2/144: 87% runic_power
3.0/6: 50% rune		 empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
4:55.966 breath P obliterate Fluffy_Pillow 125.2/144: 87% runic_power
5.0/6: 83% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
4:57.083 breath N howling_blast Fluffy_Pillow 128.0/144: 89% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
4:58.198 breath P obliterate Fluffy_Pillow 121.9/144: 85% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), killing_machine, remorseless_winter, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, rune_of_hysteria, static_empowerment(5)
4:59.316 Waiting     0.664 sec 128.0/144: 89% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, empower_rune_weapon, gathering_storm(10), icy_talons(3), remorseless_winter, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:59.980 breath T obliterate Fluffy_Pillow 117.0/144: 81% runic_power
4.0/6: 67% rune		 breath_of_sindragosa, empower_rune_weapon, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 2089 -3 7754 7448 4869 (4044)
Agility 1734 1 1821 1735 0
Stamina 3463 0 21039 20037 13235
Intellect 1128 2 1276 1130 0
Spirit 0 0 0 0 0
Health 420780 400740 0
Runic Power 144 144 0
Rune 6 6 0
Spell Power 1276 1130 0
Crit 36.48% 36.48% 5126
Haste 17.29% 17.29% 2940
Versatility 3.85% 0.85% 174
Attack Power 8142 7448 0
Mastery 59.55% 59.55% 3919
Armor 7154 7154 7154
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 421.00
Local Head Maw of the Haunted Frostbrood
ilevel: 424, stats: { 948 Armor, +1383 Sta, +236 Haste, +550 Mastery, +512 StrInt }, gems: { +70 Crit, +33 Mastery }
Local Neck Elemental Lariat
ilevel: 418, stats: { +722 Sta, +592 Crit, +592 Mastery }, gems: { +70 Crit, +33 Mastery, +70 Crit, +33 Mastery, +70 Crit, +33 Mastery }
item effects: { equip: Elemental Lariat }
Local Shoulders Jaws of the Haunted Frostbrood
ilevel: 424, stats: { 869 Armor, +1037 Sta, +392 Crit, +198 Haste, +384 StrInt }
Local Chest Breastplate of the Haunted Frostbrood
ilevel: 421, stats: { 1240 Armor, +1333 Sta, +254 Crit, +520 Mastery, +498 StrInt }, enchant: { +150 StrAgiInt }
Local Waist Primal Molten Greatbelt
ilevel: 418, stats: { 684 Armor, +962 Sta, +286 Mastery, +286 Haste, +363 StrInt }, gems: { +70 Crit, +33 Mastery }
item effects: { equip: Blue Silken Lining }
Local Legs Greaves of the God-King
ilevel: 421, stats: { 1085 Armor, +1333 Sta, +537 Crit, +238 Mastery, +498 StrInt }, enchant: { +105 Sta, +177 StrAgi }
Local Feet Stonestep Boots
ilevel: 421, stats: { 775 Armor, +1000 Sta, +228 Crit, +436 Mastery, +374 StrInt }
Local Wrists Vambraces of the Haunted Frostbrood
ilevel: 424, stats: { 632 Armor, +778 Sta, +144 Crit, +298 Haste, +288 StrInt }, gems: { +70 Crit, +33 Mastery }
Local Hands Grasps of the Haunted Frostbrood
ilevel: 421, stats: { 697 Armor, +1000 Sta, +407 Haste, +174 Vers, +374 StrInt }
Local Finger1 Platinum Star Band
ilevel: 421, stats: { +750 Sta, +795 Crit, +415 Mastery }, gems: { +70 Crit, +33 Mastery }, enchant: { +82 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 421, stats: { +750 Sta, +553 Crit, +657 Haste }, gems: { +70 Crit, +33 Mastery }, enchant: { +82 Mastery }
item effects: { equip: Signet of Melandrus }
Local Trinket1 Blazebinder's Hoof
ilevel: 421, stats: { +553 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Whispering Incarnate Icon
ilevel: 421, stats: { +473 StrAgiInt }
item effects: { equip: Whispering Incarnate Icon }
Local Back Goldscar Pelt
ilevel: 421, stats: { 224 Armor, +750 Sta, +131 Crit, +305 Haste, +280 StrAgiInt }
Local Main Hand Strike Twice
ilevel: 421, weapon: { 551 - 921, 2.6 }, stats: { +249 Str, +666 Sta, +160 Crit, +227 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 421, weapon: { 551 - 921, 2.6 }, stats: { +249 Str, +666 Sta, +160 Crit, +227 Mastery }, enchant: rune_of_hysteria, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Talents

Talent Tables

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="T29_Death_Knight_Frost"
source=default
spec=frost
level=70
race=blood_elf
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkIAgkkIBSQkkkEiISSkEEQiIRSSSSSSa5AAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
# Estimates a trinkets value by comparing the cooldown of the trinket, divided by the duration of the buff it provides. Has a strength modifier to give a higher priority to strength trinkets, as well as a modifier for if a trinket will or will not sync with cooldowns.
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets=use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

head=maw_of_the_haunted_frostbrood,id=200408,bonus_id=4800/4786/1498/6935,gem_id=192922
neck=elemental_lariat,id=193001,bonus_id=6652/7936/7979/1540/8767/8782,gem_id=192922/192922/192922,crafted_stats=32/49
shoulders=jaws_of_the_haunted_frostbrood,id=200410,bonus_id=4800/4786/1498
back=goldscar_pelt,id=133639,bonus_id=1795/6808/4786/3300,ilevel=421,drop_level=70
chest=breastplate_of_the_haunted_frostbrood,id=200405,bonus_id=4800/4786/1498,enchant_id=6625
wrists=vambraces_of_the_haunted_frostbrood,id=200412,bonus_id=1507/6935,gem_id=192922
hands=grasps_of_the_haunted_frostbrood,id=200407,bonus_id=4800/4786/1498
waist=primal_molten_greatbelt,id=190501,bonus_id=8836/8840/8902/8802/8793/8932/8960/6935,ilevel=418,gem_id=192922,crafted_stats=36/40
legs=greaves_of_the_godking,id=133630,bonus_id=1795/6808/4786/3300,ilevel=421,enchant_id=6490,drop_level=70
feet=stonestep_boots,id=143974,bonus_id=4177/6808/4786/3311,ilevel=421,drop_level=70
finger1=platinum_star_band,id=193708,bonus_id=6808/4786/1643/6935,gem_id=192922,enchant_id=6562
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/6808/4786/3300/6935,ilevel=421,gem_id=192922,enchant_id=6562,drop_level=70
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1643
trinket2=whispering_incarnate_icon,id=194301,bonus_id=4800/4786/1498
main_hand=strike_twice,id=193700,bonus_id=6652/1643/8767,enchant=rune_of_the_fallen_crusader
off_hand=strike_twice,id=193700,bonus_id=6652/1643/8767,enchant=rune_of_hysteria

# Gear Summary
# gear_ilvl=421.19
# gear_strength=4869
# gear_stamina=13235
# gear_crit_rating=5126
# gear_haste_rating=2940
# gear_mastery_rating=3919
# gear_versatility_rating=174
# gear_armor=7154
# set_bonus=tier29_2pc=1
# set_bonus=tier29_4pc=1

T29_Death_Knight_Frost_2h : 86720 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
86719.7 86719.7 83.6 / 0.096% 14274.1 / 16.5% 9420.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.0 9.3 Runic Power 0.43% 59.0 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAkEBASSiEIBRSSSIiIJRSSAkQSCQSSSKJBAAAAAAAAAAAA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T29_Death_Knight_Frost_2h 86720
Abomination Limb 0 (914) 0.0% (1.0%) 3.0 122.44sec 91095 84659

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 1.0761 0.0000 0.00 0.00 0.00% 84658.76 84658.76

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [Q]:2.98
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    Abomination Limb (_damage) 914 1.0% 38.1 6.99sec 7133 0 Direct 38.1 5381 11053 7133 30.9%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.10 38.10 0.00 0.00 0.00 0.0000 0.0000 271754.62 271754.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.11% 26.33 9 36 5381.50 3448 9835 5383.45 4358 6702 141687 141687 0.00%
crit 30.89% 11.77 2 23 11052.95 7034 19603 11054.54 8562 14421 130068 130068 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 5646 6.5% 161.6 2.24sec 10473 4709 Direct 161.6 7899 16140 10473 31.2%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 161.57 161.57 0.00 0.00 0.00 2.2241 0.0000 1692088.94 2417331.54 30.00% 4708.76 4708.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.77% 111.11 75 155 7898.97 4997 14222 7900.58 7418 8484 877659 1253830 30.00%
crit 31.23% 50.46 25 86 16140.14 10193 28383 16140.99 14765 17797 814430 1163501 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Burnout Wave 1143 1.3% 2.9 123.52sec 117455 0 Direct 2.7 95074 194060 126310 31.6%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.72 0.00 0.00 0.00 0.0000 0.0000 343673.14 343673.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.45% 1.86 0 3 95073.76 35437 106310 90454.46 0 106310 177079 177079 0.00%
crit 31.55% 0.86 0 3 194060.05 72291 216872 124293.77 0 216872 166594 166594 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16070.92
  • base_dd_max:16070.92
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=25627} Fire damage split between all nearby enemies, based on the strength of your binding.}
Cold Heart 2822 3.3% 8.3 34.53sec 102502 0 Direct 8.3 77645 157933 102507 31.0%

Stats Details: Cold Heart

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.00 0.0000 0.0000 847396.31 847396.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.04% 5.71 0 11 77644.82 3053 142891 77916.79 0 114556 443161 443161 0.00%
crit 30.96% 2.56 0 9 157932.90 6942 301303 150108.97 0 271079 404236 404236 0.00%

Action Details: Cold Heart

  • id:281210
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:281210
  • name:Cold Heart
  • school:frost
  • tooltip:
  • description:{$@spelldesc281208=Every {$t1=2} sec, gain a stack of Cold Heart, causing your next Chains of Ice to deal {$281210s1=0} Frost damage. Stacks up to {$281209u=20} times.}
Frost Fever 3615 4.2% 34.9 8.58sec 31048 0 Periodic 99.0 8281 16854 10962 31.3% 98.9%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.94 0.00 98.96 98.96 33.85 0.0000 2.9986 1084765.11 1084765.11 0.00% 3655.61 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 68.73% 68.01 40 98 8280.62 6 15886 8280.49 7577 9071 563176 563176 0.00%
crit 31.27% 30.95 12 52 16853.73 39 31900 16853.68 14479 19140 521589 521589 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 14591 16.8% 108.0 2.76sec 40495 36902 Direct 108.0 30583 62263 40496 31.3%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 108.01 108.01 0.00 0.00 0.00 1.0974 0.0000 4374033.10 4374033.10 0.00% 36901.71 36901.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.71% 74.22 49 103 30583.38 14667 60245 30603.11 27689 33545 2269789 2269789 0.00%
crit 31.29% 33.80 12 60 62262.75 29922 134108 62223.89 52931 73029 2104244 2104244 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [C]:13.49
  • if_expr:active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
    obliteration
    [V]:2.32
  • if_expr:!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    obliteration
    [X]:46.26
  • if_expr:!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    obliteration
    [Z]:3.07
  • if_expr:!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [d]:35.02
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [f]:7.86
  • if_expr:!variable.pooling_runic_power
Frostwhelp's Aid 281 0.3% 9.7 32.19sec 8717 0 Direct 9.7 6613 13455 8717 30.7%

Stats Details: Frostwhelps Aid

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 9.68 0.00 0.00 0.00 0.0000 0.0000 84368.53 84368.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.26% 6.70 1 12 6613.28 4203 12263 6611.68 4966 8948 44330 44330 0.00%
crit 30.74% 2.98 0 10 13454.67 8573 24395 13026.23 0 24395 40038 40038 0.00%

Action Details: Frostwhelps Aid

  • id:377245
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377245
  • name:Frostwhelp's Aid
  • school:frost
  • tooltip:
  • description:{$@spelldesc377226=Pillar of Frost summons a Frostwhelp who breathes on all enemies within {$s2=40} yards in front of you for {$377245s1=0} Frost damage. Each unique enemy hit by Frostwhelp's Aid grants you {$=}{{$s3=1}*2}% Mastery for {$287338d=15 seconds}, up to {$=}{{$s3=1}*2*{$377253u=5}}%. }
Howling Blast 5048 (6369) 5.8% (7.3%) 34.9 8.58sec 54669 49474 Direct 34.9 (69.5) 32728 66730 43334 31.2% (31.2%)

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.94 34.94 0.00 0.00 0.00 1.1050 0.0000 1514046.07 1514046.07 0.00% 49473.60 49473.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.81% 24.04 10 43 32728.26 7298 69896 32721.69 26706 38044 786817 786817 0.00%
crit 31.19% 10.90 2 26 66730.31 15406 130643 66712.12 47205 85894 727229 727229 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    obliteration
    [U]:0.33
  • if_expr:!dot.frost_fever.ticking&!buff.killing_machine.react
    obliteration
    [W]:3.00
  • if_expr:buff.rime.react&buff.killing_machine.react
    obliteration
    [Y]:0.88
  • if_expr:!buff.killing_machine.react&runic_power<25
    obliteration
    [a]:0.00
  • if_expr:buff.rime.react
    single_target
    [c]:30.73
  • if_expr:buff.rime.react&talent.icebreaker.rank=2
    Avalanche 1321 1.5% 34.5 8.68sec 11466 0 Direct 34.5 8655 17653 11466 31.2%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.54 34.54 0.00 0.00 0.00 0.0000 0.0000 396030.49 396030.49 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.76% 23.75 9 41 8655.29 4317 18447 8652.98 7179 9962 205571 205571 0.00%
crit 31.24% 10.79 1 24 17653.09 8806 35668 17650.26 13633 24552 190460 190460 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Inexorable Assault 1633 1.9% 42.1 7.16sec 11616 0 Direct 42.1 8769 17879 11616 31.2%

Stats Details: Inexorable Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.10 42.10 0.00 0.00 0.00 0.0000 0.0000 489065.43 489065.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.75% 28.95 13 43 8769.05 4111 16954 8767.75 7475 10114 253842 253842 0.00%
crit 31.25% 13.16 3 25 17878.69 8387 33905 17875.98 13768 22926 235224 235224 0.00%

Action Details: Inexorable Assault

  • id:253597
  • school:frost
  • range:20.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:253597
  • name:Inexorable Assault
  • school:frost
  • tooltip:
  • description:{$@spelldesc253593=Gain Inexorable Assault every {$t1=8} sec, stacking up to {$253595u=5} times. {$?s207230=false}[Obliterate and Frostscythe consume][Obliterate consumes] a stack to deal an additional {$253597s1=0} Frost damage.}
Obliterate 2408 (47864) 2.8% (55.2%) 26.1 11.25sec 550393 110869 Direct 26.1 (119.0) 20914 42765 27712 31.1% (84.9%)

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.06 26.06 0.00 0.00 0.00 4.9644 0.0000 722057.36 896988.53 19.50% 110869.48 110869.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.89% 17.95 5 33 20914.11 14079 31175 20922.02 18099 24151 375409 466358 19.50%
crit 31.11% 8.11 0 19 42765.04 28722 63597 42748.25 0 59997 346649 430630 19.49%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    obliteration
    [T]:58.81
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [b]:31.80
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [e]:28.38
  • if_expr:!variable.pooling_runes
    Obliterate (_km) 45456 52.4% 92.9 3.19sec 146555 0 Direct 92.9 0 146556 146556 100.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 92.93 92.93 0.00 0.00 0.00 0.0000 0.0000 13618909.81 11842530.27 -15.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 92.93 58 127 146555.74 64927 299324 146520.35 134129 158815 13618910 11842530 -15.00%

Action Details: Obliterate Km

  • id:325461
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:325461
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
pet - ghoul 3376 / 1841
Claw 1098 0.7% 58.5 4.80sec 3066 3066 Direct 58.5 2290 4768 3066 31.3%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.48 58.48 0.00 0.00 0.00 1.0000 0.0000 179315.95 256172.17 30.00% 3066.17 3066.17
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.68% 40.16 19 58 2289.80 1420 3983 2292.11 2075 2569 91969 131387 30.00%
crit 31.32% 18.32 5 34 4768.33 2954 8192 4773.55 4096 5692 87347 124785 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:58.48
  • if_expr:energy>70
Gnaw 2 0.0% 2.9 120.89sec 106 106 Direct 2.9 79 165 106 31.4%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 0.00 1.0000 0.0000 310.26 443.24 30.00% 106.14 106.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.56% 2.00 0 3 79.09 50 117 76.23 0 115 159 226 28.90%
crit 31.44% 0.92 0 3 165.10 106 249 109.82 0 238 152 217 19.93%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.92
main_hand 2276 1.4% 108.4 2.56sec 3430 2510 Direct 108.4 2561 5335 3430 31.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 108.41 108.41 0.00 0.00 0.00 1.3666 0.0000 371880.03 531270.73 30.00% 2510.14 2510.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 68.66% 74.43 40 100 2561.23 1578 4474 2564.02 2354 2827 190635 272342 30.00%
crit 31.34% 33.98 12 56 5334.51 3282 9204 5340.06 4742 6195 181245 258929 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
T29_Death_Knight_Frost_2h
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost_2h
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Chains of Ice 8.3 34.52sec

Stats Details: Chains Of Ice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.27 0.00 0.00 0.00 0.00 1.1310 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Chains Of Ice

  • id:45524
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:45524
  • name:Chains of Ice
  • school:frost
  • tooltip:Movement slowed {$=}w1% {$?=}{$=}w5!=0[and Haste reduced {$=}w5% ][]by frozen chains.
  • description:Shackles the target {$?a373930=false}[and {$373930s1=1} nearby enemy ][]with frozen chains, reducing movement speed by {$s1=70}% for {$d=8 seconds}.

Action Priority List

    cold_heart
    [M]:0.25
  • if_expr:fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
    cold_heart
    [N]:8.02
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)
Empower Rune Weapon 4.0 81.73sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [P]:3.97
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost_2h
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost_2h
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Pillar of Frost 9.7 32.19sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.68 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [R]:9.68
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
Elemental Potion of Ultimate Power 1.5 303.24sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [O]:1.47
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.89sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [S]:2.98
Unholy Strength 22.9 12.76sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 22.91 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost_2h
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 122.0sec 122.4sec 11.8sec 11.83% 0.00% 32.2 (32.2) 2.9

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 135.2s
  • trigger_min/max:120.0s / 134.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.83%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 17.5 75.5 17.4sec 3.2sec 13.7sec 79.62% 0.00% 0.0 (0.0) 2.9

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.6s / 54.8s
  • trigger_min/max:0.8s / 37.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.6s

Stack Uptimes

  • bonegrinder_crit_1:18.44%
  • bonegrinder_crit_2:16.56%
  • bonegrinder_crit_3:15.72%
  • bonegrinder_crit_4:14.86%
  • bonegrinder_crit_5:14.04%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 13.1 0.7 22.8sec 21.5sec 10.3sec 45.09% 49.64% 0.7 (0.7) 12.7

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 102.6s
  • trigger_min/max:5.5s / 93.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.5s

Stack Uptimes

  • bonegrinder_frost_1:45.09%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 2.9 14.2 124.4sec 15.8sec 19.4sec 19.02% 0.00% 1.7 (1.7) 2.7

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:410.31
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:410.31

Trigger Details

  • interval_min/max:120.0s / 142.5s
  • trigger_min/max:0.0s / 127.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:1.11%
  • bound_by_fire_and_blaze_2:4.37%
  • bound_by_fire_and_blaze_3:4.19%
  • bound_by_fire_and_blaze_4:3.69%
  • bound_by_fire_and_blaze_5:2.71%
  • bound_by_fire_and_blaze_6:2.96%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=25627} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Cold Heart 9.1 141.9 34.9sec 2.0sec 32.1sec 97.07% 0.00% 23.5 (23.5) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_cold_heart
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 205.7s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 204.5s

Stack Uptimes

  • cold_heart_1:5.33%
  • cold_heart_2:5.28%
  • cold_heart_3:5.25%
  • cold_heart_4:5.21%
  • cold_heart_5:5.17%
  • cold_heart_6:5.13%
  • cold_heart_7:5.09%
  • cold_heart_8:5.05%
  • cold_heart_9:5.01%
  • cold_heart_10:4.98%
  • cold_heart_11:4.94%
  • cold_heart_12:4.90%
  • cold_heart_13:4.87%
  • cold_heart_14:4.13%
  • cold_heart_15:3.27%
  • cold_heart_16:2.63%
  • cold_heart_17:2.06%
  • cold_heart_18:1.60%
  • cold_heart_19:1.02%
  • cold_heart_20:16.15%

Spelldata

  • id:281209
  • name:Cold Heart
  • tooltip:Your next Chains of Ice will deal {$281210s1=0} Frost damage.
  • description:{$@spelldesc281208=Every {$t1=2} sec, gain a stack of Cold Heart, causing your next Chains of Ice to deal {$281210s1=0} Frost damage. Stacks up to {$281209u=20} times.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Earth 7.5 3.6 38.0sec 24.9sec 14.5sec 36.43% 0.00% 3.6 (3.6) 7.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_elemental_lariat__empowered_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 122.0s
  • trigger_min/max:0.1s / 111.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.2s

Stack Uptimes

  • elemental_lariat__empowered_earth_1:36.43%

Spelldata

  • id:375345
  • name:Elemental Lariat - Empowered Earth
  • tooltip:Mastery increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 303.3sec 303.3sec 27.2sec 13.06% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.8s
  • trigger_min/max:300.0s / 328.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.06%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 4.0 0.0 81.7sec 81.7sec 19.6sec 26.07% 0.00% 11.7 (11.7) 3.7

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 144.4s
  • trigger_min/max:20.0s / 144.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:26.07%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 9.2 0.1 32.6sec 32.1sec 18.1sec 55.63% 0.00% 0.1 (0.1) 8.7

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:22.0s / 85.9s
  • trigger_min/max:19.0s / 50.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 67.1s

Stack Uptimes

  • enduring_strength_1:55.63%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 9.6 49.2 32.3sec 5.0sec 10.9sec 35.03% 99.70% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:19.1s / 47.7s
  • trigger_min/max:0.8s / 39.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:6.64%
  • enduring_strength_builder_2:6.57%
  • enduring_strength_builder_3:6.51%
  • enduring_strength_builder_4:6.23%
  • enduring_strength_builder_5:4.89%
  • enduring_strength_builder_6:2.33%
  • enduring_strength_builder_7:1.19%
  • enduring_strength_builder_8:0.56%
  • enduring_strength_builder_9:0.11%
  • enduring_strength_builder_10:0.01%
  • enduring_strength_builder_11:0.00%
  • enduring_strength_builder_12:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frostwhelp's Aid 9.7 0.0 32.2sec 32.2sec 14.7sec 47.34% 0.00% 0.0 (0.0) 9.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_frostwhelps_aid
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:19.0s / 50.0s
  • trigger_min/max:19.0s / 50.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • frostwhelps_aid_1:47.34%

Spelldata

  • id:377253
  • name:Frostwhelp's Aid
  • tooltip:Grants {$=}{{$s1=0}*$mas}% Mastery.
  • description:{$@spelldesc377226=Pillar of Frost summons a Frostwhelp who breathes on all enemies within {$s2=40} yards in front of you for {$377245s1=0} Frost damage. Each unique enemy hit by Frostwhelp's Aid grants you {$=}{{$s3=1}*2}% Mastery for {$287338d=15 seconds}, up to {$=}{{$s3=1}*2*{$377253u=5}}%. }
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 5.3 102.7 55.4sec 2.8sec 55.1sec 97.88% 85.13% 92.1 (92.1) 4.3

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 345.6s
  • trigger_min/max:0.8s / 14.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 352.9s

Stack Uptimes

  • icy_talons_1:2.60%
  • icy_talons_2:2.50%
  • icy_talons_3:92.78%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Inexorable Assault 37.4 1.1 8.1sec 8.0sec 1.8sec 22.49% 35.43% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_inexorable_assault
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.1s / 20.4s
  • trigger_min/max:8.0s / 8.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.4s

Stack Uptimes

  • inexorable_assault_1:19.74%
  • inexorable_assault_2:0.62%
  • inexorable_assault_3:0.64%
  • inexorable_assault_4:0.86%
  • inexorable_assault_5:0.63%

Spelldata

  • id:253595
  • name:Inexorable Assault
  • tooltip:{$?s207230=false}[Your next {$m2=0} {$=}LObliterate or Frostscythe:Obliterates or Frostscythes; {$=}Ldeals:deal; an additional {$253597s1=0} Frost damage.][Your next {$m2=0} {$=}LObliterate:Obliterates; {$=}Ldeals:deal; an additional {$253597s1=0} Frost damage.]
  • description:{$@spelldesc253593=Gain Inexorable Assault every {$t1=8} sec, stacking up to {$253595u=5} times. {$?s207230=false}[Obliterate and Frostscythe consume][Obliterate consumes] a stack to deal an additional {$253597s1=0} Frost damage.}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Inspired by Fire and Earth 7.5 3.5 38.1sec 25.0sec 14.4sec 36.27% 0.00% 3.5 (3.5) 7.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_inspired_by_fire_and_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:277.19

Trigger Details

  • interval_min/max:12.0s / 119.5s
  • trigger_min/max:0.0s / 112.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 76.8s

Stack Uptimes

  • inspired_by_fire_and_earth_1:36.27%

Spelldata

  • id:394461
  • name:Inspired by Fire and Earth
  • tooltip:Haste and Versatility increased by {$=}w1.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 93.2 33.7 3.2sec 2.3sec 1.3sec 39.72% 51.79% 33.7 (33.7) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 36.9s
  • trigger_min/max:0.0s / 35.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.6s

Stack Uptimes

  • killing_machine_1:39.72%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 9.7 0.0 32.2sec 32.2sec 11.8sec 38.05% 37.85% 0.0 (0.0) 9.3

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:19.0s / 50.0s
  • trigger_min/max:19.0s / 50.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:38.05%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 9.7 53.5 32.3sec 4.6sec 11.0sec 35.48% 50.41% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:19.1s / 48.0s
  • trigger_min/max:0.8s / 38.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:0.45%
  • pillar_of_frost_bonus_2:5.66%
  • pillar_of_frost_bonus_3:0.95%
  • pillar_of_frost_bonus_4:5.25%
  • pillar_of_frost_bonus_5:1.24%
  • pillar_of_frost_bonus_6:4.96%
  • pillar_of_frost_bonus_7:1.46%
  • pillar_of_frost_bonus_8:4.67%
  • pillar_of_frost_bonus_9:1.53%
  • pillar_of_frost_bonus_10:3.86%
  • pillar_of_frost_bonus_11:1.10%
  • pillar_of_frost_bonus_12:1.77%
  • pillar_of_frost_bonus_13:0.60%
  • pillar_of_frost_bonus_14:0.77%
  • pillar_of_frost_bonus_15:0.43%
  • pillar_of_frost_bonus_16:0.36%
  • pillar_of_frost_bonus_17:0.24%
  • pillar_of_frost_bonus_18:0.10%
  • pillar_of_frost_bonus_19:0.05%
  • pillar_of_frost_bonus_20:0.01%
  • pillar_of_frost_bonus_21:0.00%
  • pillar_of_frost_bonus_22:0.00%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Rime 35.0 27.3 8.6sec 4.8sec 4.1sec 47.60% 98.85% 27.3 (27.3) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 57.5s
  • trigger_min/max:0.0s / 57.5s
  • trigger_pct:48.85%
  • duration_min/max:0.0s / 31.0s

Stack Uptimes

  • rime_1:47.60%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.3 11.0 22.4sec 12.0sec 11.1sec 49.17% 0.00% 11.0 (11.0) 12.8

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 144.9s
  • trigger_min/max:0.8s / 140.7s
  • trigger_pct:14.98%
  • duration_min/max:0.0s / 68.1s

Stack Uptimes

  • rune_mastery_1:49.17%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.5 14.4 35.7sec 12.7sec 25.1sec 71.44% 0.00% 14.4 (14.4) 7.8

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 193.7s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 171.6s

Stack Uptimes

  • unholy_strength_1:71.44%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 5.3 102.7 55.4sec 2.8sec 55.1sec 97.88% 94.92% 92.1 (92.1) 4.3

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 345.6s
  • trigger_min/max:0.8s / 14.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 352.9s

Stack Uptimes

  • unleashed_frenzy_1:2.60%
  • unleashed_frenzy_2:2.50%
  • unleashed_frenzy_3:92.78%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=6 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Zone of Focus 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_zone_of_focus
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:220.30

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • zone_of_focus_1:100.00%

Spelldata

  • id:387336
  • name:Zone of Focus
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc387335=Greatly improves the comfort of your gear, allowing you to enter a Zone of Focus while over {$396377s1=90}% health, granting you {$s1=92} Mastery.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Incarnate's Mark of Frost

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_incarnates_mark_of_frost
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:567.88

Spelldata

  • id:382079
  • name:Incarnate's Mark of Frost
  • tooltip:Critical Strike increased by {$=}w1. Dealing harmful spells and abilities has a chance to grant you an additional {$377452=}w2 Versatility or Haste if any nearby allies are Marked by Earth or Fire.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 27.0 10.0 51.0 10.8s 1.6s 115.1s
Killing Machine spent on Obliterate 92.9 58.0 127.0 3.2s 0.8s 37.3s
Killing Machine: Critical auto attacks 31.5 15.0 54.0 9.3s 1.6s 105.0s
Killing Machine: Cold-Blooded Rage 5.3 0.0 16.0 45.6s 1.6s 315.9s
Killing Machine: Frost Strike 41.4 24.0 60.0 7.0s 1.6s 102.3s
Killing Machine: Howling Blast 1.1 0.0 5.0 115.8s 1.6s 349.7s
Killing Machine: T29 4pc 13.9 2.0 32.0 20.2s 0.8s 218.2s
Killing Machine wasted: Critical auto attacks 19.0 5.0 36.0 15.8s 1.6s 199.4s
Killing Machine wasted: Cold-Blooded Rage 1.4 0.0 9.0 77.3s 0.8s 338.2s
Killing Machine wasted: Frost Strike 10.2 0.0 24.0 26.1s 0.8s 257.8s
Killing Machine wasted: Howling Blast 3.1 0.0 12.0 61.0s 0.8s 346.2s
Rune ready 243.1 178.0 305.0 1.5s 0.0s 15.1s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 15.48% 1.17% 33.39% 1.7s 0.0s 10.4s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=776395)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.3721.804 / 1.1944.74729.797
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
58.386119.020186.771 / 185.076260.976353.498

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Abomination Limb2.2010.00115.2293.9730.00024.587
Pillar of Frost0.9160.00112.0186.9831.10319.852
Raise Dead0.9210.0015.2421.7400.0008.801

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
T29_Death_Knight_Frost_2h
Empower Rune WeaponRunic Power19.3681.672.94%4.2215.1115.61%
Empower Rune WeaponRune19.3618.177.47%0.941.186.12%
Frigid ExecutionerRune35.6735.6714.67%1.000.000.00%
Frost FeverRunic Power29.65126.614.56%4.2721.6314.59%
Murderous EfficiencyRune46.4445.4518.69%0.980.992.13%
ObliterationRune16.7514.966.15%0.891.7810.65%
Rune RegenerationRune77.2177.2131.76%1.000.000.00%
Runic AttenuationRunic Power79.15350.0412.61%4.4245.7211.55%
Runic EmpowermentRune53.9351.6721.25%0.962.264.20%
Chains of IceRunic Power8.2751.531.86%6.2331.1637.68%
Howling BlastRunic Power34.943.990.14%0.110.000.10%
ObliterateRunic Power118.982161.4477.88%18.17218.219.17%
pet - ghoul
energy_regenEnergy1064.662183.36100.00%2.05203.088.51%
Usage Type Count Total Avg RPE APR
T29_Death_Knight_Frost_2h
Chains of IceRune 8.278.271.001.000.00
Frost StrikeRunic Power 108.012700.3525.0025.001619.80
Howling BlastRune 34.940.400.010.014786997.76
ObliterateRune 118.98237.972.009.1360265.01
pet - ghoul
ClawEnergy 58.482339.3740.0040.0076.65
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 9.25 9.00 331.9 74.9 0.0 100.0
Rune 6.0 0.81 0.82 0.0 2.5 0.0 6.0

Statistics & Data Analysis

Fight Length
T29_Death_Knight_Frost_2h Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
T29_Death_Knight_Frost_2h Damage Per Second
Count 7499
Mean 86719.67
Minimum 72967.43
Maximum 99741.47
Spread ( max - min ) 26774.04
Range [ ( max - min ) / 2 * 100% ] 15.44%
Standard Deviation 3694.0367
5th Percentile 80628.53
95th Percentile 92837.98
( 95th Percentile - 5th Percentile ) 12209.45
Mean Distribution
Standard Deviation 42.6579
95.00% Confidence Interval ( 86636.07 - 86803.28 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6971
0.1 Scale Factor Error with Delta=300 116490
0.05 Scale Factor Error with Delta=300 465958
0.01 Scale Factor Error with Delta=300 11648932
Priority Target DPS
T29_Death_Knight_Frost_2h Priority Target Damage Per Second
Count 7499
Mean 86719.67
Minimum 72967.43
Maximum 99741.47
Spread ( max - min ) 26774.04
Range [ ( max - min ) / 2 * 100% ] 15.44%
Standard Deviation 3694.0367
5th Percentile 80628.53
95th Percentile 92837.98
( 95th Percentile - 5th Percentile ) 12209.45
Mean Distribution
Standard Deviation 42.6579
95.00% Confidence Interval ( 86636.07 - 86803.28 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 6971
0.1 Scale Factor Error with Delta=300 116490
0.05 Scale Factor Error with Delta=300 465958
0.01 Scale Factor Error with Delta=300 11648932
DPS(e)
T29_Death_Knight_Frost_2h Damage Per Second (Effective)
Count 7499
Mean 86719.67
Minimum 72967.43
Maximum 99741.47
Spread ( max - min ) 26774.04
Range [ ( max - min ) / 2 * 100% ] 15.44%
Damage
T29_Death_Knight_Frost_2h Damage
Count 7499
Mean 25438188.92
Minimum 17707257.63
Maximum 32967325.86
Spread ( max - min ) 15260068.23
Range [ ( max - min ) / 2 * 100% ] 29.99%
DTPS
T29_Death_Knight_Frost_2h Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
T29_Death_Knight_Frost_2h Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
T29_Death_Knight_Frost_2h Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
T29_Death_Knight_Frost_2h Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
T29_Death_Knight_Frost_2h Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
T29_Death_Knight_Frost_2h Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
T29_Death_Knight_Frost_2hTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
T29_Death_Knight_Frost_2h Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
5 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
6 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Estimates a trinkets value by comparing the cooldown of the trinket, divided by the duration of the buff it provides. Has a strength modifier to give a higher priority to strength trinkets, as well as a modifier for if a trinket will or will not sync with cooldowns.
7 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
8 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
9 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
A 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
C 13.49 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
D 0.00 call_action_list,name=trinkets
Choose Action list to run
E 0.00 call_action_list,name=cooldowns
F 0.00 call_action_list,name=racials
G 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
H 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
I 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
J 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
L 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.cold_heart
# count action,conditions
M 0.25 chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
Cold Heart
0.00 chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
0.00 chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
0.00 chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>20
N 8.02 chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)
actions.cooldowns
# count action,conditions
O 1.47 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
P 3.97 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
0.00 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
Q 2.98 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
0.00 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
R 9.68 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
0.00 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
0.00 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
0.00 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
S 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.obliteration
# count action,conditions
0.00 remorseless_winter,if=active_enemies>3
Obliteration Active Rotation
T 58.81 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
U 0.33 howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
V 2.32 frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
W 3.00 howling_blast,if=buff.rime.react&buff.killing_machine.react
0.00 glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
X 46.26 frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
Y 0.88 howling_blast,if=!buff.killing_machine.react&runic_power<25
0.00 arcane_torrent,if=rune<1&runic_power<25
0.00 glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
Z 3.07 frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
a 0.00 howling_blast,if=buff.rime.react
0.00 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
actions.single_target
# count action,conditions
0.00 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
b 31.80 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
c 30.73 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
d 35.02 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
0.00 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
e 28.38 obliterate,if=!variable.pooling_runes
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
0.00 arcane_torrent,if=runic_power.deficit>20
f 7.86 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
g 2.60 use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
h 0.32 use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
0.00 use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABQSbceCPCRgOYTYTVTXTTXTXTTXTbcdededecdbNcPddeecdeRXTXTXTXTXTXTTXbbcbdbcbbNCCCRTXTTTWZZTXTcdebdbbbNdffefRZTXTXTYTWZCbCbceceCCCeeQSbCCPCbNcRgXTXTXTXTXTTTcdecdbcdededRTTTZZTXTXTXbNcdededecdbcdecdbRXTXTXTXTXTXbceNdecddfbffbcfRTXTZTXTXTXTceecCCCQSbNcffbcePffcbRgXTXTXTXTXTXTcedNedededecdecdededecdRXTM

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask T29_Death_Knight_Frost_2h 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food T29_Death_Knight_Frost_2h 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 2 augmentation T29_Death_Knight_Frost_2h 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 4 trinket_1_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 5 trinket_2_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 6 trinket_priority Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 7 rw_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 8 2h_check Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 9 trinket_1_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat A trinket_2_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
0:00.000 default B auto_attack Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
0:00.000 cooldowns Q abomination_limb Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, killing_machine, static_empowerment
0:00.918 cooldowns S raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, killing_machine, rime, static_empowerment
0:00.918 single_target b obliterate Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, killing_machine, rime, static_empowerment
0:01.838 single_target c howling_blast Fluffy_Pillow 20.0/100: 20% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, rime, bonegrinder_crit, static_empowerment(2)
0:02.758 single_target e obliterate Fluffy_Pillow 20.0/100: 20% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, bonegrinder_crit, static_empowerment(3)
0:03.679 default C frost_strike Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, rime, bonegrinder_crit, static_empowerment(4)
0:04.598 cooldowns P empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, icy_talons, rime, bonegrinder_crit, unleashed_frenzy, static_empowerment(5)
0:04.598 default C frost_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons, rime, bonegrinder_crit, unleashed_frenzy, static_empowerment(5)
0:05.397 cooldowns R pillar_of_frost Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), rime, bonegrinder_crit, unleashed_frenzy(2), static_empowerment(5)
0:05.397 trinkets g use_item_blazebinders_hoof Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), pillar_of_frost, rime, bonegrinder_crit, frostwhelps_aid, unleashed_frenzy(2), static_empowerment(5)
0:05.397 cooldowns O potion Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), pillar_of_frost, rime, bonegrinder_crit, frostwhelps_aid, unleashed_frenzy(2), bound_by_fire_and_blaze, static_empowerment(5)
0:05.397 obliteration Y howling_blast Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), pillar_of_frost, rime, bonegrinder_crit, frostwhelps_aid, unleashed_frenzy(2), bound_by_fire_and_blaze, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.195 obliteration T obliterate Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus, rime, bonegrinder_crit, frostwhelps_aid, unleashed_frenzy(2), bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:06.995 obliteration Y howling_blast Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(3), rime, bonegrinder_crit(2), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(2), bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:07.794 obliteration T obliterate Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(2), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(2), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.585 obliteration V frost_strike Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(3), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(2), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.376 obliteration T obliterate Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(3), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.164 obliteration X frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.954 obliteration T obliterate Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.742 obliteration T obliterate Fluffy_Pillow 45.0/100: 45% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, abomination_limb, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(5), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.531 obliteration X frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.321 obliteration T obliterate Fluffy_Pillow 45.0/100: 45% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.109 obliteration X frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.899 obliteration T obliterate Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.688 obliteration T obliterate Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(16), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(7), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.477 obliteration X frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), inexorable_assault, pillar_of_frost, pillar_of_frost_bonus(18), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(8), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.267 obliteration T obliterate Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(18), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(8), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.056 single_target b obliterate Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.845 single_target c howling_blast Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(5), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.635 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), bonegrinder_crit(5), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.425 single_target e obliterate Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), bonegrinder_crit(5), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.215 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), bonegrinder_crit(5), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.005 single_target e obliterate Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.794 single_target d frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.582 single_target e obliterate Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.371 single_target c howling_blast Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.163 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:26.082 single_target b obliterate Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:27.000 cold_heart N chains_of_ice Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:27.919 single_target c howling_blast Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.827 cooldowns P empower_rune_weapon Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.827 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart, empower_rune_weapon, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.617 single_target d frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(2), empower_rune_weapon, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.405 single_target e obliterate Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(2), empower_rune_weapon, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.195 single_target e obliterate Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(2), empower_rune_weapon, icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.984 single_target c howling_blast Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(3), empower_rune_weapon, icy_talons(3), inexorable_assault, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.773 single_target d frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(3), empower_rune_weapon, icy_talons(3), inexorable_assault, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.559 single_target e obliterate Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(3), empower_rune_weapon, icy_talons(3), inexorable_assault, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:34.348 cooldowns R pillar_of_frost Fluffy_Pillow 95.0/100: 95% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(4), empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:34.348 obliteration X frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(4), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:35.137 obliteration T obliterate Fluffy_Pillow 75.0/100: 75% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(4), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:35.928 obliteration X frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:36.718 obliteration T obliterate Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, enduring_strength_builder, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:37.508 obliteration X frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(2), enduring_strength_builder(2), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:38.295 obliteration T obliterate Fluffy_Pillow 70.0/100: 70% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(6), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(2), enduring_strength_builder(2), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:39.084 obliteration X frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(6), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(3), enduring_strength_builder(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:39.883 obliteration T obliterate Fluffy_Pillow 75.0/100: 75% runic_power
6.0/6: 100% rune		 bloodlust, unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(3), enduring_strength_builder(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:40.684 obliteration X frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), enduring_strength_builder(4), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:41.722 obliteration T obliterate Fluffy_Pillow 70.0/100: 70% runic_power
6.0/6: 100% rune		 unholy_strength, cold_heart(8), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:42.760 obliteration X frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(8), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(5), enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:43.800 obliteration T obliterate Fluffy_Pillow 70.0/100: 70% runic_power
6.0/6: 100% rune		 unholy_strength, cold_heart(9), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(5), enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:44.839 obliteration T obliterate Fluffy_Pillow 95.0/100: 95% runic_power
6.0/6: 100% rune		 unholy_strength, cold_heart(9), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:45.876 obliteration X frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(10), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(7), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:46.914 single_target b obliterate Fluffy_Pillow 75.0/100: 75% runic_power
6.0/6: 100% rune		 unholy_strength, cold_heart(10), empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:47.950 single_target b obliterate Fluffy_Pillow 95.0/100: 95% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(11), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:48.989 single_target c howling_blast Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(3), killing_machine, rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:50.182 single_target b obliterate Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(12), icy_talons(3), killing_machine, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:51.376 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(12), icy_talons(3), killing_machine, bonegrinder_crit(4), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:52.569 single_target b obliterate Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(13), icy_talons(3), killing_machine, bonegrinder_crit(4), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:53.761 single_target c howling_blast Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(14), icy_talons(3), killing_machine, rime, bonegrinder_crit(5), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:54.954 single_target b obliterate Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(14), icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:56.148 single_target b obliterate Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(15), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:57.341 cold_heart N chains_of_ice Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(15), icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:58.535 default C frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart, bonegrinder_crit, bonegrinder_frost, enduring_strength, static_empowerment(5)
0:59.728 default C frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(2), icy_talons, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy, static_empowerment(5)
1:00.921 default C frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(2), icy_talons(2), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(2), static_empowerment(5)
1:02.116 cooldowns R pillar_of_frost Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(3), icy_talons(3), killing_machine, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:02.348 obliteration T obliterate Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(3), icy_talons(3), killing_machine, pillar_of_frost, bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:03.541 obliteration X frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(3), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:04.734 obliteration T obliterate Fluffy_Pillow 30.0/100: 30% runic_power
6.0/6: 100% rune		 rune_mastery, cold_heart(4), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:05.929 obliteration T obliterate Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(3), enduring_strength_builder(2), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:07.122 obliteration T obliterate Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(4), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:08.315 obliteration W howling_blast Fluffy_Pillow 95.0/100: 95% runic_power
0.0/6: 0% rune		 rune_mastery, cold_heart(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(5), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:09.509 obliteration Z frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 rune_mastery, cold_heart(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit(5), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:10.702 obliteration Z frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune		 cold_heart(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit(5), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:11.896 obliteration T obliterate Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 cold_heart(8), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit(5), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:13.092 obliteration X frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 cold_heart(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:14.286 obliteration T obliterate Fluffy_Pillow 55.0/100: 55% runic_power
6.0/6: 100% rune		 cold_heart(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:15.464 single_target c howling_blast Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 cold_heart(9), icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:16.641 single_target d frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
5.0/6: 83% rune		 cold_heart(10), icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:17.819 single_target e obliterate Fluffy_Pillow 55.0/100: 55% runic_power
6.0/6: 100% rune		 cold_heart(11), icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:18.998 single_target b obliterate Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune		 unholy_strength, cold_heart(11), icy_talons(3), killing_machine, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:20.176 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(12), icy_talons(3), inexorable_assault, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:21.353 single_target b obliterate Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(12), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:22.531 single_target b obliterate Fluffy_Pillow 95.0/100: 95% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(13), icy_talons(3), killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:23.711 single_target b obliterate Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(14), icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:24.889 cold_heart N chains_of_ice Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(14), icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:26.067 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:27.260 single_target f frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:28.454 single_target f frost_strike Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(2), icy_talons(3), inexorable_assault, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:29.648 single_target e obliterate Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(3), icy_talons(3), inexorable_assault, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:30.843 single_target f frost_strike Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(3), icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:32.036 Waiting     0.091 sec 30.0/100: 30% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(4), icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:32.127 cooldowns R pillar_of_frost Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(4), icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:32.348 obliteration Z frost_strike Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(4), icy_talons(3), killing_machine, pillar_of_frost, bonegrinder_crit(5), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:33.542 obliteration T obliterate Fluffy_Pillow 5.0/100: 5% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(4), icy_talons(3), killing_machine, pillar_of_frost, bonegrinder_crit(5), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:34.736 obliteration X frost_strike Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(5), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:35.929 obliteration T obliterate Fluffy_Pillow 5.0/100: 5% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(6), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:37.121 obliteration X frost_strike Fluffy_Pillow 25.0/100: 25% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, cold_heart(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:38.315 Waiting     0.092 sec 0.0/100: 0% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:38.407 obliteration T obliterate Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:39.599 obliteration Y howling_blast Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:40.793 obliteration T obliterate Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:41.987 obliteration W howling_blast Fluffy_Pillow 50.0/100: 50% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, cold_heart(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:43.179 obliteration Z frost_strike Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(9), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, elemental_lariat__empowered_earth, static_empowerment(5)
1:44.373 default C frost_strike Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons, inexorable_assault, killing_machine, bonegrinder_crit(3), enduring_strength, frostwhelps_aid, unleashed_frenzy, elemental_lariat__empowered_earth, static_empowerment(5)
1:45.566 single_target b obliterate Fluffy_Pillow 5.0/100: 5% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(2), inexorable_assault, killing_machine, bonegrinder_crit(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(2), elemental_lariat__empowered_earth, static_empowerment(5)
1:46.760 default C frost_strike Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(2), killing_machine, bonegrinder_crit(4), enduring_strength, frostwhelps_aid, unleashed_frenzy(2), elemental_lariat__empowered_earth, static_empowerment(5)
1:47.954 single_target b obliterate Fluffy_Pillow 5.0/100: 5% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(12), icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:49.148 single_target c howling_blast Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(12), icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:50.342 single_target e obliterate Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(13), icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:51.537 single_target c howling_blast Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(13), icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:52.728 single_target e obliterate Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(14), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:53.922 default C frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 cold_heart(15), bonegrinder_crit, bonegrinder_frost, enduring_strength, static_empowerment(5)
1:55.116 default C frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune		 cold_heart(15), icy_talons, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy, static_empowerment(5)
1:56.310 default C frost_strike Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune		 cold_heart(16), icy_talons(2), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(2), static_empowerment(5)
1:57.504 single_target e obliterate Fluffy_Pillow 0.0/100: 0% runic_power
5.0/6: 83% rune		 cold_heart(16), icy_talons(3), killing_machine, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:58.699 single_target e obliterate Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune		 cold_heart(17), icy_talons(3), bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), static_empowerment(5)
1:59.893 cooldowns Q abomination_limb Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 cold_heart(18), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(2), bonegrinder_frost, unleashed_frenzy(3), static_empowerment(5)
2:01.194 cooldowns S raise_dead Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 abomination_limb, cold_heart(18), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:01.194 single_target b obliterate Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 abomination_limb, cold_heart(18), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
2:02.387 default C frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
0.0/6: 0% rune		 abomination_limb, cold_heart(19), rime, bonegrinder_crit(3), static_empowerment(5)
2:03.581 default C frost_strike Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 abomination_limb, cold_heart(19), icy_talons, rime, bonegrinder_crit(3), unleashed_frenzy, static_empowerment(5)
2:04.775 cooldowns P empower_rune_weapon Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 abomination_limb, cold_heart(20), icy_talons(2), rime, bonegrinder_crit(3), unleashed_frenzy(2), static_empowerment(5)
2:04.775 default C frost_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 abomination_limb, cold_heart(20), empower_rune_weapon, icy_talons(2), rime, bonegrinder_crit(3), unleashed_frenzy(2), static_empowerment(5)
2:05.813 single_target b obliterate Fluffy_Pillow 0.0/100: 0% runic_power
5.0/6: 83% rune		 abomination_limb, cold_heart(20), empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
2:06.852 cold_heart N chains_of_ice Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 abomination_limb, cold_heart(20), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
2:07.890 single_target c howling_blast Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 rune_mastery, abomination_limb, cold_heart, empower_rune_weapon, icy_talons(3), inexorable_assault, rime, bonegrinder_crit(4), unleashed_frenzy(3), static_empowerment(5)
2:08.928 cooldowns R pillar_of_frost Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 rune_mastery, abomination_limb, cold_heart, empower_rune_weapon, icy_talons(3), inexorable_assault, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:08.928 trinkets g use_item_blazebinders_hoof Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 rune_mastery, abomination_limb, cold_heart, empower_rune_weapon, icy_talons(3), inexorable_assault, pillar_of_frost, bonegrinder_crit(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:08.928 obliteration X frost_strike Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 rune_mastery, abomination_limb, cold_heart, empower_rune_weapon, icy_talons(3), inexorable_assault, pillar_of_frost, bonegrinder_crit(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze, inspired_by_fire_and_earth, static_empowerment(5)
2:09.953 obliteration T obliterate Fluffy_Pillow 15.0/100: 15% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(2), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, bonegrinder_crit(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
2:10.978 obliteration X frost_strike Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(2), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(5), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
2:12.005 obliteration T obliterate Fluffy_Pillow 15.0/100: 15% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, cold_heart(3), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(5), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
2:13.031 obliteration X frost_strike Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(3), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
2:14.055 obliteration T obliterate Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(4), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
2:15.080 obliteration X frost_strike Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(4), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5)
2:16.106 obliteration T obliterate Fluffy_Pillow 20.0/100: 20% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5)
2:17.131 obliteration X frost_strike Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5)
2:18.156 obliteration T obliterate Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(6), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5)
2:19.182 obliteration T obliterate Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(6), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5)
2:20.206 obliteration T obliterate Fluffy_Pillow 70.0/100: 70% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:21.245 single_target c howling_blast Fluffy_Pillow 90.0/100: 90% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(5), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:22.285 single_target d frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(8), empower_rune_weapon, icy_talons(3), bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:23.323 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(8), empower_rune_weapon, icy_talons(3), bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:24.362 single_target c howling_blast Fluffy_Pillow 90.0/100: 90% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(9), empower_rune_weapon, icy_talons(3), inexorable_assault, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:25.399 single_target d frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(9), icy_talons(3), inexorable_assault, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:26.591 single_target b obliterate Fluffy_Pillow 80.0/100: 80% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:27.785 single_target c howling_blast Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:28.978 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:30.173 single_target e obliterate Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(12), icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:31.366 single_target d frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(12), icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:32.560 single_target e obliterate Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(13), icy_talons(3), inexorable_assault, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:33.754 single_target d frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(14), icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:34.949 cooldowns R pillar_of_frost Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(14), icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:34.949 obliteration T obliterate Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(14), icy_talons(3), killing_machine, pillar_of_frost, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:36.142 obliteration T obliterate Fluffy_Pillow 95.0/100: 95% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(15), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:37.336 obliteration T obliterate Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(15), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), enduring_strength_builder(2), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:38.529 obliteration Z frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 unholy_strength, cold_heart(16), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(3), enduring_strength_builder(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:39.722 obliteration Z frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(17), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(3), enduring_strength_builder(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:40.914 obliteration T obliterate Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(17), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(3), enduring_strength_builder(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:42.107 obliteration X frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(18), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:43.300 obliteration T obliterate Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(18), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:44.493 obliteration X frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(19), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(5), enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:45.686 obliteration T obliterate Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(5), enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:46.878 obliteration X frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(20), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:48.073 single_target b obliterate Fluffy_Pillow 55.0/100: 55% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:49.264 cold_heart N chains_of_ice Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(20), icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:50.457 single_target c howling_blast Fluffy_Pillow 90.0/100: 90% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:51.650 single_target d frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(2), icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:52.843 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(2), icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:54.035 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(3), icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:55.229 single_target e obliterate Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(3), icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:56.420 single_target d frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune		 cold_heart(4), icy_talons(3), inexorable_assault, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:57.613 single_target e obliterate Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune		 cold_heart(5), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:58.806 single_target c howling_blast Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 cold_heart(5), icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:00.000 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 cold_heart(6), icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:01.194 single_target b obliterate Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 cold_heart(6), icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:02.389 single_target c howling_blast Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(7), icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:03.584 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(7), icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:04.776 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(8), icy_talons(3), inexorable_assault, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:05.955 single_target c howling_blast Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(9), icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:07.132 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(9), icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:08.311 single_target b obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(10), icy_talons(3), killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:09.490 cooldowns R pillar_of_frost Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(10), icy_talons(3), rime, bonegrinder_crit(4), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:09.490 obliteration X frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(10), icy_talons(3), pillar_of_frost, rime, bonegrinder_crit(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:10.668 obliteration T obliterate Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(11), icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_crit(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:11.847 obliteration X frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(12), icy_talons(3), inexorable_assault, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(5), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:13.026 obliteration T obliterate Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(12), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(5), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:14.205 obliteration X frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(13), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:15.384 obliteration T obliterate Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(13), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:16.562 obliteration X frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
6.0/6: 100% rune		 unholy_strength, cold_heart(14), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:17.740 obliteration T obliterate Fluffy_Pillow 50.0/100: 50% runic_power
6.0/6: 100% rune		 unholy_strength, cold_heart(15), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:18.921 obliteration X frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(15), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:20.098 obliteration T obliterate Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(16), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:21.277 obliteration X frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(16), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:22.456 single_target b obliterate Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(17), icy_talons(3), killing_machine, rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:23.634 single_target c howling_blast Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(18), icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:24.829 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(18), icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:26.024 cold_heart N chains_of_ice Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(19), icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:27.218 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:28.411 single_target e obliterate Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart, icy_talons(3), inexorable_assault, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:29.588 single_target c howling_blast Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 rune_mastery, cold_heart, icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:30.767 single_target d frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 rune_mastery, cold_heart(2), icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:31.944 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(3), icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:33.122 single_target f frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(3), icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:34.301 single_target b obliterate Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(4), icy_talons(3), killing_machine, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:35.481 single_target f frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
0.0/6: 0% rune		 unholy_strength, cold_heart(4), icy_talons(3), bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:36.660 single_target f frost_strike Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(5), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:37.838 single_target b obliterate Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(6), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:39.019 single_target c howling_blast Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(6), icy_talons(3), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:40.198 single_target f frost_strike Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(7), icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
3:41.392 cooldowns R pillar_of_frost Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(7), icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
3:41.490 obliteration T obliterate Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(7), icy_talons(3), killing_machine, pillar_of_frost, bonegrinder_crit(2), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:42.684 obliteration X frost_strike Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(3), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:43.878 obliteration T obliterate Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(9), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(3), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:45.070 obliteration Z frost_strike Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(4), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:46.264 obliteration T obliterate Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(4), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:47.456 obliteration X frost_strike Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(10), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(5), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:48.650 obliteration T obliterate Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(11), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(5), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:49.844 obliteration X frost_strike Fluffy_Pillow 35.0/100: 35% runic_power
6.0/6: 100% rune		 rune_mastery, cold_heart(12), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:51.036 obliteration T obliterate Fluffy_Pillow 15.0/100: 15% runic_power
6.0/6: 100% rune		 rune_mastery, cold_heart(12), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
3:52.229 obliteration X frost_strike Fluffy_Pillow 35.0/100: 35% runic_power
5.0/6: 83% rune		 cold_heart(13), icy_talons(3), inexorable_assault, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:53.423 obliteration T obliterate Fluffy_Pillow 15.0/100: 15% runic_power
6.0/6: 100% rune		 cold_heart(13), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:54.615 single_target c howling_blast Fluffy_Pillow 35.0/100: 35% runic_power
4.0/6: 67% rune		 cold_heart(14), icy_talons(3), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:55.809 single_target e obliterate Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 cold_heart(15), icy_talons(3), bonegrinder_crit(2), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:57.003 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 cold_heart(15), icy_talons(3), bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:58.198 single_target c howling_blast Fluffy_Pillow 85.0/100: 85% runic_power
0.0/6: 0% rune		 cold_heart(16), icy_talons(3), killing_machine, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:59.376 default C frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
0.0/6: 0% rune		 rune_mastery, cold_heart(16), killing_machine, bonegrinder_crit(2), enduring_strength, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
4:00.553 default C frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, cold_heart(17), icy_talons, inexorable_assault, killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
4:01.732 default C frost_strike Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(18), icy_talons(2), inexorable_assault, killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(2), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
4:02.911 cooldowns Q abomination_limb Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(18), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
4:04.090 cooldowns S raise_dead Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(19), icy_talons(3), inexorable_assault, killing_machine, rime, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:04.090 single_target b obliterate Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(19), icy_talons(3), inexorable_assault, killing_machine, rime, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:05.268 cold_heart N chains_of_ice Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(19), icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:06.446 single_target c howling_blast Fluffy_Pillow 60.0/100: 60% runic_power
1.0/6: 17% rune		 unholy_strength, abomination_limb, cold_heart, icy_talons(3), rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:07.623 single_target f frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(2), icy_talons(3), killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:08.801 single_target f frost_strike Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(2), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:09.978 single_target b obliterate Fluffy_Pillow 15.0/100: 15% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(3), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:11.171 single_target c howling_blast Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(3), icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:12.367 single_target e obliterate Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(4), icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:13.560 cooldowns P empower_rune_weapon Fluffy_Pillow 60.0/100: 60% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(4), icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:13.560 single_target f frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(4), empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:14.598 single_target f frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
1.0/6: 17% rune		 unholy_strength, abomination_limb, cold_heart(5), empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), static_empowerment(5)
4:15.637 single_target c howling_blast Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(6), empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:16.664 single_target b obliterate Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(6), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(2), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:17.689 cooldowns R pillar_of_frost Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:17.689 trinkets g use_item_blazebinders_hoof Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), pillar_of_frost, rime, bonegrinder_crit(3), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:17.689 obliteration X frost_strike Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), pillar_of_frost, rime, bonegrinder_crit(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze, inspired_by_fire_and_earth, static_empowerment(5)
4:18.714 obliteration T obliterate Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_crit(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:19.739 obliteration X frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(8), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(4), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:20.764 obliteration T obliterate Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(8), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(4), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:21.789 obliteration X frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(9), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:22.814 obliteration T obliterate Fluffy_Pillow 25.0/100: 25% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(9), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:23.840 obliteration X frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
5.0/6: 83% rune		 cold_heart(10), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:24.867 obliteration T obliterate Fluffy_Pillow 30.0/100: 30% runic_power
6.0/6: 100% rune		 cold_heart(10), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:25.891 obliteration X frost_strike Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 cold_heart(11), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:26.916 obliteration T obliterate Fluffy_Pillow 30.0/100: 30% runic_power
6.0/6: 100% rune		 cold_heart(11), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:27.955 obliteration X frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
5.0/6: 83% rune		 cold_heart(12), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:28.993 obliteration T obliterate Fluffy_Pillow 40.0/100: 40% runic_power
6.0/6: 100% rune		 cold_heart(12), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:30.033 single_target c howling_blast Fluffy_Pillow 60.0/100: 60% runic_power
6.0/6: 100% rune		 cold_heart(13), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:31.071 single_target e obliterate Fluffy_Pillow 60.0/100: 60% runic_power
6.0/6: 100% rune		 rune_mastery, cold_heart(13), empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:32.109 single_target d frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
5.0/6: 83% rune		 rune_mastery, cold_heart(14), empower_rune_weapon, icy_talons(3), inexorable_assault, bonegrinder_crit(4), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:33.148 cold_heart N chains_of_ice Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(14), empower_rune_weapon, icy_talons(3), inexorable_assault, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:34.188 single_target e obliterate Fluffy_Pillow 70.0/100: 70% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), inexorable_assault, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
4:35.381 single_target d frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
4:36.573 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(2), icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
4:37.767 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(3), icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:38.961 single_target e obliterate Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(3), icy_talons(3), bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:40.154 single_target d frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(4), icy_talons(3), inexorable_assault, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:41.347 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(4), icy_talons(3), inexorable_assault, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:42.541 single_target c howling_blast Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(5), icy_talons(3), rime, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:43.735 single_target d frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(6), icy_talons(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:44.929 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(6), icy_talons(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:46.122 single_target c howling_blast Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(7), icy_talons(3), rime, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:47.315 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(7), icy_talons(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:48.509 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(8), icy_talons(3), inexorable_assault, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:49.702 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(9), icy_talons(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:50.895 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(9), icy_talons(3), unleashed_frenzy(3), static_empowerment(5)
4:52.089 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(10), icy_talons(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:53.282 single_target e obliterate Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 cold_heart(10), icy_talons(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:54.476 single_target c howling_blast Fluffy_Pillow 85.0/100: 85% runic_power
0.0/6: 0% rune		 cold_heart(11), icy_talons(3), rime, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:55.668 single_target d frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
0.0/6: 0% rune		 cold_heart(12), icy_talons(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:56.863 cooldowns R pillar_of_frost Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune		 cold_heart(12), icy_talons(3), inexorable_assault, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:56.863 obliteration X frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune		 cold_heart(12), icy_talons(3), inexorable_assault, pillar_of_frost, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:58.057 obliteration T obliterate Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 cold_heart(13), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:59.249 cold_heart M chains_of_ice Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 cold_heart(13), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 2089 2 7854 7549 4958 (4044)
Agility 1734 -2 1818 1732 0
Stamina 3463 2 21653 20622 13377
Intellect 1128 -2 1272 1126 0
Spirit 0 0 0 0 0
Health 433060 412440 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1272 1126 0
Crit 25.83% 25.83% 3390
Haste 26.09% 26.09% 4435
Versatility 5.00% 2.00% 410
Attack Power 8247 7549 0
Mastery 55.79% 55.79% 3581
Armor 7154 7154 7154
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 422.00
Local Head Maw of the Haunted Frostbrood
ilevel: 424, stats: { 948 Armor, +1383 Sta, +236 Haste, +550 Mastery, +512 StrInt }, gems: { +75 StrAgiInt, +66 Haste }
Local Neck Elemental Lariat
ilevel: 418, stats: { +722 Sta, +592 Crit, +592 Mastery }, gems: { +70 Haste, +33 Mastery, +70 Haste, +33 Mastery, +70 Haste, +33 Mastery }
item effects: { equip: Elemental Lariat }
Local Shoulders Jaws of the Haunted Frostbrood
ilevel: 424, stats: { 869 Armor, +1037 Sta, +392 Crit, +198 Haste, +384 StrInt }
Local Chest Breastplate of the Haunted Frostbrood
ilevel: 421, stats: { 1240 Armor, +1333 Sta, +254 Crit, +520 Mastery, +498 StrInt }, enchant: { +150 StrAgiInt }
Local Waist Primal Molten Greatbelt
ilevel: 418, stats: { 684 Armor, +962 Sta, +286 Mastery, +286 Haste, +363 StrInt }, gems: { +70 Haste, +33 Mastery }
item effects: { equip: Blue Silken Lining }
Local Legs Drake Hunter's Greaves
ilevel: 421, stats: { 1085 Armor, +1333 Sta, +503 Haste, +271 Mastery, +498 StrInt }, enchant: { +105 Sta, +177 StrAgi }
Local Feet Duskwatch Guard's Boots
ilevel: 421, stats: { 775 Armor, +1000 Sta, +340 Crit, +241 Haste, +374 StrInt }
Local Wrists Vambraces of the Haunted Frostbrood
ilevel: 424, stats: { 632 Armor, +778 Sta, +144 Crit, +298 Haste, +288 StrInt }, gems: { +70 Haste, +33 Mastery }
Local Hands Grasps of the Haunted Frostbrood
ilevel: 421, stats: { 697 Armor, +1000 Sta, +407 Haste, +174 Vers, +374 StrInt }
Local Finger1 Seal of Filial Duty
ilevel: 430, stats: { +841 Sta, +320 Haste, +967 Mastery }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Mastery }
item effects: { equip: Broodkeeper's Barrier }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 421, stats: { +750 Sta, +553 Crit, +657 Haste }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Mastery }
item effects: { equip: Signet of Melandrus }
Local Trinket1 Blazebinder's Hoof
ilevel: 421, stats: { +553 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Whispering Incarnate Icon
ilevel: 421, stats: { +473 StrAgiInt }
item effects: { equip: Whispering Incarnate Icon }
Local Back Cloak of Lost Devotion
ilevel: 421, stats: { 224 Armor, +750 Sta, +255 Crit, +180 Haste, +280 StrAgiInt }
Local Main Hand Incarnate Sky-Splitter
ilevel: 424, weapon: { 902 - 1874, 3.6 }, stats: { +512 Str, +1383 Sta, +550 Crit, +236 Vers }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune

Talents

Talent Tables

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="T29_Death_Knight_Frost_2h"
source=default
spec=frost
level=70
race=tauren
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAkEBASSiEIBRSSSIiIJRSSAkQSCQSSSKJBAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
# Estimates a trinkets value by comparing the cooldown of the trinket, divided by the duration of the buff it provides. Has a strength modifier to give a higher priority to strength trinkets, as well as a modifier for if a trinket will or will not sync with cooldowns.
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets=use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

head=maw_of_the_haunted_frostbrood,id=200408,bonus_id=4800/4786/1498/6935,gem_id=192985
neck=elemental_lariat,id=193001,bonus_id=6652/7936/7979/1540/8767/8782,gem_id=192948/192948/192948,crafted_stats=32/49
shoulders=jaws_of_the_haunted_frostbrood,id=200410,bonus_id=4800/4786/1498
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1643
chest=breastplate_of_the_haunted_frostbrood,id=200405,bonus_id=4800/4786/1498,enchant_id=6625
wrists=vambraces_of_the_haunted_frostbrood,id=200412,bonus_id=1507/6935,gem_id=192948
hands=grasps_of_the_haunted_frostbrood,id=200407,bonus_id=4800/4786/1498
waist=primal_molten_greatbelt,id=190501,bonus_id=8836/8840/8902/8802/8793/8932/8960,ilevel=418,gem_id=192948,crafted_stats=36/40
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1643,enchant_id=6490
feet=duskwatch_guards_boots,id=137482,bonus_id=1795/6808/4786/3300,ilevel=421,drop_level=70
finger1=seal_of_filial_duty,id=195526,bonus_id=4800/4786/1497/6935,gem_id=192948,enchant_id=6562
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/6808/4786/3300/6935,ilevel=421,gem_id=192948,enchant_id=6562,drop_level=70
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1643
trinket2=whispering_incarnate_icon,id=194301,bonus_id=4800/4786/1498
main_hand=incarnate_skysplitter,id=195528,bonus_id=4800/4786/1498,enchant=rune_of_the_fallen_crusader,enchant_id=3368

# Gear Summary
# gear_ilvl=422.00
# gear_strength=4958
# gear_stamina=13377
# gear_crit_rating=3390
# gear_haste_rating=4435
# gear_mastery_rating=3581
# gear_versatility_rating=410
# gear_armor=7154
# set_bonus=tier29_2pc=1
# set_bonus=tier29_4pc=1

T29_Death_Knight_Frost_DW : 88929 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
88928.6 88928.6 73.4 / 0.083% 12641.6 / 14.2% 9288.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.4 9.6 Runic Power 0.31% 59.5 100.0% 100%
TalentBsPAAAAAAAAAAAAAAAAAAAAAAcgEBASSiEIBRSSSIiIJRSEEkEJJAJJJpkEAAAAAAAAAAAAA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T29_Death_Knight_Frost_DW 88929
Abomination Limb 0 (878) 0.0% (1.0%) 3.0 121.16sec 88275 84051

Stats Details: Abomination Limb

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.00 1.0503 0.0000 0.00 0.00 0.00% 84050.96 84050.96

Action Details: Abomination Limb

  • id:383269
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383269
  • name:Abomination Limb
  • school:shadow
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.

Action Priority List

    cooldowns
    [Q]:2.96
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
    Abomination Limb (_damage) 878 1.0% 37.8 7.01sec 6909 0 Direct 37.8 5266 10793 6908 29.7% 0.0%

Stats Details: Abomination Limb Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.85 37.85 0.00 0.00 0.00 0.0000 0.0000 261482.54 261482.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.28% 26.60 10 37 5265.58 3153 9329 5265.07 4151 6301 140060 140060 0.00%
crit 29.72% 11.25 2 23 10792.75 6432 18586 10791.52 8021 14448 121422 121422 0.00%

Action Details: Abomination Limb Damage

  • id:383313
  • school:shadow
  • range:20.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:5
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383313
  • name:Abomination Limb
  • school:shadow
  • tooltip:
  • description:{$@spelldesc383269=Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.}
auto_attack_mh 4642 5.2% 217.4 1.61sec 6398 3999 Direct 217.4 5572 11379 6398 29.9% 16.4%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 217.40 217.40 0.00 0.00 0.00 1.5998 0.0000 1390817.33 1986932.57 30.00% 3998.99 3998.99
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.71% 116.77 71 164 5572.11 3365 9948 5573.59 5231 5938 650661 929539 30.00%
crit 29.92% 65.05 33 103 11378.66 6864 20294 11379.88 10368 12406 740156 1057393 30.00%
miss 16.37% 35.58 16 58 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
auto_attack_oh 2261 2.5% 212.5 1.61sec 3188 1993 Direct 212.5 2786 5690 3188 29.9% 16.7%

Stats Details: Auto Attack Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 212.55 212.55 0.00 0.00 0.00 1.5995 0.0000 677590.96 968011.76 30.00% 1993.05 1993.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.38% 113.45 73 170 2786.05 1682 4919 2786.80 2606 3046 316088 451566 30.00%
crit 29.89% 63.53 33 97 5689.88 3432 10147 5690.51 5224 6228 361503 516446 30.00%
miss 16.73% 35.56 12 62 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Auto Attack Oh

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Burnout Wave 1139 1.3% 3.0 120.55sec 115656 0 Direct 2.8 94158 192263 123164 29.6% 0.0%

Stats Details: Burnout Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.95 2.77 0.00 0.00 0.00 0.0000 0.0000 341755.32 341755.32 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.44% 1.95 0 3 94157.53 35048 105144 90490.52 0 105144 184043 184043 0.00%
crit 29.56% 0.82 0 3 192262.68 71498 214494 119345.27 0 214494 157712 157712 0.00%

Action Details: Burnout Wave

  • id:389710
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16070.92
  • base_dd_max:16070.92
  • base_dd_mult:1.00

Spelldata

  • id:389710
  • name:Burnout Wave
  • school:fire
  • tooltip:
  • description:{$@spelldesc383926=Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=25627} Fire damage split between all nearby enemies, based on the strength of your binding.}
Cold Heart 2899 3.3% 8.5 35.46sec 101918 0 Direct 8.5 77710 158887 101918 29.8% 0.0%

Stats Details: Cold Heart

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.53 8.53 0.00 0.00 0.00 0.0000 0.0000 868864.01 868864.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.18% 5.98 1 11 77709.89 3118 145962 78063.14 48025 111359 464935 464935 0.00%
crit 29.82% 2.54 0 8 158886.60 8175 297762 150544.34 0 287809 403929 403929 0.00%

Action Details: Cold Heart

  • id:281210
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:281210
  • name:Cold Heart
  • school:frost
  • tooltip:
  • description:{$@spelldesc281208=Every {$t1=2} sec, gain a stack of Cold Heart, causing your next Chains of Ice to deal {$281210s1=0} Frost damage. Stacks up to {$281209u=20} times.}
Frost Fever 3662 4.1% 25.9 11.64sec 42484 0 Periodic 98.7 8502 17266 11125 29.9% 0.0% 98.4%

Stats Details: Frost Fever

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.85 0.00 98.73 98.73 24.19 0.0000 2.9910 1098326.38 1098326.38 0.00% 3719.51 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 70.08% 69.18 44 96 8502.44 2 18651 8504.83 7737 9261 588240 588240 0.00%
crit 29.92% 29.54 14 52 17266.39 14 38477 17269.47 14882 20863 510086 510086 0.00%

Action Details: Frost Fever

  • id:55095
  • school:frost
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.214000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering {$=}w1 Frost damage every {$t1=3} sec.
  • description:A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.
Frost Strike 14748 (22123) 16.6% (24.9%) 112.4 2.65sec 58981 53851 Direct 112.4 (224.8) 30015 61094 39321 29.9% (30.0%) 0.0%

Stats Details: Frost Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.41 112.41 0.00 0.00 0.00 1.0953 0.0000 4420145.37 4420145.37 0.00% 53850.76 53850.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.06% 78.76 51 108 30015.13 9900 73256 30035.90 26765 34981 2363857 2363857 0.00%
crit 29.94% 33.66 13 58 61094.38 20197 149441 61094.55 48998 73807 2056288 2056288 0.00%

Action Details: Frost Strike

  • id:49143
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:25.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:
  • description:Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]

Action Priority List

    default
    [C]:3.48
  • if_expr:active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
    obliteration
    [X]:29.39
  • if_expr:!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    obliteration
    [Z]:21.70
  • if_expr:!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    obliteration
    [b]:3.42
  • if_expr:!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [e]:51.46
  • if_expr:!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
    single_target
    [h]:2.97
  • if_expr:!variable.pooling_runic_power
    Frost Strike Off-Hand 7375 8.3% 112.4 2.65sec 19661 0 Direct 112.4 15015 30514 19661 30.0% 0.0%

Stats Details: Frost Strike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 112.41 112.41 0.00 0.00 0.00 0.0000 0.0000 2210121.97 2210121.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.02% 78.72 51 108 15014.53 4950 36628 15024.40 13328 17157 1181881 1181881 0.00%
crit 29.98% 33.70 13 57 30514.09 10098 73709 30512.10 23777 38363 1028241 1028241 0.00%

Action Details: Frost Strike Offhand

  • id:66196
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:
  • description:{$@spelldesc49143=Chill your {$?=}{$=}owb==0[weapon with icy power and quickly strike the enemy, dealing {$=}<2hDamage> Frost damage.][weapons with icy power and quickly strike the enemy with both, dealing a total of {$=}<dualWieldDamage> Frost damage.]}
Frostwhelp's Aid 322 0.4% 10.9 28.43sec 8864 0 Direct 10.9 6775 13798 8864 29.7% 0.0%

Stats Details: Frostwhelps Aid

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.89 10.89 0.00 0.00 0.00 0.0000 0.0000 96534.22 96534.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.26% 7.65 2 13 6775.42 4201 13038 6771.49 4959 9097 51847 51847 0.00%
crit 29.74% 3.24 0 10 13798.07 8570 25093 13457.17 0 22900 44687 44687 0.00%

Action Details: Frostwhelps Aid

  • id:377245
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377245
  • name:Frostwhelp's Aid
  • school:frost
  • tooltip:
  • description:{$@spelldesc377226=Pillar of Frost summons a Frostwhelp who breathes on all enemies within {$s2=40} yards in front of you for {$377245s1=0} Frost damage. Each unique enemy hit by Frostwhelp's Aid grants you {$=}{{$s3=1}*2}% Mastery for {$287338d=15 seconds}, up to {$=}{{$s3=1}*2*{$377253u=5}}%. }
Frostwyrm's Fury 1560 1.7% 1.9 213.05sec 238437 0 Direct 1.9 182070 370379 238427 29.9% 0.0%

Stats Details: Frostwyrms Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.94 1.94 0.00 0.00 0.00 0.0000 0.0000 462979.92 462979.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.07% 1.36 0 2 182070.31 81407 297069 163547.87 0 297069 247736 247736 0.00%
crit 29.93% 0.58 0 2 370379.48 158363 592461 182851.54 0 585681 215244 215244 0.00%

Action Details: Frostwyrms Fury

  • id:279303
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:279303
  • name:Frostwyrm's Fury
  • school:frost
  • tooltip:Movement speed slowed by {$s2=50}%.
  • description:{$@spelldesc279302=Summons a frostwyrm who breathes on all enemies within {$s1=40} yd in front of you, dealing {$279303s1=0} Frost damage and slowing movement speed by {$279303s2=50}% for {$279303d=10 seconds}.}
Howling Blast 2890 (3802) 3.3% (4.3%) 25.9 11.64sec 44111 39995 Direct 25.9 (51.3) 25605 52159 33534 29.9% (29.9%) 0.0%

Stats Details: Howling Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.85 25.85 0.00 0.00 0.00 1.1029 0.0000 866931.94 866931.94 0.00% 39994.97 39994.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.14% 18.13 4 32 25605.33 5892 62232 25599.02 20754 32181 464317 464317 0.00%
crit 29.86% 7.72 0 19 52158.66 12020 118239 52152.65 0 81531 402615 402615 0.00%

Action Details: Howling Blast

  • id:49184
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:
  • description:Blast the target with a frigid wind, dealing {$=}{{$s1=0}*{$=}<CAP>/{$=}AP} {$?s204088=false}[Frost damage and applying Frost Fever to the target.][Frost damage to that foe, and reduced damage to all other enemies within {$237680=}A1 yards, infecting all targets with Frost Fever.] |Tinterface\icons\spell_deathknight_frostfever.blp:24|t |cFFFFFFFFFrost Fever|r {$@spelldesc55095=A disease that deals {$=}{{$=}o1*{$=}<CAP>/{$=}AP} Frost damage over {$d=24 seconds} and has a chance to grant the Death Knight {$=}{{$195617m1=50}/10} Runic Power each time it deals damage.}

Action Priority List

    obliteration
    [W]:0.47
  • if_expr:!dot.frost_fever.ticking&!buff.killing_machine.react
    obliteration
    [Y]:4.12
  • if_expr:buff.rime.react&buff.killing_machine.react
    obliteration
    [a]:0.90
  • if_expr:!buff.killing_machine.react&runic_power<25
    obliteration
    [c]:0.00
  • if_expr:buff.rime.react
    single_target
    [f]:20.36
  • if_expr:variable.rime_buffs
    Avalanche 912 1.0% 25.4 11.85sec 10763 0 Direct 25.4 8215 16745 10763 29.9% 0.0%

Stats Details: Avalanche

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 25.41 25.41 0.00 0.00 0.00 0.0000 0.0000 273444.54 273444.54 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.13% 17.82 5 33 8215.30 4155 19805 8215.26 6856 9868 146385 146385 0.00%
crit 29.87% 7.59 0 20 16744.80 8476 39045 16736.85 0 33334 127060 127060 0.00%

Action Details: Avalanche

  • id:207150
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:207150
  • name:Avalanche
  • school:frost
  • tooltip:
  • description:{$@spelldesc207142=Casting Howling Blast with Rime active causes jagged icicles to fall on enemies nearby your target, applying Razorice and dealing {$207150s1=0} Frost damage.}
Inexorable Assault 1597 1.8% 42.1 7.16sec 11361 0 Direct 42.1 8666 17624 11361 30.1% 0.0%

Stats Details: Inexorable Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 42.10 42.10 0.00 0.00 0.00 0.0000 0.0000 478243.72 478243.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.92% 29.43 16 43 8665.54 3957 17877 8666.60 7455 9851 255044 255044 0.00%
crit 30.08% 12.66 2 28 17624.35 8072 36325 17625.44 12960 24240 223199 223199 0.00%

Action Details: Inexorable Assault

  • id:253597
  • school:frost
  • range:20.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:253597
  • name:Inexorable Assault
  • school:frost
  • tooltip:
  • description:{$@spelldesc253593=Gain Inexorable Assault every {$t1=8} sec, stacking up to {$253595u=5} times. {$?s207230=false}[Obliterate and Frostscythe consume][Obliterate consumes] a stack to deal an additional {$253597s1=0} Frost damage.}
Obliterate 697 (40526) 0.8% (45.6%) 15.7 18.34sec 774037 91120 Direct 15.7 (244.7) 10210 20865 13356 29.5% (91.0%) 0.0%

Stats Details: Obliterate

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.68 15.68 0.00 0.00 0.00 8.4947 0.0000 209459.14 260204.32 19.50% 91120.38 91120.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.47% 11.05 1 25 10210.35 6692 15277 10208.27 8418 12500 112838 140175 19.50%
crit 29.53% 4.63 0 14 20864.79 13651 31164 20663.16 0 29557 96621 120030 19.31%

Action Details: Obliterate

  • id:49020
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]

Action Priority List

    obliteration
    [V]:66.27
  • if_expr:buff.killing_machine.react&!variable.frostscythe_priority
  • target_if_expr:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
    single_target
    [d]:38.40
  • if_expr:!variable.pooling_runes&buff.killing_machine.react
    single_target
    [g]:17.66
  • if_expr:!variable.pooling_runes
    Obliterate Off-Hand 350 0.4% 15.7 18.34sec 6693 0 Direct 15.7 5103 10441 6693 29.8% 0.0%

Stats Details: Obliterate Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.68 15.68 0.00 0.00 0.00 0.0000 0.0000 104967.54 130397.79 19.50% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.21% 11.01 1 24 5103.40 3346 7638 5102.12 3392 6337 56190 69803 19.50%
crit 29.79% 4.67 0 15 10440.76 6826 15582 10335.06 0 15582 48777 60595 19.31%

Action Details: Obliterate Offhand

  • id:66198
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate (_km) 26319 29.6% 106.6 2.79sec 73913 0 Direct 106.6 0 73912 73912 100.0% 0.0%

Stats Details: Obliterate Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 106.65 106.65 0.00 0.00 0.00 0.0000 0.0000 7882722.85 6854541.61 -15.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 106.65 72 141 73912.44 32482 153094 73911.98 68674 80179 7882723 6854542 -15.00%

Action Details: Obliterate Km

  • id:222024
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:222024
  • name:Obliterate
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
    Obliterate Off-Hand (_km) 13160 14.8% 106.6 2.79sec 36956 0 Direct 106.6 0 36956 36956 100.0% 0.0%

Stats Details: Obliterate Offhand Km

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 106.65 106.65 0.00 0.00 0.00 0.0000 0.0000 3941361.43 3427270.80 -15.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 106.65 72 141 36956.22 16241 76547 36955.99 34337 40089 3941361 3427271 -15.00%

Action Details: Obliterate Offhand Km

  • id:66198
  • school:frost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc49020=A brutal attack {$?=}{$=}owb==0[that deals {$=}<2hDamage> Physical damage.][with both weapons that deals a total of {$=}<dualWieldDamage> Physical damage.]}
Razorice 983 1.1% 411.7 0.77sec 715 0 Direct 411.7 546 1111 715 30.0% 0.0%

Stats Details: Razorice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 411.73 411.73 0.00 0.00 0.00 0.0000 0.0000 294589.67 294589.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.01% 288.27 206 381 546.19 250 1192 546.34 506 595 157449 157449 0.00%
crit 29.99% 123.46 77 183 1110.78 510 2404 1111.04 1016 1233 137140 137140 0.00%

Action Details: Razorice

  • id:50401
  • school:frost
  • range:10.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:50401
  • name:Razorice
  • school:frost
  • tooltip:
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
Strike Twice 371 0.4% 22.9 12.76sec 4859 0 Direct 22.9 3699 7546 4859 30.2% 0.0%

Stats Details: Strike Twice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.91 22.91 0.00 0.00 0.00 0.0000 0.0000 111330.84 159048.11 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.85% 16.00 5 33 3698.80 3699 3699 3698.80 3699 3699 59195 84567 30.00%
crit 30.15% 6.91 0 17 7545.56 7546 7546 7540.53 0 7546 52136 74481 29.98%

Action Details: Strike Twice

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4845.70
  • base_dd_max:4845.70
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
Strike Twice (_oh) 373 0.4% 23.0 12.72sec 4859 0 Direct 23.0 3699 7546 4859 30.2% 0.0%

Stats Details: Strike Twice Oh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.00 23.00 0.00 0.00 0.00 0.0000 0.0000 111762.74 159665.12 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 69.83% 16.06 5 32 3698.80 3699 3699 3698.80 3699 3699 59410 84873 30.00%
crit 30.17% 6.94 0 18 7545.56 7546 7546 7540.53 0 7546 52353 74792 29.98%

Action Details: Strike Twice Oh

  • id:384177
  • school:physical
  • range:50.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4845.70
  • base_dd_max:4845.70
  • base_dd_mult:1.00

Spelldata

  • id:384177
  • name:Strike Twice
  • school:physical
  • tooltip:
  • description:{$@spelldesc384157=Your attacks have a chance to strike out again, dealing {$384177s1=2161} Physical damage.}
pet - ghoul 3277 / 1791
Claw 1067 0.7% 58.7 4.78sec 2973 2973 Direct 58.7 2245 4670 2973 30.0% 0.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 58.73 58.73 0.00 0.00 0.00 1.0000 0.0000 174567.18 249388.04 30.00% 2972.62 2972.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.00% 41.11 23 57 2245.20 1350 3900 2247.76 2042 2494 92293 131851 30.00%
crit 30.00% 17.62 5 31 4669.69 2763 8111 4674.57 4004 5539 82274 117538 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:58.73
  • if_expr:energy>70
Gnaw 2 0.0% 2.9 120.53sec 104 104 Direct 2.9 79 163 104 29.8% 0.0%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.00 1.0000 0.0000 304.31 434.74 30.00% 103.86 103.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.18% 2.06 0 3 78.54 49 112 76.01 0 109 162 231 29.02%
crit 29.82% 0.87 0 3 163.41 102 230 104.97 0 228 143 204 19.28%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:2.93
main_hand 2208 1.4% 109.0 2.54sec 3316 2432 Direct 109.0 2504 5212 3316 30.0% 0.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 109.03 109.03 0.00 0.00 0.00 1.3631 0.0000 361505.54 516449.65 30.00% 2432.48 2432.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 70.04% 76.36 45 101 2504.48 1476 4333 2507.54 2283 2790 191251 273223 30.00%
crit 29.96% 32.67 12 55 5212.00 3120 9012 5218.43 4280 5978 170254 243227 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
T29_Death_Knight_Frost_DW
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost_DW
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Chains of Ice 8.5 35.46sec

Stats Details: Chains Of Ice

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.53 0.00 0.00 0.00 0.00 1.1136 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Chains Of Ice

  • id:45524
  • school:frost
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:45524
  • name:Chains of Ice
  • school:frost
  • tooltip:Movement slowed {$=}w1% {$?=}{$=}w5!=0[and Haste reduced {$=}w5% ][]by frozen chains.
  • description:Shackles the target {$?a373930=false}[and {$373930s1=1} nearby enemy ][]with frozen chains, reducing movement speed by {$s1=70}% for {$d=8 seconds}.

Action Priority List

    cold_heart
    [M]:0.19
  • if_expr:fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
    cold_heart
    [N]:8.34
  • if_expr:talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)
Empower Rune Weapon 4.0 81.24sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [P]:3.97
  • if_expr:talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost_DW
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost_DW
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Frostwyrm's Fury (_driver) 1.9 213.05sec

Stats Details: Frostwyrms Fury Driver

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.94 0.00 0.00 0.00 0.00 1.0236 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Frostwyrms Fury Driver

  • id:279302
  • school:frost
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:279302
  • name:Frostwyrm's Fury
  • school:frost
  • tooltip:
  • description:Summons a frostwyrm who breathes on all enemies within {$s1=40} yd in front of you, dealing {$279303s1=0} Frost damage and slowing movement speed by {$279303s2=50}% for {$279303d=10 seconds}.

Action Priority List

    cooldowns
    [S]:0.18
  • if_expr:active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
    cooldowns
    [T]:1.76
  • if_expr:talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
Pillar of Frost 10.9 28.43sec

Stats Details: Pillar Of Frost

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.89 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Pillar Of Frost

  • id:51271
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.

Action Priority List

    cooldowns
    [R]:10.89
  • if_expr:talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
Elemental Potion of Ultimate Power 1.5 303.43sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [O]:1.47
  • if_expr:variable.cooldown_check|fight_remains<25
Raise Dead 3.0 120.53sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46585
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46585
  • name:Raise Dead
  • school:physical
  • tooltip:
  • description:Raises a {$?s58640=false}[geist][ghoul] to fight by your side. You can have a maximum of one {$?s58640=false}[geist][ghoul] at a time. Lasts {$46585d=60 seconds}.

Action Priority List

    cooldowns
    [U]:2.98
Unholy Strength 23.0 12.71sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 22.95 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Frost_DW
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Abomination Limb 3.0 0.0 122.8sec 121.2sec 11.8sec 11.73% 0.00% 32.0 (32.0) 2.9

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_abomination_limb
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:120.0s / 134.4s
  • trigger_min/max:120.0s / 132.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • abomination_limb_1:11.73%

Spelldata

  • id:383269
  • name:Abomination Limb
  • tooltip:Pulling enemies to your location and dealing {$323798s1=0} Shadow damage to nearby enemies every {$t1=1} sec.
  • description:Sprout an additional limb, dealing {$=}{{$383313s1=0}*13} Shadow damage over {$d=12 seconds} to all nearby enemies. Deals reduced damage beyond {$s5=5} targets. Every {$t1=1} sec, an enemy is pulled to your location if they are further than {$383312s3=8} yds from you. The same enemy can only be pulled once every {$383312d=4 seconds}. Gain {$?a137008=false}[{$s3=3} Bone Shield charges][]{$?a137006=true}[Rime][]{$?a137007=false}[Runic Corruption][] instantly, and again every {$?a353447=false}[{$=}{{$s4=6}-{$353447s2=2}}][{$s4=6}] sec.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bonegrinder (_crit) 18.9 87.8 16.1sec 2.8sec 13.0sec 81.72% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_bonegrinder_crit
  • max_stacks:6
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.70
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.6s / 43.6s
  • trigger_min/max:0.8s / 26.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 33.1s

Stack Uptimes

  • bonegrinder_crit_1:17.56%
  • bonegrinder_crit_2:16.71%
  • bonegrinder_crit_3:16.23%
  • bonegrinder_crit_4:15.85%
  • bonegrinder_crit_5:15.38%

Spelldata

  • id:377101
  • name:Bonegrinder
  • tooltip:Critical Strike chance increased by {$s1=1}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bonegrinder (_frost) 15.8 1.1 18.9sec 17.6sec 10.4sec 54.84% 53.66% 1.1 (1.1) 15.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_bonegrinder_frost
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 78.4s
  • trigger_min/max:5.5s / 78.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.7s

Stack Uptimes

  • bonegrinder_frost_1:54.84%

Spelldata

  • id:377103
  • name:Bonegrinder
  • tooltip:Frost damage increased by {$s1=0}%.
  • description:{$@spelldesc377098=Consuming Killing Machine grants {$377101s1=1}% critical strike chance for {$377101d=10 seconds}, stacking up to {$=}{{$377101u=6}-1} times. At {$=}{{$377101u=6}-1} stacks your next Killing Machine consumes the stacks and grants you {$s1=10}% increased Frost damage for {$377103d=10 seconds}.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Bound by Fire and Blaze 3.0 14.4 121.4sec 15.5sec 19.4sec 19.24% 0.00% 1.7 (1.7) 2.8

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_bound_by_fire_and_blaze
  • max_stacks:6
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:410.31
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Blazebinder's Hoof

Stat Details

  • stat:strength
  • amount:410.31

Trigger Details

  • interval_min/max:120.0s / 138.5s
  • trigger_min/max:0.0s / 127.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • bound_by_fire_and_blaze_1:1.15%
  • bound_by_fire_and_blaze_2:4.37%
  • bound_by_fire_and_blaze_3:4.24%
  • bound_by_fire_and_blaze_4:3.72%
  • bound_by_fire_and_blaze_5:2.72%
  • bound_by_fire_and_blaze_6:3.05%

Spelldata

  • id:383926
  • name:Bound by Fire and Blaze
  • tooltip:Your bond with the blaze grows stronger. Strength increased by {$=}w1.
  • description:Bind with the blaze for {$d=20 seconds}, giving your attacks a high chance to increase your Strength by {$s1=197}, stacking up to {$u=6} times. When your binding is complete, emit a burnout wave, dealing up to {$s2=25627} Fire damage split between all nearby enemies, based on the strength of your binding.
  • max_stacks:6
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Cold Heart 9.4 141.6 33.6sec 2.0sec 31.0sec 97.10% 0.00% 17.3 (17.3) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_cold_heart
  • max_stacks:20
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 108.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 107.2s

Stack Uptimes

  • cold_heart_1:5.55%
  • cold_heart_2:5.51%
  • cold_heart_3:5.47%
  • cold_heart_4:5.44%
  • cold_heart_5:5.40%
  • cold_heart_6:5.36%
  • cold_heart_7:5.32%
  • cold_heart_8:5.29%
  • cold_heart_9:5.25%
  • cold_heart_10:5.21%
  • cold_heart_11:5.17%
  • cold_heart_12:5.13%
  • cold_heart_13:5.10%
  • cold_heart_14:4.51%
  • cold_heart_15:3.35%
  • cold_heart_16:2.51%
  • cold_heart_17:2.05%
  • cold_heart_18:1.75%
  • cold_heart_19:1.50%
  • cold_heart_20:12.24%

Spelldata

  • id:281209
  • name:Cold Heart
  • tooltip:Your next Chains of Ice will deal {$281210s1=0} Frost damage.
  • description:{$@spelldesc281208=Every {$t1=2} sec, gain a stack of Cold Heart, causing your next Chains of Ice to deal {$281210s1=0} Frost damage. Stacks up to {$281209u=20} times.}
  • max_stacks:20
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Earth 7.5 3.6 38.3sec 25.1sec 14.5sec 36.34% 0.00% 3.6 (3.6) 7.1

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_elemental_lariat__empowered_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 117.8s
  • trigger_min/max:0.1s / 114.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.1s

Stack Uptimes

  • elemental_lariat__empowered_earth_1:36.34%

Spelldata

  • id:375345
  • name:Elemental Lariat - Empowered Earth
  • tooltip:Mastery increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 303.5sec 303.5sec 27.2sec 13.06% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 323.1s
  • trigger_min/max:300.0s / 323.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.06%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 4.0 0.0 81.2sec 81.2sec 19.6sec 26.09% 0.00% 11.7 (11.7) 3.8

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:20.0s / 144.0s
  • trigger_min/max:20.0s / 144.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:26.09%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=true}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength 9.9 0.6 30.2sec 28.4sec 18.8sec 62.29% 0.00% 0.6 (0.6) 9.3

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_enduring_strength
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 84.5s
  • trigger_min/max:18.1s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.2s

Stack Uptimes

  • enduring_strength_1:62.29%

Spelldata

  • id:377195
  • name:Enduring Strength
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Enduring Strength (_builder) 10.9 55.4 28.5sec 4.4sec 10.9sec 39.54% 99.71% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_enduring_strength_builder
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:18.1s / 41.7s
  • trigger_min/max:0.8s / 34.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • enduring_strength_builder_1:7.42%
  • enduring_strength_builder_2:7.38%
  • enduring_strength_builder_3:7.30%
  • enduring_strength_builder_4:7.01%
  • enduring_strength_builder_5:5.64%
  • enduring_strength_builder_6:2.70%
  • enduring_strength_builder_7:1.24%
  • enduring_strength_builder_8:0.67%
  • enduring_strength_builder_9:0.16%
  • enduring_strength_builder_10:0.01%
  • enduring_strength_builder_11:0.00%
  • enduring_strength_builder_12:0.00%

Spelldata

  • id:377192
  • name:Enduring Strength
  • tooltip:When Pillar of Frost expires, you will gain {$s1=5}% Strength for {$=}<duration> sec.
  • description:{$@spelldesc377190=When Pillar of Frost expires, your Strength is increased by {$s3=10}% for {$377195d=6 seconds}. This effect lasts {$=}{{$s2=2000}/1000} sec longer for each Obliterate and Frostscythe critical strike during Pillar of Frost.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frostwhelp's Aid 10.9 0.0 28.4sec 28.4sec 14.7sec 53.25% 0.00% 0.0 (0.0) 10.4

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_frostwhelps_aid
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:18.1s / 41.5s
  • trigger_min/max:18.1s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • frostwhelps_aid_1:53.25%

Spelldata

  • id:377253
  • name:Frostwhelp's Aid
  • tooltip:Grants {$=}{{$s1=0}*$mas}% Mastery.
  • description:{$@spelldesc377226=Pillar of Frost summons a Frostwhelp who breathes on all enemies within {$s2=40} yards in front of you for {$377245s1=0} Frost damage. Each unique enemy hit by Frostwhelp's Aid grants you {$=}{{$s3=1}*2}% Mastery for {$287338d=15 seconds}, up to {$=}{{$s3=1}*2*{$377253u=5}}%. }
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Talons 2.0 110.4 129.8sec 2.6sec 149.8sec 98.81% 89.61% 106.5 (106.5) 1.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 352.8s
  • trigger_min/max:0.8s / 13.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.8s

Stack Uptimes

  • icy_talons_1:1.38%
  • icy_talons_2:1.16%
  • icy_talons_3:96.27%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Inexorable Assault 37.4 1.1 8.1sec 8.0sec 1.8sec 21.88% 34.46% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_inexorable_assault
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.3s / 21.2s
  • trigger_min/max:8.0s / 8.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.7s

Stack Uptimes

  • inexorable_assault_1:19.12%
  • inexorable_assault_2:0.60%
  • inexorable_assault_3:0.61%
  • inexorable_assault_4:0.87%
  • inexorable_assault_5:0.68%

Spelldata

  • id:253595
  • name:Inexorable Assault
  • tooltip:{$?s207230=false}[Your next {$m2=0} {$=}LObliterate or Frostscythe:Obliterates or Frostscythes; {$=}Ldeals:deal; an additional {$253597s1=0} Frost damage.][Your next {$m2=0} {$=}LObliterate:Obliterates; {$=}Ldeals:deal; an additional {$253597s1=0} Frost damage.]
  • description:{$@spelldesc253593=Gain Inexorable Assault every {$t1=8} sec, stacking up to {$253595u=5} times. {$?s207230=false}[Obliterate and Frostscythe consume][Obliterate consumes] a stack to deal an additional {$253597s1=0} Frost damage.}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Inspired by Fire and Earth 7.5 3.5 37.9sec 24.9sec 14.4sec 36.29% 0.00% 3.5 (3.5) 7.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_inspired_by_fire_and_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:277.19

Trigger Details

  • interval_min/max:12.0s / 142.6s
  • trigger_min/max:0.0s / 109.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 81.7s

Stack Uptimes

  • inspired_by_fire_and_earth_1:36.29%

Spelldata

  • id:394461
  • name:Inspired by Fire and Earth
  • tooltip:Haste and Versatility increased by {$=}w1.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Killing Machine 107.0 46.3 2.8sec 1.9sec 1.2sec 44.09% 51.49% 46.3 (46.3) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1000.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 26.7s
  • trigger_min/max:0.0s / 26.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.6s

Stack Uptimes

  • killing_machine_1:44.09%

Spelldata

  • id:51124
  • name:Killing Machine
  • tooltip:Guaranteed critical strike on your next Obliterate{$?s207230=false}[ or Frostscythe][].
  • description:Your auto attack has a chance to cause your next Obliterate {$?s207230=false}[or Frostscythe ][]to be a guaranteed critical strike.
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Pillar of Frost 10.9 0.0 28.4sec 28.4sec 11.8sec 42.81% 41.56% 0.0 (0.0) 10.5

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:18.1s / 41.5s
  • trigger_min/max:18.1s / 41.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_1:42.81%

Spelldata

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by {$=}w1%.
  • description:The power of frost increases your Strength by {$s1=25}% for {$d=12 seconds}. Each Rune spent while active increases your Strength by an additional {$s2=2}%.
  • max_stacks:0
  • duration:12.00
  • cooldown:60.00
  • default_chance:101.00%
pillar_of_frost_bonus 10.9 61.0 28.5sec 4.1sec 11.1sec 40.12% 57.59% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_pillar_of_frost_bonus
  • max_stacks:99
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:18.3s / 41.5s
  • trigger_min/max:0.8s / 34.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • pillar_of_frost_bonus_1:0.58%
  • pillar_of_frost_bonus_2:6.16%
  • pillar_of_frost_bonus_3:1.21%
  • pillar_of_frost_bonus_4:5.68%
  • pillar_of_frost_bonus_5:1.61%
  • pillar_of_frost_bonus_6:5.29%
  • pillar_of_frost_bonus_7:1.88%
  • pillar_of_frost_bonus_8:4.98%
  • pillar_of_frost_bonus_9:1.99%
  • pillar_of_frost_bonus_10:4.23%
  • pillar_of_frost_bonus_11:1.52%
  • pillar_of_frost_bonus_12:2.06%
  • pillar_of_frost_bonus_13:0.72%
  • pillar_of_frost_bonus_14:0.80%
  • pillar_of_frost_bonus_15:0.45%
  • pillar_of_frost_bonus_16:0.43%
  • pillar_of_frost_bonus_17:0.29%
  • pillar_of_frost_bonus_18:0.14%
  • pillar_of_frost_bonus_19:0.07%
  • pillar_of_frost_bonus_20:0.02%
  • pillar_of_frost_bonus_21:0.01%
  • pillar_of_frost_bonus_22:0.00%
  • pillar_of_frost_bonus_23:0.00%
  • pillar_of_frost_bonus_24:0.00%
Rime 26.2 37.4 11.5sec 4.7sec 7.5sec 65.85% 98.26% 37.4 (37.4) 0.2

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_rime
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:45.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 68.0s
  • trigger_min/max:0.0s / 54.2s
  • trigger_pct:48.62%
  • duration_min/max:0.0s / 45.6s

Stack Uptimes

  • rime_1:65.85%

Spelldata

  • id:59052
  • name:Rime
  • tooltip:Your next Howling Blast will consume no Runes, generate no Runic Power, and deals {$s2=225}% additional damage.
  • description:Your next Howling Blast will consume no Runes, generate no Runic Power, and deal {$s2=225}% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spelldata

  • id:59057
  • name:Rime
  • tooltip:
  • description:Obliterate has a {$s2=45}% chance {$?s207230=false}[and Frostscythe has a {$=}{{$s2=45}/2}.1% chance ][]to cause your next Howling Blast to consume no runes and deal {$59052s2=225}% additional damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Rune Mastery 13.2 10.4 22.7sec 12.4sec 11.0sec 48.22% 0.00% 10.4 (10.4) 12.7

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 172.9s
  • trigger_min/max:0.8s / 162.1s
  • trigger_pct:15.04%
  • duration_min/max:0.0s / 62.2s

Stack Uptimes

  • rune_mastery_1:48.22%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Shattering Blade 67.9 0.0 4.4sec 4.4sec 0.0sec 0.00% 60.38% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_shattering_blade
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.6s / 14.2s
  • trigger_min/max:1.6s / 14.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:207057
  • name:Shattering Blade
  • tooltip:
  • description:When Frost Strike damages an enemy with {$51714u=5} stacks of Razorice it will consume them to deal an additional {$s1=100}% damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Unholy Strength 8.6 14.4 35.5sec 12.7sec 25.0sec 71.29% 0.00% 14.4 (14.4) 7.8

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 219.2s
  • trigger_min/max:0.0s / 55.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 201.0s

Stack Uptimes

  • unholy_strength_1:71.29%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unleashed Frenzy 2.0 110.4 129.8sec 2.6sec 149.8sec 98.81% 97.00% 106.5 (106.5) 1.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_unleashed_frenzy
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.2s / 352.8s
  • trigger_min/max:0.8s / 13.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.8s

Stack Uptimes

  • unleashed_frenzy_1:1.38%
  • unleashed_frenzy_2:1.16%
  • unleashed_frenzy_3:96.27%

Spelldata

  • id:376907
  • name:Unleashed Frenzy
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc376905=Damaging an enemy with a Runic Power ability increases your Strength by {$s1=2}% for {$376907d=6 seconds}, stacks up to {$338501u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Zone of Focus 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_zone_of_focus
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:220.30

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • zone_of_focus_1:100.00%

Spelldata

  • id:387336
  • name:Zone of Focus
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc387335=Greatly improves the comfort of your gear, allowing you to enter a Zone of Focus while over {$396377s1=90}% health, granting you {$s1=92} Mastery.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Incarnate's Mark of Frost

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_incarnates_mark_of_frost
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:567.88

Spelldata

  • id:382079
  • name:Incarnate's Mark of Frost
  • tooltip:Critical Strike increased by {$=}w1. Dealing harmful spells and abilities has a chance to grant you an additional {$377452=}w2 Versatility or Haste if any nearby allies are Marked by Earth or Fire.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 30.3 13.0 55.0 9.7s 1.1s 117.2s
windfury_totem_extra_attack_oh 25.4 9.0 50.0 11.5s 1.1s 147.2s
Killing Machine spent on Obliterate 106.6 72.0 141.0 2.8s 0.8s 26.1s
Killing Machine: Critical auto attacks 40.0 19.0 61.0 7.4s 1.1s 66.4s
Killing Machine: Cold-Blooded Rage 10.3 0.0 24.0 26.6s 1.6s 234.7s
Killing Machine: Frost Strike 39.6 22.0 59.0 7.4s 1.6s 69.9s
Killing Machine: Howling Blast 1.2 0.0 6.0 115.5s 1.6s 351.4s
Killing Machine: T29 4pc 16.0 3.0 33.0 17.7s 0.8s 195.5s
Killing Machine wasted: Critical auto attacks 23.9 7.0 44.0 13.0s 1.1s 158.3s
Killing Machine wasted: Cold-Blooded Rage 3.2 0.0 11.0 61.2s 0.8s 326.9s
Killing Machine wasted: Frost Strike 14.9 3.0 30.0 19.1s 0.8s 188.3s
Killing Machine wasted: Howling Blast 4.3 0.0 13.0 52.0s 0.8s 316.5s
Rune ready 250.4 187.0 315.0 1.4s 0.0s 13.8s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 11.77% 1.42% 26.18% 1.3s 0.0s 9.5s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=838729)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.3731.878 / 1.1934.76633.958
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
84.247139.967209.966 / 208.991287.338370.980

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Abomination Limb2.9130.00114.3515.4360.00021.112
Pillar of Frost0.8330.00110.6197.4281.07318.787
Frostwyrm's Fury (_driver)32.9030.011160.79530.8030.000160.795
Raise Dead0.5750.0016.6011.0530.0007.729

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
T29_Death_Knight_Frost_DW
Empower Rune WeaponRunic Power19.3784.992.95%4.3911.8812.27%
Empower Rune WeaponRune19.3718.077.22%0.931.306.71%
Frigid ExecutionerRune36.8736.8714.73%1.000.000.00%
Frost FeverRunic Power29.62132.224.59%4.4615.8510.71%
Murderous EfficiencyRune53.3552.2220.86%0.981.132.11%
ObliterationRune17.9416.186.46%0.901.769.83%
Rune RegenerationRune73.5873.5829.39%1.000.000.00%
Runic AttenuationRunic Power80.97362.3412.57%4.4742.5310.50%
Runic EmpowermentRune56.1053.4421.35%0.952.664.74%
Chains of IceRunic Power8.5361.412.13%7.2023.8627.98%
Howling BlastRunic Power25.854.440.15%0.170.020.45%
ObliterateRunic Power122.332238.0177.62%18.29208.628.53%
pet - ghoul
energy_regenEnergy1066.542194.67100.00%2.06203.828.50%
Usage Type Count Total Avg RPE APR
T29_Death_Knight_Frost_DW
Chains of IceRune 8.538.531.001.000.00
Frost StrikeRunic Power 112.412810.3425.0025.002359.24
Howling BlastRune 25.850.450.020.022556474.58
ObliterateRune 122.33244.662.0015.6049613.11
pet - ghoul
ClawEnergy 58.732349.0740.0040.0074.31
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 9.61 9.37 302.8 73.1 0.0 100.0
Rune 6.0 0.83 0.85 0.0 2.7 0.0 6.0

Statistics & Data Analysis

Fight Length
T29_Death_Knight_Frost_DW Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
T29_Death_Knight_Frost_DW Damage Per Second
Count 7499
Mean 88928.61
Minimum 77663.84
Maximum 100052.28
Spread ( max - min ) 22388.44
Range [ ( max - min ) / 2 * 100% ] 12.59%
Standard Deviation 3242.4239
5th Percentile 83686.83
95th Percentile 94330.05
( 95th Percentile - 5th Percentile ) 10643.22
Mean Distribution
Standard Deviation 37.4428
95.00% Confidence Interval ( 88855.22 - 89001.99 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5107
0.1 Scale Factor Error with Delta=300 89748
0.05 Scale Factor Error with Delta=300 358991
0.01 Scale Factor Error with Delta=300 8974769
Priority Target DPS
T29_Death_Knight_Frost_DW Priority Target Damage Per Second
Count 7499
Mean 88928.61
Minimum 77663.84
Maximum 100052.28
Spread ( max - min ) 22388.44
Range [ ( max - min ) / 2 * 100% ] 12.59%
Standard Deviation 3242.4239
5th Percentile 83686.83
95th Percentile 94330.05
( 95th Percentile - 5th Percentile ) 10643.22
Mean Distribution
Standard Deviation 37.4428
95.00% Confidence Interval ( 88855.22 - 89001.99 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5107
0.1 Scale Factor Error with Delta=300 89748
0.05 Scale Factor Error with Delta=300 358991
0.01 Scale Factor Error with Delta=300 8974769
DPS(e)
T29_Death_Knight_Frost_DW Damage Per Second (Effective)
Count 7499
Mean 88928.61
Minimum 77663.84
Maximum 100052.28
Spread ( max - min ) 22388.44
Range [ ( max - min ) / 2 * 100% ] 12.59%
Damage
T29_Death_Knight_Frost_DW Damage
Count 7499
Mean 26103432.42
Minimum 19140698.05
Maximum 33166244.84
Spread ( max - min ) 14025546.79
Range [ ( max - min ) / 2 * 100% ] 26.87%
DTPS
T29_Death_Knight_Frost_DW Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
T29_Death_Knight_Frost_DW Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
T29_Death_Knight_Frost_DW Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
T29_Death_Knight_Frost_DW Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
T29_Death_Knight_Frost_DW Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
T29_Death_Knight_Frost_DW Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
T29_Death_Knight_Frost_DWTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
T29_Death_Knight_Frost_DW Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
5 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
6 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
Estimates a trinkets value by comparing the cooldown of the trinket, divided by the duration of the buff it provides. Has a strength modifier to give a higher priority to strength trinkets, as well as a modifier for if a trinket will or will not sync with cooldowns.
7 0.00 variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
8 0.00 variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
9 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
A 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 auto_attack
0.00 variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
0.00 variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
0.00 variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
0.00 variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
0.00 variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
0.00 variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
0.00 variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
0.00 variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
0.00 variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
0.00 mind_freeze,if=target.debuff.casting.react
Interrupt
0.00 howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
Maintain Frost Fever, Icy Talons and Unleashed Frenzy
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
0.00 frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
C 3.48 frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
0.00 remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
0.00 remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
D 0.00 call_action_list,name=trinkets
Choose Action list to run
E 0.00 call_action_list,name=cooldowns
F 0.00 call_action_list,name=racials
G 0.00 call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
H 0.00 run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
I 0.00 run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
J 0.00 run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
K 0.00 call_action_list,name=aoe,if=active_enemies>=2
L 0.00 call_action_list,name=single_target,if=active_enemies=1
actions.cold_heart
# count action,conditions
M 0.19 chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
Cold Heart
0.00 chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
0.00 chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
0.00 chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>20
N 8.34 chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)
actions.cooldowns
# count action,conditions
O 1.47 potion,if=variable.cooldown_check|fight_remains<25
Cooldowns
P 3.97 empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
0.00 empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
0.00 empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
Q 2.96 abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
0.00 abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
0.00 chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
R 10.89 pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
0.00 pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
0.00 pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
0.00 breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
S 0.18 frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
0.00 frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
T 1.76 frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
U 2.98 raise_dead
0.00 soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
0.00 sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
0.00 any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)
actions.obliteration
# count action,conditions
0.00 remorseless_winter,if=active_enemies>3
Obliteration Active Rotation
V 66.27 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
0.00 frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
W 0.47 howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
X 29.39 frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
Y 4.12 howling_blast,if=buff.rime.react&buff.killing_machine.react
0.00 glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
Z 21.70 frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
a 0.90 howling_blast,if=!buff.killing_machine.react&runic_power<25
0.00 arcane_torrent,if=rune<1&runic_power<25
0.00 glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
b 3.42 frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
c 0.00 howling_blast,if=buff.rime.react
0.00 obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice
actions.single_target
# count action,conditions
0.00 remorseless_winter,if=variable.rw_buffs|variable.adds_remain
Single Target Rotation
0.00 frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
d 38.40 obliterate,if=!variable.pooling_runes&buff.killing_machine.react
0.00 howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
e 51.46 frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
f 20.36 howling_blast,if=variable.rime_buffs
0.00 glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
g 17.66 obliterate,if=!variable.pooling_runes
0.00 horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
0.00 arcane_torrent,if=runic_power.deficit>20
h 2.97 frost_strike,if=!variable.pooling_runic_power
actions.trinkets
# count action,conditions
i 2.24 use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
0.00 use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
j 0.72 use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
0.00 use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

Sample Sequence

012456789ABQUdCfdCPRiOVXVXVXVZVVYVXVZTdNedefdegePedRZVXVZVXVXVZVXVZVefdeddNedefedRZVXVVXVZVVXdedefeedfegdedRZVXVXVZYVbVegdehhdNdefhegfddRXYVUXVZViPVVXVQeefddNedeeffedfgeRZVXVVXbVXVfgedfeddeNefgefgeRVXVZVXVXYVZedhegfdedfehdefRZVVXVZVXVZTdNefgedfdefgeUgedRZiPVXVZVVVVXYVQNedededeefgeefgRXVZVXVZVXVVNegeedfegd

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask T29_Death_Knight_Frost_DW 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food T29_Death_Knight_Frost_DW 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 2 augmentation T29_Death_Knight_Frost_DW 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 4 trinket_1_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 5 trinket_2_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 6 trinket_priority Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 7 rw_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 8 2h_check Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 9 trinket_1_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat A trinket_2_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
0:00.000 default B auto_attack Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
0:00.000 cooldowns Q abomination_limb Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, killing_machine, static_empowerment
0:00.915 cooldowns U raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, killing_machine, rime, static_empowerment
0:00.915 single_target d obliterate Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, killing_machine, rime, static_empowerment
0:01.833 default C frost_strike Fluffy_Pillow 25.0/100: 25% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, rime, bonegrinder_crit, static_empowerment(2)
0:02.750 single_target f howling_blast Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, icy_talons, rime, bonegrinder_crit, unleashed_frenzy, static_empowerment(3)
0:03.669 single_target d obliterate Fluffy_Pillow 5.0/100: 5% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, icy_talons, killing_machine, bonegrinder_crit, unleashed_frenzy, static_empowerment(4)
0:04.587 default C frost_strike Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, icy_talons, killing_machine, bonegrinder_crit(2), unleashed_frenzy, static_empowerment(5)
0:05.504 cooldowns P empower_rune_weapon Fluffy_Pillow 5.0/100: 5% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, icy_talons(2), killing_machine, bonegrinder_crit(2), unleashed_frenzy(2), static_empowerment(5)
0:05.504 cooldowns R pillar_of_frost Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), killing_machine, bonegrinder_crit(2), unleashed_frenzy(2), static_empowerment(5)
0:05.504 trinkets i use_item_blazebinders_hoof Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), killing_machine, pillar_of_frost, bonegrinder_crit(2), frostwhelps_aid, unleashed_frenzy(2), static_empowerment(5)
0:05.504 cooldowns O potion Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), killing_machine, pillar_of_frost, bonegrinder_crit(2), frostwhelps_aid, unleashed_frenzy(2), bound_by_fire_and_blaze, static_empowerment(5)
0:05.504 obliteration V obliterate Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), killing_machine, pillar_of_frost, bonegrinder_crit(2), frostwhelps_aid, unleashed_frenzy(2), bound_by_fire_and_blaze, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.301 obliteration X frost_strike Fluffy_Pillow 30.0/100: 30% runic_power
5.0/6: 83% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(2), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(3), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(2), bound_by_fire_and_blaze(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:07.099 obliteration V obliterate Fluffy_Pillow 5.0/100: 5% runic_power
6.0/6: 100% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(3), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:07.897 obliteration X frost_strike Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(4), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:08.696 obliteration V obliterate Fluffy_Pillow 5.0/100: 5% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(4), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:09.493 obliteration X frost_strike Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(5), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:10.292 obliteration V obliterate Fluffy_Pillow 5.0/100: 5% runic_power
3.0/6: 50% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(5), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:11.091 obliteration Z frost_strike Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:11.888 obliteration V obliterate Fluffy_Pillow 10.0/100: 10% runic_power
4.0/6: 67% rune		 bloodlust, abomination_limb, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:12.684 obliteration V obliterate Fluffy_Pillow 30.0/100: 30% runic_power
3.0/6: 50% rune		 bloodlust, empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:13.484 obliteration Y howling_blast Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:14.282 obliteration V obliterate Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:15.080 obliteration X frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
0.0/6: 0% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(15), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(7), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:15.880 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(15), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(7), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:16.680 obliteration Z frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(17), rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength_builder(8), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:17.479 cooldowns T frostwyrms_fury_driver Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(17), rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength_builder(8), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:18.279 single_target d obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:19.076 cold_heart N chains_of_ice Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(5), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:19.873 single_target e frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(5), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:20.672 single_target d obliterate Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart, empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), static_empowerment(5), elemental_potion_of_ultimate_power
0:21.471 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart, empower_rune_weapon, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), static_empowerment(5), elemental_potion_of_ultimate_power
0:22.269 single_target f howling_blast Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(2), empower_rune_weapon, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:23.067 single_target d obliterate Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(2), empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:23.867 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(3), empower_rune_weapon, icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:24.666 single_target g obliterate Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(3), empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:25.465 single_target e frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(3), empower_rune_weapon, icy_talons(3), bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5), elemental_potion_of_ultimate_power
0:26.263 cooldowns P empower_rune_weapon Fluffy_Pillow 80.0/100: 80% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(4), icy_talons(3), killing_machine, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.263 single_target e frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(4), empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.062 single_target d obliterate Fluffy_Pillow 65.0/100: 65% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(4), empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.862 cooldowns R pillar_of_frost Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.862 obliteration Z frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), pillar_of_frost, rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.660 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.459 obliteration X frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength_builder, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:30.257 obliteration V obliterate Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(6), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength_builder, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.055 obliteration Z frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(6), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.854 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.653 obliteration X frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_frost, enduring_strength_builder(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:33.451 obliteration V obliterate Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, cold_heart(7), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_frost, enduring_strength_builder(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:34.250 obliteration X frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(8), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:35.048 obliteration V obliterate Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(8), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:35.848 obliteration Z frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(9), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
0:36.646 obliteration V obliterate Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(9), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
0:37.445 obliteration X frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(9), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(6), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
0:38.242 obliteration V obliterate Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(10), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(6), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
0:39.041 obliteration Z frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(10), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(14), rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength_builder(7), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
0:39.840 obliteration V obliterate Fluffy_Pillow 50.0/100: 50% runic_power
6.0/6: 100% rune		 bloodlust, rune_mastery, unholy_strength, cold_heart(11), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(14), rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength_builder(7), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
0:40.637 single_target e frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(11), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(5), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
0:41.676 single_target f howling_blast Fluffy_Pillow 55.0/100: 55% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, cold_heart(12), empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit(5), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
0:42.713 single_target d obliterate Fluffy_Pillow 60.0/100: 60% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, cold_heart(12), empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:43.749 single_target e frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, cold_heart(13), empower_rune_weapon, icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:44.785 single_target d obliterate Fluffy_Pillow 70.0/100: 70% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, cold_heart(13), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:45.820 single_target d obliterate Fluffy_Pillow 90.0/100: 90% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(14), empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:46.857 cold_heart N chains_of_ice Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(14), icy_talons(3), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:48.050 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:49.242 single_target d obliterate Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:50.434 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(2), icy_talons(3), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:51.625 single_target f howling_blast Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(3), icy_talons(3), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:52.816 single_target e frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(3), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
0:54.009 single_target d obliterate Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 cold_heart(4), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
0:55.202 cooldowns R pillar_of_frost Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 cold_heart(4), icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:55.202 obliteration Z frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 cold_heart(4), icy_talons(3), pillar_of_frost, rime, bonegrinder_crit(4), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:56.378 obliteration V obliterate Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(5), icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_crit(4), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:57.557 obliteration X frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(6), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(5), enduring_strength_builder, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:58.734 obliteration V obliterate Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(5), enduring_strength_builder, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
0:59.909 obliteration V obliterate Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_frost, enduring_strength_builder(2), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:01.086 obliteration X frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(7), icy_talons(3), inexorable_assault, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:02.264 obliteration V obliterate Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(8), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:03.438 obliteration Z frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:04.615 obliteration V obliterate Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:05.790 obliteration V obliterate Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:06.966 obliteration X frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:08.159 single_target d obliterate Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(3), killing_machine, rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:09.350 single_target e frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:10.541 single_target d obliterate Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(12), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:11.733 single_target e frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
0.0/6: 0% rune		 rune_mastery, cold_heart(13), icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:12.924 single_target f howling_blast Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 cold_heart(13), icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:14.114 single_target e frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune		 cold_heart(14), icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:15.306 single_target e frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 cold_heart(14), icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:16.497 single_target d obliterate Fluffy_Pillow 35.0/100: 35% runic_power
5.0/6: 83% rune		 cold_heart(15), icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:17.688 single_target f howling_blast Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune		 cold_heart(16), icy_talons(3), inexorable_assault, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:18.881 single_target e frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune		 cold_heart(16), icy_talons(3), inexorable_assault, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:20.071 single_target g obliterate Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 cold_heart(17), icy_talons(3), inexorable_assault, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:21.264 single_target d obliterate Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 cold_heart(17), icy_talons(3), killing_machine, rime, bonegrinder_crit, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:22.455 single_target e frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune		 cold_heart(18), icy_talons(3), rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:23.646 single_target d obliterate Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 cold_heart(19), icy_talons(3), killing_machine, rime, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:24.840 cooldowns R pillar_of_frost Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune		 cold_heart(19), icy_talons(3), inexorable_assault, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:24.840 obliteration Z frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune		 cold_heart(19), icy_talons(3), inexorable_assault, pillar_of_frost, rime, bonegrinder_crit(3), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:26.034 obliteration V obliterate Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 cold_heart(20), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, rime, bonegrinder_crit(3), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:27.226 obliteration X frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
1.0/6: 17% rune		 rune_mastery, cold_heart(20), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(4), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:28.417 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit(4), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:29.608 obliteration X frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
1.0/6: 17% rune		 rune_mastery, cold_heart(20), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:30.800 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
1:31.990 obliteration Z frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
0.0/6: 0% rune		 rune_mastery, cold_heart(20), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:33.167 obliteration Y howling_blast Fluffy_Pillow 65.0/100: 65% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:34.342 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:35.518 obliteration b frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
0.0/6: 0% rune		 unholy_strength, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:36.695 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:37.872 single_target e frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(20), icy_talons(3), bonegrinder_crit(2), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:39.049 single_target g obliterate Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(20), icy_talons(3), bonegrinder_crit(2), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:40.226 single_target d obliterate Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(20), icy_talons(3), killing_machine, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:41.402 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:42.578 single_target h frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
0.0/6: 0% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
1:43.756 single_target h frost_strike Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:44.946 single_target d obliterate Fluffy_Pillow 35.0/100: 35% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:46.137 cold_heart N chains_of_ice Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(20), icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:47.329 single_target d obliterate Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), killing_machine, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
1:48.521 single_target e frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
0.0/6: 0% rune		 unholy_strength, cold_heart, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:49.715 single_target f howling_blast Fluffy_Pillow 65.0/100: 65% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(2), icy_talons(3), inexorable_assault, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:50.909 single_target h frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(2), icy_talons(3), inexorable_assault, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:52.101 single_target e frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(3), icy_talons(3), inexorable_assault, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:53.293 single_target g obliterate Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(3), icy_talons(3), inexorable_assault, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:54.483 single_target f howling_blast Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(4), icy_talons(3), killing_machine, rime, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:55.673 single_target d obliterate Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(5), icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:56.866 single_target d obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(5), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_frost, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:58.055 cooldowns R pillar_of_frost Fluffy_Pillow 90.0/100: 90% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(6), icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:58.055 obliteration X frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(6), icy_talons(3), pillar_of_frost, rime, bonegrinder_crit, bonegrinder_frost, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
1:59.247 obliteration Y howling_blast Fluffy_Pillow 65.0/100: 65% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(6), icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_crit, bonegrinder_frost, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:00.439 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 cold_heart(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus, bonegrinder_crit, bonegrinder_frost, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:01.631 cooldowns U raise_dead Fluffy_Pillow 85.0/100: 85% runic_power
1.0/6: 17% rune		 cold_heart(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:01.631 obliteration X frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
1.0/6: 17% rune		 cold_heart(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:02.824 obliteration V obliterate Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(3), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:04.015 obliteration Z frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:05.208 obliteration V obliterate Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(9), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(5), bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:06.400 trinkets i use_item_blazebinders_hoof Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(4), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:06.400 cooldowns P empower_rune_weapon Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(4), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze, static_empowerment(5)
2:06.400 obliteration V obliterate Fluffy_Pillow 90.0/100: 90% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(10), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(7), bonegrinder_crit(4), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze, static_empowerment(5)
2:07.438 obliteration V obliterate Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(10), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit(5), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:08.474 obliteration X frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(11), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(2), static_empowerment(5)
2:09.511 obliteration V obliterate Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, cold_heart(11), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:10.548 cooldowns Q abomination_limb Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(12), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:11.586 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(13), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:12.622 single_target e frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
6.0/6: 100% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(13), empower_rune_weapon, icy_talons(3), inexorable_assault, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:13.660 single_target f howling_blast Fluffy_Pillow 55.0/100: 55% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, cold_heart(14), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:14.698 single_target d obliterate Fluffy_Pillow 55.0/100: 55% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, cold_heart(14), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:15.733 single_target d obliterate Fluffy_Pillow 80.0/100: 80% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, cold_heart(15), empower_rune_weapon, icy_talons(3), killing_machine, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(3), static_empowerment(5)
2:16.769 cold_heart N chains_of_ice Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(15), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
2:17.806 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart, empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(4), static_empowerment(5)
2:18.843 single_target d obliterate Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart, empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(5), static_empowerment(5)
2:19.878 single_target e frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(2), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:20.915 single_target e frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(2), empower_rune_weapon, icy_talons(3), inexorable_assault, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), static_empowerment(5)
2:21.953 single_target f howling_blast Fluffy_Pillow 55.0/100: 55% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, abomination_limb, cold_heart(3), empower_rune_weapon, icy_talons(3), inexorable_assault, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5)
2:22.975 single_target f howling_blast Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(3), empower_rune_weapon, icy_talons(3), inexorable_assault, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5)
2:23.999 single_target e frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(4), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5)
2:25.021 single_target d obliterate Fluffy_Pillow 35.0/100: 35% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(4), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5)
2:26.045 single_target f howling_blast Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(5), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), bound_by_fire_and_blaze(6), inspired_by_fire_and_earth, static_empowerment(5)
2:27.068 single_target g obliterate Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(5), icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:28.245 single_target e frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(6), icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:29.424 cooldowns R pillar_of_frost Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 cold_heart(6), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:29.424 obliteration Z frost_strike Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 cold_heart(6), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, bonegrinder_crit(5), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:30.603 obliteration V obliterate Fluffy_Pillow 30.0/100: 30% runic_power
5.0/6: 83% rune		 cold_heart(7), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, bonegrinder_crit(5), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:31.780 obliteration X frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 cold_heart(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:32.954 obliteration V obliterate Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 cold_heart(8), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:34.130 obliteration V obliterate Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(9), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:35.323 obliteration X frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:36.514 obliteration b frost_strike Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:37.705 Waiting     0.806 sec 20.0/100: 20% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:38.511 obliteration V obliterate Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:39.704 obliteration X frost_strike Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(12), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:40.895 obliteration V obliterate Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(12), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(3), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:42.085 single_target f howling_blast Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(13), icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:43.277 single_target g obliterate Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(13), icy_talons(3), bonegrinder_crit(4), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
2:44.469 single_target e frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(14), icy_talons(3), killing_machine, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:45.660 single_target d obliterate Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(15), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
2:46.851 single_target f howling_blast Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(15), icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:48.045 single_target e frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(16), icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:49.237 single_target d obliterate Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(16), icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:50.429 single_target d obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(17), icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:51.619 single_target e frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(18), icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:52.809 cold_heart N chains_of_ice Fluffy_Pillow 65.0/100: 65% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(18), icy_talons(3), inexorable_assault, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:54.000 single_target e frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), inexorable_assault, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:55.190 single_target f howling_blast Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), inexorable_assault, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:56.382 single_target g obliterate Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(2), icy_talons(3), inexorable_assault, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:57.575 single_target e frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(3), icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
2:58.766 single_target f howling_blast Fluffy_Pillow 65.0/100: 65% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(3), icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
2:59.942 single_target g obliterate Fluffy_Pillow 65.0/100: 65% runic_power
5.0/6: 83% rune		 unholy_strength, cold_heart(4), icy_talons(3), bonegrinder_crit, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:01.119 single_target e frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(4), icy_talons(3), inexorable_assault, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:02.294 cooldowns R pillar_of_frost Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(5), icy_talons(3), inexorable_assault, killing_machine, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:02.294 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(5), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:03.469 obliteration X frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(5), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:04.646 obliteration V obliterate Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(6), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:05.821 obliteration Z frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(7), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:06.996 obliteration V obliterate Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(7), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), bonegrinder_crit(2), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:08.172 obliteration X frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(8), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(3), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:09.349 obliteration V obliterate Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(8), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), bonegrinder_crit(3), enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:10.525 obliteration X frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(9), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:11.715 obliteration Y howling_blast Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:12.908 obliteration V obliterate Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(10), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(9), bonegrinder_crit(4), enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:14.083 obliteration Z frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
0.0/6: 0% rune		 unholy_strength, cold_heart(11), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(11), bonegrinder_crit(5), enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:15.260 single_target e frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(11), icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:16.437 single_target d obliterate Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(12), icy_talons(3), killing_machine, bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:17.614 single_target h frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(13), icy_talons(3), inexorable_assault, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
3:18.790 single_target e frost_strike Fluffy_Pillow 50.0/100: 50% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(13), icy_talons(3), inexorable_assault, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:19.967 single_target g obliterate Fluffy_Pillow 30.0/100: 30% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(14), icy_talons(3), inexorable_assault, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:21.142 single_target f howling_blast Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(14), icy_talons(3), killing_machine, rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:22.318 single_target d obliterate Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(15), icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:23.495 single_target e frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(15), icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
3:24.672 single_target d obliterate Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(16), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:25.865 single_target f howling_blast Fluffy_Pillow 75.0/100: 75% runic_power
0.0/6: 0% rune		 rune_mastery, cold_heart(17), icy_talons(3), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:27.056 single_target e frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
0.0/6: 0% rune		 rune_mastery, cold_heart(17), icy_talons(3), bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:28.248 single_target h frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
1.0/6: 17% rune		 rune_mastery, cold_heart(18), icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:29.439 single_target d obliterate Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(18), icy_talons(3), killing_machine, bonegrinder_crit(2), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:30.630 single_target e frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
0.0/6: 0% rune		 rune_mastery, cold_heart(19), icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), static_empowerment(5)
3:31.822 single_target f howling_blast Fluffy_Pillow 35.0/100: 35% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(20), icy_talons(3), rime, bonegrinder_crit(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:33.012 cooldowns R pillar_of_frost Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(3), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:33.012 obliteration Z frost_strike Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, bonegrinder_crit(3), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:34.203 obliteration V obliterate Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, bonegrinder_crit(3), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:35.394 obliteration V obliterate Fluffy_Pillow 40.0/100: 40% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), bonegrinder_crit(4), enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:36.586 obliteration X frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:37.775 obliteration V obliterate Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(5), enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:38.967 obliteration Z frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(20), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:40.159 obliteration V obliterate Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:41.351 obliteration X frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:42.543 obliteration V obliterate Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(20), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:43.735 obliteration Z frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:44.925 cooldowns T frostwyrms_fury_driver Fluffy_Pillow 35.0/100: 35% runic_power
6.0/6: 100% rune		 unholy_strength, cold_heart(20), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:46.119 single_target d obliterate Fluffy_Pillow 35.0/100: 35% runic_power
6.0/6: 100% rune		 cold_heart(20), icy_talons(3), killing_machine, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:47.311 cold_heart N chains_of_ice Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune		 cold_heart(20), icy_talons(3), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:48.502 single_target e frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:49.695 single_target f howling_blast Fluffy_Pillow 45.0/100: 45% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(2), icy_talons(3), inexorable_assault, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:50.886 single_target g obliterate Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 rune_mastery, cold_heart(2), icy_talons(3), inexorable_assault, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:52.076 single_target e frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 rune_mastery, cold_heart(3), icy_talons(3), bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:53.266 single_target d obliterate Fluffy_Pillow 45.0/100: 45% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(3), icy_talons(3), killing_machine, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:54.459 single_target f howling_blast Fluffy_Pillow 70.0/100: 70% runic_power
5.0/6: 83% rune		 rune_mastery, cold_heart(4), icy_talons(3), killing_machine, rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:55.650 single_target d obliterate Fluffy_Pillow 70.0/100: 70% runic_power
6.0/6: 100% rune		 cold_heart(5), icy_talons(3), killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:56.840 single_target e frost_strike Fluffy_Pillow 90.0/100: 90% runic_power
5.0/6: 83% rune		 rune_mastery, cold_heart(5), icy_talons(3), inexorable_assault, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
3:58.030 single_target f howling_blast Fluffy_Pillow 65.0/100: 65% runic_power
6.0/6: 100% rune		 rune_mastery, cold_heart(6), icy_talons(3), inexorable_assault, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
3:59.222 single_target g obliterate Fluffy_Pillow 65.0/100: 65% runic_power
6.0/6: 100% rune		 rune_mastery, cold_heart(6), icy_talons(3), inexorable_assault, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:00.414 single_target e frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(7), icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:01.604 cooldowns U raise_dead Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(8), icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:01.631 single_target g obliterate Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(8), icy_talons(3), bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:02.824 single_target e frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(8), icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:04.016 single_target d obliterate Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 cold_heart(9), icy_talons(3), killing_machine, bonegrinder_crit(5), unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:05.208 cooldowns R pillar_of_frost Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(9), icy_talons(3), inexorable_assault, rime, bonegrinder_frost, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:05.208 obliteration Z frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 rune_mastery, cold_heart(9), icy_talons(3), inexorable_assault, pillar_of_frost, rime, bonegrinder_frost, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:06.399 trinkets i use_item_blazebinders_hoof Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(10), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, rime, bonegrinder_frost, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, static_empowerment(5)
4:06.400 cooldowns P empower_rune_weapon Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 rune_mastery, cold_heart(10), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, rime, bonegrinder_frost, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze, inspired_by_fire_and_earth, static_empowerment(5)
4:06.400 obliteration V obliterate Fluffy_Pillow 65.0/100: 65% runic_power
5.0/6: 83% rune		 rune_mastery, cold_heart(10), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, rime, bonegrinder_frost, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze, inspired_by_fire_and_earth, static_empowerment(5)
4:07.425 obliteration X frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(10), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:08.449 obliteration V obliterate Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(11), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(2), inspired_by_fire_and_earth, static_empowerment(5)
4:09.471 obliteration Z frost_strike Fluffy_Pillow 85.0/100: 85% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(11), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5)
4:10.494 obliteration V obliterate Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(12), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5)
4:11.518 obliteration V obliterate Fluffy_Pillow 90.0/100: 90% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(12), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(3), inspired_by_fire_and_earth, static_empowerment(5)
4:12.541 obliteration V obliterate Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(13), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(4), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5)
4:13.565 obliteration V obliterate Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(14), empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(5), bonegrinder_frost, enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5)
4:14.588 obliteration X frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(14), empower_rune_weapon, icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(4), inspired_by_fire_and_earth, static_empowerment(5)
4:15.612 obliteration Y howling_blast Fluffy_Pillow 80.0/100: 80% runic_power
1.0/6: 17% rune		 unholy_strength, cold_heart(15), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(12), rime, bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5)
4:16.636 obliteration V obliterate Fluffy_Pillow 85.0/100: 85% runic_power
2.0/6: 33% rune		 unholy_strength, cold_heart(15), empower_rune_weapon, icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(13), bonegrinder_frost, enduring_strength_builder(6), frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(5), inspired_by_fire_and_earth, static_empowerment(5)
4:17.658 cooldowns Q abomination_limb Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(16), empower_rune_weapon, icy_talons(3), bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5)
4:18.694 cold_heart N chains_of_ice Fluffy_Pillow 100.0/100: 100% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, cold_heart(16), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5)
4:19.732 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, cold_heart, empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, frostwhelps_aid, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5)
4:20.770 single_target d obliterate Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, cold_heart, empower_rune_weapon, icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5)
4:21.804 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, cold_heart(2), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5)
4:22.842 single_target d obliterate Fluffy_Pillow 80.0/100: 80% runic_power
6.0/6: 100% rune		 unholy_strength, abomination_limb, cold_heart(2), empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5)
4:23.878 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, cold_heart(3), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5)
4:24.914 single_target d obliterate Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 unholy_strength, abomination_limb, cold_heart(3), empower_rune_weapon, icy_talons(3), killing_machine, rime, bonegrinder_crit(3), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5)
4:25.951 single_target e frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
3.0/6: 50% rune		 unholy_strength, abomination_limb, cold_heart(4), empower_rune_weapon, icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, bound_by_fire_and_blaze(6), static_empowerment(5)
4:26.987 single_target e frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, cold_heart(4), icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), elemental_lariat__empowered_earth, static_empowerment(5)
4:28.181 single_target f howling_blast Fluffy_Pillow 55.0/100: 55% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, cold_heart(5), icy_talons(3), rime, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:29.375 single_target g obliterate Fluffy_Pillow 60.0/100: 60% runic_power
4.0/6: 67% rune		 unholy_strength, abomination_limb, cold_heart(5), icy_talons(3), inexorable_assault, killing_machine, bonegrinder_crit(4), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:30.566 single_target e frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(6), icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:31.757 single_target e frost_strike Fluffy_Pillow 60.0/100: 60% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(7), icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:32.949 single_target f howling_blast Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(7), icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:34.142 single_target g obliterate Fluffy_Pillow 40.0/100: 40% runic_power
4.0/6: 67% rune		 unholy_strength, cold_heart(8), icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:35.334 cooldowns R pillar_of_frost Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(8), icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:35.334 obliteration X frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(8), icy_talons(3), pillar_of_frost, rime, bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
4:36.526 obliteration V obliterate Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(9), icy_talons(3), killing_machine, pillar_of_frost, rime, bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
4:37.718 obliteration Z frost_strike Fluffy_Pillow 65.0/100: 65% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(3), inexorable_assault, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
4:38.910 obliteration V obliterate Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(10), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(2), rime, bonegrinder_frost, enduring_strength_builder, frostwhelps_aid, unleashed_frenzy(3), static_empowerment(5)
4:40.101 obliteration X frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:41.278 obliteration V obliterate Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(11), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(4), rime, bonegrinder_crit, bonegrinder_frost, enduring_strength_builder(2), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:42.454 obliteration Z frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(12), icy_talons(3), pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:43.633 obliteration V obliterate Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(13), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(6), rime, bonegrinder_crit(2), bonegrinder_frost, enduring_strength_builder(3), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:44.809 obliteration X frost_strike Fluffy_Pillow 80.0/100: 80% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(13), icy_talons(3), inexorable_assault, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:45.985 obliteration V obliterate Fluffy_Pillow 55.0/100: 55% runic_power
5.0/6: 83% rune		 rune_mastery, unholy_strength, cold_heart(14), icy_talons(3), inexorable_assault, killing_machine, pillar_of_frost, pillar_of_frost_bonus(8), rime, bonegrinder_crit(3), bonegrinder_frost, enduring_strength_builder(4), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:47.163 obliteration V obliterate Fluffy_Pillow 80.0/100: 80% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, cold_heart(14), icy_talons(3), killing_machine, pillar_of_frost, pillar_of_frost_bonus(10), rime, bonegrinder_crit(4), enduring_strength_builder(5), frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:48.340 cold_heart N chains_of_ice Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart(15), icy_talons(3), rime, bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:49.517 single_target e frost_strike Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), bonegrinder_crit(5), enduring_strength, frostwhelps_aid, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:50.693 single_target g obliterate Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, cold_heart, icy_talons(3), bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), inspired_by_fire_and_earth, static_empowerment(5)
4:51.870 single_target e frost_strike Fluffy_Pillow 95.0/100: 95% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(2), icy_talons(3), killing_machine, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:53.060 single_target e frost_strike Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, cold_heart(2), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:54.251 single_target d obliterate Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(3), icy_talons(3), inexorable_assault, killing_machine, rime, bonegrinder_crit(5), enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:55.441 single_target f howling_blast Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, cold_heart(3), icy_talons(3), rime, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:56.634 single_target e frost_strike Fluffy_Pillow 75.0/100: 75% runic_power
3.0/6: 50% rune		 unholy_strength, cold_heart(4), icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:57.824 single_target g obliterate Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 cold_heart(5), icy_talons(3), bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)
4:59.014 single_target d obliterate Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 cold_heart(5), icy_talons(3), killing_machine, bonegrinder_frost, enduring_strength, unleashed_frenzy(3), static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 2089 2 7839 7534 4944 (4044)
Agility 1734 -2 1818 1732 0
Stamina 3463 2 21588 20560 13326
Intellect 1128 -2 1272 1126 0
Spirit 0 0 0 0 0
Health 431760 411200 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1272 1126 0
Crit 24.39% 24.39% 3130
Haste 26.34% 26.34% 4478
Versatility 3.85% 0.85% 174
Attack Power 8231 7534 0
Mastery 64.11% 64.11% 4330
Armor 7154 7154 7154
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 422.00
Local Head Maw of the Haunted Frostbrood
ilevel: 424, stats: { 948 Armor, +1383 Sta, +236 Haste, +550 Mastery, +512 StrInt }, gems: { +75 StrAgiInt, +66 Haste }
Local Neck Elemental Lariat
ilevel: 418, stats: { +722 Sta, +592 Crit, +592 Mastery }, gems: { +70 Haste, +33 Mastery, +70 Haste, +33 Mastery, +70 Haste, +33 Mastery }
item effects: { equip: Elemental Lariat }
Local Shoulders Jaws of the Haunted Frostbrood
ilevel: 424, stats: { 869 Armor, +1037 Sta, +392 Crit, +198 Haste, +384 StrInt }
Local Chest Breastplate of the Haunted Frostbrood
ilevel: 421, stats: { 1240 Armor, +1333 Sta, +254 Crit, +520 Mastery, +498 StrInt }, enchant: { +150 StrAgiInt }
Local Waist Primal Molten Greatbelt
ilevel: 418, stats: { 684 Armor, +962 Sta, +286 Mastery, +286 Haste, +363 StrInt }, gems: { +70 Haste, +33 Mastery }
item effects: { equip: Blue Silken Lining }
Local Legs Drake Hunter's Greaves
ilevel: 421, stats: { 1085 Armor, +1333 Sta, +503 Haste, +271 Mastery, +498 StrInt }, enchant: { +105 Sta, +177 StrAgi }
Local Feet Verdant Plate Treads
ilevel: 421, stats: { 775 Armor, +1000 Sta, +284 Haste, +295 Mastery, +374 StrInt }
Local Wrists Vambraces of the Haunted Frostbrood
ilevel: 424, stats: { 632 Armor, +778 Sta, +144 Crit, +298 Haste, +288 StrInt }, gems: { +70 Haste, +33 Mastery }
Local Hands Grasps of the Haunted Frostbrood
ilevel: 421, stats: { 697 Armor, +1000 Sta, +407 Haste, +174 Vers, +374 StrInt }
Local Finger1 Seal of Filial Duty
ilevel: 430, stats: { +841 Sta, +320 Haste, +967 Mastery }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Mastery }
item effects: { equip: Broodkeeper's Barrier }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 421, stats: { +750 Sta, +553 Crit, +657 Haste }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Mastery }
item effects: { equip: Signet of Melandrus }
Local Trinket1 Blazebinder's Hoof
ilevel: 421, stats: { +553 Haste }
item effects: { use: Bound by Fire and Blaze }
Local Trinket2 Whispering Incarnate Icon
ilevel: 421, stats: { +473 StrAgiInt }
item effects: { equip: Whispering Incarnate Icon }
Local Back Cloak of Lost Devotion
ilevel: 421, stats: { 224 Armor, +750 Sta, +255 Crit, +180 Haste, +280 StrAgiInt }
Local Main Hand Strike Twice
ilevel: 421, weapon: { 551 - 921, 2.6 }, stats: { +249 Str, +666 Sta, +160 Crit, +227 Mastery }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }
Local Off Hand Strike Twice
ilevel: 421, weapon: { 551 - 921, 2.6 }, stats: { +249 Str, +666 Sta, +160 Crit, +227 Mastery }, enchant: rune_of_razorice, temporary_enchant: Buzzing Rune
item effects: { equip: Strike Twice }

Talents

Talent Tables

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowFrost Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="T29_Death_Knight_Frost_DW"
source=default
spec=frost
level=70
race=tauren
role=attack
position=back
talents=BsPAAAAAAAAAAAAAAAAAAAAAAcgEBASSiEIBRSSSIiIJRSEEkEJJAJJJpkEAAAAAAAAAAAAA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:buzzing_rune_3/off_hand:buzzing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Evaluates a trinkets cooldown, divided by pillar of frost, empower rune weapon, or breath of sindragosa's cooldown. If it's value has no remainder return 1, else return 0.5.
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.1.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.1.cooldown.duration=0))
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(talent.pillar_of_frost&!talent.breath_of_sindragosa&(trinket.2.cooldown.duration%%cooldown.pillar_of_frost.duration=0)|talent.breath_of_sindragosa&(cooldown.breath_of_sindragosa.duration%%trinket.2.cooldown.duration=0))
# Estimates a trinkets value by comparing the cooldown of the trinket, divided by the duration of the buff it provides. Has a strength modifier to give a higher priority to strength trinkets, as well as a modifier for if a trinket will or will not sync with cooldowns.
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=rw_buffs,value=talent.gathering_storm|talent.everfrost
actions.precombat+=/variable,name=2h_check,value=main_hand.2h&talent.might_of_the_frozen_wastes
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit

# Executed every time the actor is available.
actions=auto_attack
# Prevent specified trinkets being used with automatic lines actions+=/variable,name=specified_trinket,value=
actions+=/variable,name=st_planning,value=active_enemies=1&(raid_event.adds.in>15|!raid_event.adds.exists)
actions+=/variable,name=adds_remain,value=active_enemies>=2&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>5)
actions+=/variable,name=rime_buffs,value=buff.rime.react&(talent.rage_of_the_frozen_champion|talent.avalanche|talent.icebreaker)
actions+=/variable,name=rp_buffs,value=talent.unleashed_frenzy&(buff.unleashed_frenzy.remains<gcd*3|buff.unleashed_frenzy.stack<3)|talent.icy_talons&(buff.icy_talons.remains<gcd*3|buff.icy_talons.stack<3)
actions+=/variable,name=cooldown_check,value=talent.pillar_of_frost&buff.pillar_of_frost.up|!talent.pillar_of_frost&buff.empower_rune_weapon.up|!talent.pillar_of_frost&!talent.empower_rune_weapon
actions+=/variable,name=frostscythe_priority,value=talent.frostscythe&(buff.killing_machine.react|active_enemies>=3)&(!talent.improved_obliterate&!talent.frigid_executioner&!talent.frostreaper&!talent.might_of_the_frozen_wastes|!talent.cleaving_strikes|talent.cleaving_strikes&(active_enemies>6|!death_and_decay.ticking&active_enemies>3))
# Formulaic approach to determine the time before these abilities come off cooldown that the simulation should star to pool resources. Capped at 15s in the run_action_list call.
actions+=/variable,name=oblit_pooling_time,op=setif,value=((cooldown.pillar_of_frost.remains_expected+1)%gcd)%((rune+3)*(runic_power+5))*100,value_else=gcd*2,condition=runic_power<35&rune<2&cooldown.pillar_of_frost.remains_expected<10
actions+=/variable,name=breath_pooling_time,op=setif,value=((cooldown.breath_of_sindragosa.remains+1)%gcd)%((rune+1)*(runic_power+20))*100,value_else=gcd*2,condition=runic_power.deficit>10&cooldown.breath_of_sindragosa.remains<10
actions+=/variable,name=pooling_runes,value=talent.obliteration&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
actions+=/variable,name=pooling_runic_power,value=talent.breath_of_sindragosa&cooldown.breath_of_sindragosa.remains<variable.breath_pooling_time|talent.obliteration&runic_power<35&cooldown.pillar_of_frost.remains_expected<variable.oblit_pooling_time
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=(buff.pillar_of_frost.up|!talent.pillar_of_frost)&(talent.obliteration|talent.breath_of_sindragosa&buff.breath_of_sindragosa.up|!talent.breath_of_sindragosa&!talent.obliteration)
# Interrupt
actions+=/mind_freeze,if=target.debuff.casting.react
# Maintain Frost Fever, Icy Talons and Unleashed Frenzy
actions+=/howling_blast,if=!dot.frost_fever.ticking&active_enemies>=2&(!talent.obliteration|talent.obliteration&(!buff.pillar_of_frost.up|buff.pillar_of_frost.up&!buff.killing_machine.react))
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/glacial_advance,if=active_enemies>=2&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.obliteration&talent.breath_of_sindragosa&!buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&talent.breath_of_sindragosa&!buff.breath_of_sindragosa.up&cooldown.breath_of_sindragosa.remains>variable.breath_pooling_time
actions+=/frost_strike,if=active_enemies=1&variable.rp_buffs&!talent.breath_of_sindragosa&talent.obliteration&!buff.pillar_of_frost.up
actions+=/remorseless_winter,if=!talent.breath_of_sindragosa&!talent.obliteration&variable.rw_buffs
actions+=/remorseless_winter,if=talent.obliteration&active_enemies>=3&variable.adds_remain
# Choose Action list to run
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cold_heart,if=talent.cold_heart&(!buff.killing_machine.up|talent.breath_of_sindragosa)&((debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance&!talent.avalanche)|fight_remains<=gcd)
actions+=/run_action_list,name=breath_oblit,if=buff.breath_of_sindragosa.up&talent.obliteration&buff.pillar_of_frost.up
actions+=/run_action_list,name=breath,if=buff.breath_of_sindragosa.up&(!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions+=/run_action_list,name=obliteration,if=talent.obliteration&buff.pillar_of_frost.up&!buff.breath_of_sindragosa.up
actions+=/call_action_list,name=aoe,if=active_enemies>=2
actions+=/call_action_list,name=single_target,if=active_enemies=1

# AoE Action List
actions.aoe=remorseless_winter
actions.aoe+=/howling_blast,if=buff.rime.react|!dot.frost_fever.ticking
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs
actions.aoe+=/obliterate,if=buff.killing_machine.react&talent.cleaving_strikes&death_and_decay.ticking&!variable.frostscythe_priority
actions.aoe+=/glacial_advance,if=!variable.pooling_runic_power
actions.aoe+=/frostscythe,if=variable.frostscythe_priority
actions.aoe+=/obliterate,if=!variable.frostscythe_priority
actions.aoe+=/frost_strike,if=!variable.pooling_runic_power&!talent.glacial_advance
actions.aoe+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.aoe+=/arcane_torrent,if=runic_power.deficit>25

# Breath Active Rotation
actions.breath=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.breath+=/howling_blast,if=variable.rime_buffs&runic_power>(45-talent.rage_of_the_frozen_champion*8)
actions.breath+=/horn_of_winter,if=rune<2&runic_power.deficit>25
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.breath+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.breath+=/frostscythe,if=variable.frostscythe_priority&runic_power>45
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>40|buff.pillar_of_frost.up&runic_power.deficit>15
actions.breath+=/death_and_decay,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/remorseless_winter,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/howling_blast,if=runic_power<32&rune.time_to_2>runic_power%16
actions.breath+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=runic_power.deficit>25
actions.breath+=/howling_blast,if=buff.rime.react
actions.breath+=/arcane_torrent,if=runic_power<60

# Breath & Obliteration Active Rotation
actions.breath_oblit=frostscythe,if=buff.killing_machine.up&variable.frostscythe_priority
actions.breath_oblit+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.up
actions.breath_oblit+=/howling_blast,if=buff.rime.react
actions.breath_oblit+=/howling_blast,if=!buff.killing_machine.up
actions.breath_oblit+=/horn_of_winter,if=runic_power.deficit>25
actions.breath_oblit+=/arcane_torrent,if=runic_power.deficit>20

# Cold Heart
actions.cold_heart=chains_of_ice,if=fight_remains<gcd&(rune<2|!buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>=4|variable.2h_check&buff.cold_heart.stack>8)|buff.killing_machine.up&(!variable.2h_check&buff.cold_heart.stack>8|variable.2h_check&buff.cold_heart.stack>10))
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&buff.pillar_of_frost.up&buff.cold_heart.stack>=10&(buff.pillar_of_frost.remains<gcd*(1+(talent.frostwyrms_fury&cooldown.frostwyrms_fury.ready))|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&death_knight.runeforge.fallen_crusader&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>15&(buff.cold_heart.stack>=10&buff.unholy_strength.up|buff.cold_heart.stack>=13)
actions.cold_heart+=/chains_of_ice,if=!talent.obliteration&!death_knight.runeforge.fallen_crusader&buff.cold_heart.stack>=10&!buff.pillar_of_frost.up&cooldown.pillar_of_frost.remains>20
actions.cold_heart+=/chains_of_ice,if=talent.obliteration&!buff.pillar_of_frost.up&(buff.cold_heart.stack>=14&(buff.unholy_strength.up|buff.chaos_bane.up)|buff.cold_heart.stack>=19|cooldown.pillar_of_frost.remains<3&buff.cold_heart.stack>=14)

# Cooldowns
actions.cooldowns=potion,if=variable.cooldown_check|fight_remains<25
actions.cooldowns+=/empower_rune_weapon,if=talent.obliteration&!buff.empower_rune_weapon.up&rune<6&(cooldown.pillar_of_frost.remains<7&(variable.adds_remain|variable.st_planning)|buff.pillar_of_frost.up)|fight_remains<20
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=buff.breath_of_sindragosa.up&talent.breath_of_sindragosa&!buff.empower_rune_weapon.up&(runic_power<70&rune<3|time<10)
actions.cooldowns+=/empower_rune_weapon,use_off_gcd=1,if=!talent.breath_of_sindragosa&!talent.obliteration&!buff.empower_rune_weapon.up&rune<5&(cooldown.pillar_of_frost.remains_expected<7|buff.pillar_of_frost.up|!talent.pillar_of_frost)
actions.cooldowns+=/abomination_limb,if=talent.obliteration&!buff.pillar_of_frost.up&(variable.adds_remain|variable.st_planning)|fight_remains<12
actions.cooldowns+=/abomination_limb,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/abomination_limb,if=!talent.breath_of_sindragosa&!talent.obliteration&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/chill_streak,if=active_enemies>=2&(!death_and_decay.ticking&talent.cleaving_strikes|!talent.cleaving_strikes|active_enemies<=5)
actions.cooldowns+=/pillar_of_frost,if=talent.obliteration&(variable.adds_remain|variable.st_planning)&(buff.empower_rune_weapon.up|cooldown.empower_rune_weapon.remains)|fight_remains<12
actions.cooldowns+=/pillar_of_frost,if=talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)&(!talent.icecap&(runic_power>70|cooldown.breath_of_sindragosa.remains>40)|talent.icecap&(cooldown.breath_of_sindragosa.remains>10|buff.breath_of_sindragosa.up))
actions.cooldowns+=/pillar_of_frost,if=talent.icecap&!talent.obliteration&!talent.breath_of_sindragosa&(variable.adds_remain|variable.st_planning)
actions.cooldowns+=/breath_of_sindragosa,if=!buff.breath_of_sindragosa.up&runic_power>60&(variable.adds_remain|variable.st_planning)|fight_remains<30
actions.cooldowns+=/frostwyrms_fury,if=active_enemies=1&(talent.pillar_of_frost&buff.pillar_of_frost.remains<gcd*2&buff.pillar_of_frost.up&!talent.obliteration|!talent.pillar_of_frost)&(!raid_event.adds.exists|(raid_event.adds.in>15+raid_event.adds.duration|talent.absolute_zero&raid_event.adds.in>15+raid_event.adds.duration))|fight_remains<3
actions.cooldowns+=/frostwyrms_fury,if=active_enemies>=2&(talent.pillar_of_frost&buff.pillar_of_frost.up|raid_event.adds.exists&raid_event.adds.up&raid_event.adds.in>cooldown.pillar_of_frost.remains_expected-raid_event.adds.in-raid_event.adds.duration)&(buff.pillar_of_frost.remains<gcd*2|raid_event.adds.exists&raid_event.adds.remains<gcd*2)
actions.cooldowns+=/frostwyrms_fury,if=talent.obliteration&(talent.pillar_of_frost&buff.pillar_of_frost.up&!variable.2h_check|!buff.pillar_of_frost.up&variable.2h_check&cooldown.pillar_of_frost.remains|!talent.pillar_of_frost)&((buff.pillar_of_frost.remains<gcd|buff.unholy_strength.up&buff.unholy_strength.remains<gcd)&(debuff.razorice.stack=5|!death_knight.runeforge.razorice&!talent.glacial_advance))
actions.cooldowns+=/raise_dead
actions.cooldowns+=/soul_reaper,if=fight_remains>5&target.time_to_pct_35<5&active_enemies<=2&(buff.breath_of_sindragosa.up&runic_power>40|!buff.breath_of_sindragosa.up&!talent.obliteration|talent.obliteration&!buff.pillar_of_frost.up)
actions.cooldowns+=/sacrificial_pact,if=!talent.glacial_advance&!buff.breath_of_sindragosa.up&pet.ghoul.remains<gcd*2&active_enemies>3
actions.cooldowns+=/any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(buff.pillar_of_frost.up&buff.pillar_of_frost.remains>5|!buff.pillar_of_frost.up)&(active_enemies>5|talent.cleaving_strikes&active_enemies>=2)

# Obliteration Active Rotation
actions.obliteration=remorseless_winter,if=active_enemies>3
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=buff.killing_machine.react&!variable.frostscythe_priority
actions.obliteration+=/frostscythe,if=buff.killing_machine.react&variable.frostscythe_priority
actions.obliteration+=/howling_blast,if=!dot.frost_fever.ticking&!buff.killing_machine.react
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&(variable.rp_buffs|debuff.razorice.stack=5&talent.shattering_blade)&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react&buff.killing_machine.react
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&variable.rp_buffs&!buff.killing_machine.react&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!buff.killing_machine.react&!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=!buff.killing_machine.react&runic_power<25
actions.obliteration+=/arcane_torrent,if=rune<1&runic_power<25
actions.obliteration+=/glacial_advance,if=!variable.pooling_runic_power&active_enemies>=2
actions.obliteration+=/frost_strike,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice,if=!variable.pooling_runic_power&(!talent.glacial_advance|active_enemies=1)
actions.obliteration+=/howling_blast,if=buff.rime.react
actions.obliteration+=/obliterate,target_if=max:(debuff.razorice.stack+1)%(debuff.razorice.remains+1)*death_knight.runeforge.razorice

# Racial Abilities
actions.racials=blood_fury,if=variable.cooldown_check
actions.racials+=/berserking,if=variable.cooldown_check
actions.racials+=/arcane_pulse,if=variable.cooldown_check
actions.racials+=/lights_judgment,if=variable.cooldown_check
actions.racials+=/ancestral_call,if=variable.cooldown_check
actions.racials+=/fireblood,if=variable.cooldown_check
actions.racials+=/bag_of_tricks,if=talent.obliteration&!buff.pillar_of_frost.up&buff.unholy_strength.up
actions.racials+=/bag_of_tricks,if=!talent.obliteration&buff.pillar_of_frost.up&(buff.unholy_strength.up&buff.unholy_strength.remains<gcd*3|buff.pillar_of_frost.remains<gcd*3)

# Single Target Rotation
actions.single_target=remorseless_winter,if=variable.rw_buffs|variable.adds_remain
actions.single_target+=/frostscythe,if=!variable.pooling_runes&buff.killing_machine.react&variable.frostscythe_priority
actions.single_target+=/obliterate,if=!variable.pooling_runes&buff.killing_machine.react
actions.single_target+=/howling_blast,if=buff.rime.react&talent.icebreaker.rank=2
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&talent.obliteration&talent.breath_of_sindragosa
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power&(variable.rp_buffs|runic_power.deficit<25|debuff.razorice.stack=5&talent.shattering_blade)
actions.single_target+=/howling_blast,if=variable.rime_buffs
actions.single_target+=/glacial_advance,if=!variable.pooling_runic_power&!death_knight.runeforge.razorice&(debuff.razorice.stack<5|debuff.razorice.remains<gcd*3)
actions.single_target+=/obliterate,if=!variable.pooling_runes
actions.single_target+=/horn_of_winter,if=rune<4&runic_power.deficit>25&(!talent.breath_of_sindragosa|cooldown.breath_of_sindragosa.remains>cooldown.horn_of_winter.duration)
actions.single_target+=/arcane_torrent,if=runic_power.deficit>20
actions.single_target+=/frost_strike,if=!variable.pooling_runic_power

# Trinkets The trinket with the highest estimated value, will be used first and paired with Pillar of Frost.
actions.trinkets=use_item,slot=trinket1,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.2.has_cooldown|trinket.2.cooldown.remains|variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=(buff.pillar_of_frost.up|buff.breath_of_sindragosa.up)&(!trinket.1.has_cooldown|trinket.1.cooldown.remains|variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
# If only one on use trinket provides a buff, use the other on cooldown. Or if neither trinket provides a buff, use both on cooldown.
actions.trinkets+=/use_item,slot=trinket1,if=(!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)
actions.trinkets+=/use_item,slot=trinket2,if=(!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs)|talent.pillar_of_frost&cooldown.pillar_of_frost.remains>20|!talent.pillar_of_frost)

head=maw_of_the_haunted_frostbrood,id=200408,bonus_id=4800/4786/1498/6935,gem_id=192985
neck=elemental_lariat,id=193001,bonus_id=6652/7936/7979/1540/8767/8782,gem_id=192948/192948/192948,crafted_stats=32/49
shoulders=jaws_of_the_haunted_frostbrood,id=200410,bonus_id=4800/4786/1498
back=cloak_of_lost_devotion,id=193629,bonus_id=6808/4786/1643
chest=breastplate_of_the_haunted_frostbrood,id=200405,bonus_id=4800/4786/1498,enchant_id=6625
wrists=vambraces_of_the_haunted_frostbrood,id=200412,bonus_id=1507/6935,gem_id=192948
hands=grasps_of_the_haunted_frostbrood,id=200407,bonus_id=4800/4786/1498
waist=primal_molten_greatbelt,id=190501,bonus_id=8836/8840/8902/8802/8793/8932/8960,ilevel=418,gem_id=192948,crafted_stats=36/40
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1643,enchant_id=6490
feet=verdant_plate_treads,id=109794,bonus_id=4238/6808/4786/3306,ilevel=421,drop_level=70
finger1=seal_of_filial_duty,id=195526,bonus_id=4800/4786/1497/6935,gem_id=192948,enchant_id=6562
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/6808/4786/3300/6935,ilevel=421,gem_id=192948,enchant_id=6562,drop_level=70
trinket1=blazebinders_hoof,id=193762,bonus_id=6808/4786/1643
trinket2=whispering_incarnate_icon,id=194301,bonus_id=4800/4786/1498
main_hand=strike_twice,id=193700,bonus_id=6652/1643/8767,enchant=rune_of_the_fallen_crusader
off_hand=strike_twice,id=193700,bonus_id=6652/1643/8767,enchant=rune_of_razorice

# Gear Summary
# gear_ilvl=421.75
# gear_strength=4944
# gear_stamina=13326
# gear_crit_rating=3130
# gear_haste_rating=4478
# gear_mastery_rating=4330
# gear_versatility_rating=174
# gear_armor=7154
# set_bonus=tier29_2pc=1
# set_bonus=tier29_4pc=1

T29_Death_Knight_Unholy : 85674 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
85673.7 85673.7 84.5 / 0.099% 13820.7 / 16.1% 4349.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.7 Runic Power 2.77% 57.5 100.0% 100%
TalentBwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T29_Death_Knight_Unholy 85674
Apocalypse 387 0.5% 7.0 45.72sec 16636 16091 Direct 7.0 13652 27291 16636 21.9%

Stats Details: Apocalypse

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.97 6.97 0.00 0.00 0.00 1.0339 0.0000 116017.52 116017.52 0.00% 16091.20 16091.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.12% 5.45 1 8 13651.63 9883 20179 13652.79 11641 16661 74376 74376 0.00%
crit 21.88% 1.53 0 6 27291.10 19964 39475 22252.58 0 37872 41642 41642 0.00%

Action Details: Apocalypse

  • id:275699
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:275699
  • name:Apocalypse
  • school:shadow
  • tooltip:
  • description:Bring doom upon the enemy, dealing $sw1 Shadow damage and bursting up to {$s2=4} Festering Wounds on the target. Summons an Army of the Dead ghoul for {$221180d=15 seconds} for each burst Festering Wound. |cFFFFFFFFGenerates $343758s3 Runes.|r

Action Priority List

    cooldowns
    [P]:6.97
  • if_expr:active_enemies<=3&(!talent.commander_of_the_dead|talent.commander_of_the_dead&buff.commander_of_the_dead_window.up)
  • target_if_expr:debuff.festering_wound.stack
auto_attack_mh 4734 5.5% 169.0 2.14sec 8400 4036 Direct 169.0 6880 13763 8400 22.1%

Stats Details: Auto Attack Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 169.00 169.00 0.00 0.00 0.00 2.0814 0.0000 1419646.47 2028118.09 30.00% 4035.85 4035.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.91% 131.67 92 176 6879.72 5270 9126 6878.95 6596 7121 905869 1294132 30.00%
crit 22.09% 37.33 15 63 13763.08 10540 18253 13761.77 12772 14646 513777 733986 30.00%

Action Details: Auto Attack Mh

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Dark Transformation 325 0.4% 7.0 45.81sec 13942 13506 Direct 7.0 11427 22856 13942 22.0%

Stats Details: Dark Transformation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.99 6.99 0.00 0.00 0.00 1.0323 0.0000 97488.07 97488.07 0.00% 13506.24 13506.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.99% 5.45 1 8 11426.51 8633 16283 11418.19 9471 13924 62316 62316 0.00%
crit 22.01% 1.54 0 6 22855.99 17265 31559 18793.05 0 30360 35172 35172 0.00%

Action Details: Dark Transformation

  • id:63560
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.

Action Priority List

    cooldowns
    [N]:6.71
  • if_expr:variable.st_planning&cooldown.apocalypse.remains<gcd
    cooldowns
    [O]:0.28
  • if_expr:variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
Death Coil 8033 (10408) 9.4% (12.2%) 108.7 2.72sec 28677 27835 Direct 108.6 (246.1) 18142 36274 22144 22.1% (22.1%)

Stats Details: Death Coil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 108.68 108.64 0.00 0.00 0.00 1.0302 0.0000 2405677.29 2405677.29 0.00% 27834.95 27834.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.93% 84.66 59 117 18142.24 10987 30237 18158.77 17010 19561 1536000 1536000 0.00%
crit 22.07% 23.98 8 44 36273.71 21973 60474 36302.53 31363 42547 869678 869678 0.00%

Action Details: Death Coil

  • id:47541
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:runic_power
  • base_cost:30.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:
  • description:Fires a blast of unholy energy at the target{$?a377580=true}[ and {$377580s2=1} additional nearby target][], causing {$47632s1=0} Shadow damage to an enemy or healing an Undead ally for {$47633s1=0} health.{$?s390268=true}[ Increases the duration of Dark Transformation by {$390268s1=1} sec.][]

Action Priority List

    generic
    [R]:108.68
  • if_expr:!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
    Coil of Devastation 2374 2.8% 0.0 0.00sec 0 0 Periodic 137.5 5172 0 5172 0.0% 91.7%

Stats Details: Coil Of Devastation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 137.49 137.49 96.33 0.0000 2.0000 711030.04 711030.04 0.00% 2585.84 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 137.49 104 173 5171.62 1648 21155 5184.95 4278 6351 711030 711030 0.00%

Action Details: Coil Of Devastation

  • id:390271
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:390271
  • name:Coil of Devastation
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every $t sec.
  • description:{$@spelldesc390270=Death Coil causes the target to take an additional {$s1=30}% of the direct damage dealt over {$253367d=4 seconds}.}
Festering Strike 2186 2.6% 31.4 9.32sec 20879 19662 Direct 31.4 17094 34163 20879 22.2%

Stats Details: Festering Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 31.45 31.45 0.00 0.00 0.00 1.0619 0.0000 656587.73 938006.39 30.00% 19662.44 19662.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.82% 24.47 11 38 17094.05 12195 25816 17088.56 15641 18466 418350 597658 30.00%
crit 22.18% 6.97 0 18 34162.82 24389 50906 34117.68 0 43436 238238 340348 29.98%

Action Details: Festering Strike

  • id:85948
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:2.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:20.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:
  • description:Strikes for {$s1=0} Physical damage and infects the target with {$m2=2.500}-{$=}M2 Festering Wounds. |Tinterface\icons\spell_yorsahj_bloodboil_purpleoil.blp:24|t |cFFFFFFFFFestering Wound|r {$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}

Action Priority List

    generic
    [T]:31.45
  • if_expr:!variable.pop_wounds
  • target_if_expr:debuff.festering_wound.stack
Festering Wound 3430 4.0% 113.4 3.19sec 9069 0 Direct 113.4 7426 14850 9069 22.1%

Stats Details: Festering Wound

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.43 113.43 0.00 0.00 0.00 0.0000 0.0000 1028695.63 1028695.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.87% 88.33 53 119 7426.16 4910 12794 7427.32 6905 7895 655925 655925 0.00%
crit 22.13% 25.10 9 50 14850.30 9820 25246 14854.09 12955 17126 372771 372771 0.00%

Action Details: Festering Wound

  • id:194311
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:194311
  • name:Festering Wound
  • school:shadow
  • tooltip:
  • description:{$@spelldesc194310=A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.}
Manic Grieftorch 3100 3.6% 24.9 9.02sec 37309 0 Direct 24.9 30545 61090 37310 22.1%

Stats Details: Manic Grieftorch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.94 24.94 0.00 0.00 0.00 0.0000 0.0000 930380.34 930380.34 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.85% 19.41 8 27 30544.94 30545 30545 30544.94 30545 30545 593013 593013 0.00%
crit 22.15% 5.52 0 14 61089.88 61090 61090 60829.19 0 61090 337367 337367 0.00%

Action Details: Manic Grieftorch

  • id:382135
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27599.74
  • base_dd_max:27599.74
  • base_dd_mult:1.00

Spelldata

  • id:382135
  • name:Manic Grieftorch
  • school:fire
  • tooltip:
  • description:Channel for 2 seconds, unleashing a furious volley of flame around your target, dealing [A Lot] fire damage. Whenever an allied player dies, this cooldown is reduced by 90 seconds.
Outbreak 139 0.2% 11.9 26.31sec 3503 3304 Direct 11.9 2863 5741 3503 22.2%

Stats Details: Outbreak

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.87 11.87 0.00 0.00 0.00 1.0604 0.0000 41585.95 41585.95 0.00% 3303.88 3303.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.76% 9.23 2 14 2863.39 1884 5082 2862.63 2317 3355 26428 26428 0.00%
crit 22.24% 2.64 0 9 5740.59 3767 10026 5454.08 0 9888 15158 15158 0.00%

Action Details: Outbreak

  • id:77575
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Spelldata

  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to the target and infects all nearby enemies with Virulent Plague. |Tinterface\icons\ability_creature_disease_02.blp:24|t |cFFFFFFFFVirulent Plague|r {$@spelldesc191587=A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.}

Action Priority List

    default
    [D]:11.87
  • target_if_expr:(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
Scourge Strike 1638 (4003) 1.9% (4.7%) 85.8 3.41sec 13991 13547 Direct 85.8 (171.6) 4689 9381 5727 22.1% (22.1%)

Stats Details: Scourge Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 85.82 85.82 0.00 0.00 0.00 1.0328 0.0000 491502.54 702164.39 30.00% 13546.94 13546.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.88% 66.84 42 97 4689.30 3337 7164 4688.60 4442 4952 313433 447773 30.00%
crit 22.12% 18.98 5 37 9380.81 6673 14128 9378.99 8341 10494 178069 254391 30.00%

Action Details: Scourge Strike

  • id:55090
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:
  • description:An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.

Action Priority List

    generic
    [S]:85.82
  • if_expr:variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
  • target_if_expr:debuff.festering_wound.stack
    Scourge Strike (_shadow) 2365 2.8% 0.0 0.00sec 0 0 Direct 85.8 6770 13548 8264 22.0%

Stats Details: Scourge Strike Shadow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 85.82 0.00 0.00 0.00 0.0000 0.0000 709257.42 709257.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.95% 66.90 42 95 6769.89 4212 11413 6773.00 6294 7299 452922 452922 0.00%
crit 22.05% 18.92 4 36 13548.43 8772 22634 13553.97 11477 16632 256336 256336 0.00%

Action Details: Scourge Strike Shadow

  • id:70890
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:70890
  • name:Scourge Strike
  • school:shadow
  • tooltip:
  • description:{$@spelldesc55090=An unholy strike that deals {$s2=0} Physical damage and $70890sw2 Shadow damage, and causes 1 Festering Wound to burst.}
Soul Reaper 780 (4367) 0.9% (5.1%) 16.2 6.62sec 80584 74250 Direct 16.2 (32.5) 11802 23568 14392 22.0% (22.1%)

Stats Details: Soul Reaper

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.24 16.24 0.00 0.00 0.00 1.0854 0.0000 233726.33 233726.33 0.00% 74249.98 74249.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.98% 12.66 5 20 11801.55 7304 18588 11834.96 10450 13806 149450 149450 0.00%
crit 22.02% 3.58 0 11 23567.52 14786 37500 23206.79 0 36183 84276 84276 0.00%

Action Details: Soul Reaper

  • id:343294
  • school:shadowfrost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:5.00
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_EXTEND

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:343294
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:Afflicted by Soul Reaper, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage.
  • description:Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.

Action Priority List

    cooldowns
    [Q]:16.24
  • if_expr:active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
    Soul Reaper (_execute) 3587 4.2% 16.2 6.62sec 66212 0 Direct 16.2 54239 108443 66213 22.1%

Stats Details: Soul Reaper Execute

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.23 16.23 0.00 0.00 0.00 0.0000 0.0000 1074929.59 1074929.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.91% 12.65 3 20 54238.68 39958 79104 54350.09 47962 62202 686033 686033 0.00%
crit 22.09% 3.59 0 12 108443.35 81962 158208 106469.22 0 153923 388897 388897 0.00%

Action Details: Soul Reaper Execute

  • id:343295
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:343295
  • name:Soul Reaper
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc343294=Strike an enemy for {$s1=0} Shadowfrost damage and afflict the enemy with Soul Reaper. After {$d=5 seconds}, if the target is below {$s3=35}% health this effect will explode dealing an additional {$343295s1=0} Shadowfrost damage to the target. If the enemy that yields experience or honor dies while afflicted by Soul Reaper, gain Runic Corruption.}
Unholy Assault 284 0.3% 3.7 90.70sec 22900 20777 Direct 3.7 18737 37459 22900 22.2%

Stats Details: Unholy Assault

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.1023 0.0000 85145.61 85145.61 0.00% 20777.36 20777.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.77% 2.89 0 4 18737.37 16217 22768 18647.78 0 22437 54180 54180 0.00%
crit 22.23% 0.83 0 4 37458.66 32434 45535 22699.41 0 45535 30966 30966 0.00%

Action Details: Unholy Assault

  • id:207289
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:207289
  • name:Unholy Assault
  • school:shadow
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.

Action Priority List

    cooldowns
    [M]:3.72
  • if_expr:variable.st_planning
Unholy Pact 2313 2.7% 123.1 2.64sec 5631 0 Direct 123.1 4610 9216 5631 22.2%

Stats Details: Unholy Pact

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 123.08 123.08 0.00 0.00 0.00 0.0000 0.0000 692988.53 692988.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.83% 95.80 68 126 4609.61 2888 7398 4610.67 4227 4958 441576 441576 0.00%
crit 22.17% 27.28 10 50 9215.86 5775 14795 9218.96 7761 10585 251412 251412 0.00%

Action Details: Unholy Pact

  • id:319236
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:319236
  • name:Unholy Pact
  • school:shadow
  • tooltip:Deals {$s1=0} Shadow damage.
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
Virulent Plague 1486 1.7% 11.9 26.31sec 37543 0 Periodic 99.2 3680 7361 4493 22.1% 99.2%

Stats Details: Virulent Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.87 0.00 99.19 99.19 10.87 0.0000 3.0000 445641.64 445641.64 0.00% 1497.65 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 77.92% 77.29 50 104 3680.21 2442 6352 3681.04 3451 3921 284429 284429 0.00%
crit 22.08% 21.90 6 41 7360.88 4883 12704 7362.78 6503 8332 161213 161213 0.00%

Action Details: Virulent Plague

  • id:191587
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.125000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:0.95
  • dot_duration:27.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:191587
  • name:Virulent Plague
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=3} sec. Erupts for {$191685s1=0} damage split among all nearby enemies when the infected dies.
  • description:A disease that deals {$=}o Shadow damage over {$d=27 seconds}. It erupts when the infected target dies, dealing {$191685s1=0} Shadow damage to nearby enemies.
pet - ghoul 14709 / 14709
Claw 638 0.7% 40.8 7.27sec 4704 4683 Direct 40.8 3852 7707 4704 22.1%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 40.79 40.79 0.00 0.00 0.00 1.0045 0.0000 191886.66 274130.78 30.00% 4683.25 4683.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.90% 31.78 16 49 3852.45 2595 12906 3850.60 3441 4245 122420 174890 30.00%
crit 22.10% 9.01 0 23 7707.18 5190 21674 7702.41 0 9897 69467 99241 30.00%

Action Details: Claw

  • id:91776
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91776
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$=}<damage> Physical damage.

Action Priority List

    default
    [ ]:40.79
  • if_expr:energy>70
Gnaw 0 0.0% 0.0 90.11sec 144 133 Direct 0.0 122 234 144 19.7%

Stats Details: Gnaw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.02 0.02 0.00 0.00 0.00 1.1104 0.0000 2.93 4.18 30.00% 133.12 133.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.26% 0.02 0 3 122.36 95 342 1.91 0 342 2 3 0.47%
crit 19.74% 0.00 0 1 234.47 190 302 0.94 0 302 1 1 0.12%

Action Details: Gnaw

  • id:91800
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91800
  • name:Gnaw
  • school:physical
  • tooltip:Stunned.
  • description:Bite and tear at a target's limbs, stunning it for {$d=1 second} and dealing damage.

Action Priority List

    default
    [ ]:0.02
main_hand 10891 12.7% 238.9 1.25sec 13641 10960 Direct 238.9 11170 22376 13641 22.1%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 238.92 238.92 0.00 0.00 0.00 1.2447 0.0000 3259264.40 4656210.72 30.00% 10959.71 10959.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.95% 186.23 128 239 11170.23 2918 24911 11188.56 10050 12529 2080234 2971839 30.00%
crit 22.05% 52.69 27 85 22375.63 5836 49164 22409.61 16366 29707 1179030 1684372 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Monstrous Blow 79 0.1% 3.6 91.17sec 6495 6466 Direct 3.6 5321 10622 6495 22.1%

Stats Details: Monstrous Blow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.64 3.64 0.00 0.00 0.00 1.0045 0.0000 23638.91 33770.74 30.00% 6465.79 6465.79
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.86% 2.83 0 4 5321.28 2996 7007 5292.76 0 6722 15079 21543 29.78%
crit 22.14% 0.81 0 4 10621.55 6212 14014 6322.74 0 14014 8559 12228 17.86%

Action Details: Monstrous Blow

  • id:91797
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91797
  • name:Monstrous Blow
  • school:physical
  • tooltip:Stunned.
  • description:Strike an enemy with a smashing attack, dealing {$s2=0} Physical damage and stunning for {$d=2 seconds}.

Action Priority List

    default
    [ ]:3.64
Sweeping Claws 3101 3.6% 78.8 3.72sec 11772 11719 Direct 78.8 9642 19281 11772 22.1%

Stats Details: Sweeping Claws

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 78.80 78.80 0.00 0.00 0.00 1.0045 0.0000 927620.78 927620.78 0.00% 11719.49 11719.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.90% 61.38 43 83 9642.01 2922 16015 9646.20 8972 10408 591845 591845 0.00%
crit 22.10% 17.42 4 35 19280.66 6059 31328 19289.07 15482 23758 335775 335775 0.00%

Action Details: Sweeping Claws

  • id:91778
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:91778
  • name:Sweeping Claws
  • school:shadow
  • tooltip:
  • description:Rakes an enemy with deformed claws, dealing {$=}<sweepingclaw> Shadow damage to the target and nearby enemies.

Action Priority List

    default
    [ ]:78.80
pet - gargoyle 58360 / 9847
Gargoyle Strike 58360 11.4% 44.6 4.66sec 65374 68104 Direct 44.6 53536 107110 65374 22.1%

Stats Details: Gargoyle Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.64 44.64 0.00 0.00 0.00 0.9599 0.0000 2917982.74 2917982.74 0.00% 68103.97 68103.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.90% 34.77 23 43 53536.32 13940 115168 53533.93 44510 63246 1861638 1861638 0.00%
crit 22.10% 9.86 1 21 107109.75 28503 225275 107029.12 62922 159017 1056345 1056345 0.00%

Action Details: Gargoyle Strike

  • id:51963
  • school:shadowstorm
  • range:40.0
  • travel_speed:25.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51963
  • name:Gargoyle Strike
  • school:shadowstorm
  • tooltip:
  • description:Inflicts {$s1=0} Plague damage to an enemy.

Action Priority List

    default
    [ ]:46.64
pet - risen_skulker 2162 / 2162
Skulker Shot 2162 2.5% 176.0 1.70sec 3682 2166 Direct 175.9 3018 6034 3683 22.0%

Stats Details: Skulker Shot

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 175.98 175.91 0.00 0.00 0.00 1.6996 0.0000 647912.14 925612.37 30.00% 2166.13 2166.13
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.95% 137.13 99 178 3018.14 2214 4974 3019.53 2854 3191 413871 591259 30.00%
crit 22.05% 38.79 17 64 6034.21 4428 9948 6037.13 5425 6727 234041 334353 30.00%

Action Details: Skulker Shot

  • id:212423
  • school:physical
  • range:35.0
  • travel_speed:40.0000
  • radius:8.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:212423
  • name:Skulker Shot
  • school:physical
  • tooltip:
  • description:A ranged shot that causes Physical damage.

Action Priority List

    default
    [ ]:176.98
pet - magus_of_the_dead 14543 / 6452
Frostbolt 4041 2.1% 37.7 7.80sec 14183 11858 Direct 37.7 11621 23223 14187 22.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.66 37.65 0.00 0.00 0.00 1.1961 0.0000 534140.76 534140.76 0.00% 11858.20 11858.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.88% 29.32 18 41 11620.92 5794 17546 11624.43 10519 12602 340767 340767 0.00%
crit 22.12% 8.33 0 18 23222.53 11588 35092 23235.45 0 30628 193374 193374 0.00%

Action Details: Frostbolt

  • id:317792
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:3.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317792
  • name:Frostbolt
  • school:frost
  • tooltip:Movement speed reduced by {$=}w2%.
  • description:Deals {$s1=0} Frost damage and reduces their movement speed by {$s2=60}% for {$d=6 seconds}.

Action Priority List

    default
    [ ]:30.93
    default
    [ ]:10.14
Shadow Bolt 10502 5.4% 99.0 2.92sec 14018 12528 Direct 98.9 11488 22967 14021 22.1%

Stats Details: Shadow Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 98.97 98.95 0.00 0.00 0.00 1.1189 0.0000 1387377.95 1387377.95 0.00% 12527.91 12527.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.94% 77.12 58 98 11488.24 5515 16948 11491.97 10487 12473 885935 885935 0.00%
crit 22.06% 21.83 8 38 22967.46 11029 33449 22972.72 19494 26862 501442 501442 0.00%

Action Details: Shadow Bolt

  • id:317791
  • school:shadow
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:317791
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage.

Action Priority List

    default
    [ ]:74.37
    default
    [ ]:30.19
pet - army_ghoul 44637 / 10110
Claw 7240 1.9% 233.3 0.91sec 2081 2081 Direct 233.3 1705 3411 2081 22.0%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 233.28 233.28 0.00 0.00 0.00 1.0000 0.0000 485423.99 693480.52 30.00% 2080.86 2080.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.99% 181.94 155 215 1705.43 784 2353 1705.44 1509 1835 310279 443267 30.00%
crit 22.01% 51.34 29 76 3411.18 1568 4706 3411.01 3082 3714 175145 250214 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:29.34
    default
    [ ]:29.26
    default
    [ ]:29.31
    default
    [ ]:29.16
    default
    [ ]:29.15
    default
    [ ]:29.06
    default
    [ ]:29.00
    default
    [ ]:28.99
main_hand 37397 9.8% 398.6 0.53sec 6290 6311 Direct 398.6 5153 10307 6290 22.1%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 398.63 398.63 0.00 0.00 0.00 0.9967 0.0000 2507327.54 3581987.81 30.00% 6310.65 6310.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.94% 310.69 277 348 5152.79 2457 7042 5152.74 4595 5494 1600921 2287088 30.00%
crit 22.06% 87.94 56 123 10306.94 4915 14083 10306.12 9020 11102 906407 1294900 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - apoc_ghoul 15312 / 5233
Claw 3046 1.2% 167.3 1.68sec 1862 1862 Direct 167.3 1526 3052 1862 22.1%

Stats Details: Claw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 167.26 167.26 0.00 0.00 0.00 1.0000 0.0000 311490.08 444997.17 30.00% 1862.29 1862.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.94% 130.37 90 173 1525.70 1059 2260 1526.90 1387 1642 198907 284160 30.00%
crit 22.06% 36.89 18 65 3051.87 2117 4520 3054.02 2690 3499 112583 160837 30.00%

Action Details: Claw

  • id:199373
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:energy
  • base_cost:40.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:199373
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, dealing {$s1=0}% of normal melee damage.

Action Priority List

    default
    [ ]:41.93
    default
    [ ]:41.97
    default
    [ ]:41.85
    default
    [ ]:41.51
main_hand 12266 4.9% 219.7 1.27sec 5708 4771 Direct 219.7 4676 9352 5708 22.1%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 219.68 219.68 0.00 0.00 0.00 1.1964 0.0000 1253878.26 1791300.33 30.00% 4770.70 4770.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 77.94% 171.21 120 219 4676.18 3168 6763 4680.43 4260 5042 800610 1143758 30.00%
crit 22.06% 48.47 26 82 9352.25 6336 13526 9360.20 8306 10697 453268 647542 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
T29_Death_Knight_Unholy
Army of the Dead 2.0 173.03sec

Stats Details: Army Of The Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.02 0.00 16.09 0.00 0.00 1.0369 0.5000 0.00 0.00 0.00% 0.00 0.00

Action Details: Army Of The Dead

  • id:42650
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:480.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:rune
  • base_cost:1.0
  • secondary_cost:0.0
  • energize_type:on_cast
  • energize_resource:runic_power
  • energize_amount:10.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:42650
  • name:Army of the Dead
  • school:shadow
  • tooltip:Summoning ghouls.
  • description:Summons a legion of ghouls who swarms your enemies, fighting anything they can for {$42651d=30 seconds}.

Action Priority List

    default
    [C]:2.02
  • if_expr:talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 181.30sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    racials
    [U]:2.00
  • if_expr:(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
Empower Rune Weapon 2.4 167.97sec

Stats Details: Empower Rune Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.41 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Empower Rune Weapon

  • id:47568
  • school:physical
  • range:0.0
  • travel_speed:4.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:attack_haste
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]

Action Priority List

    cooldowns
    [K]:2.41
  • if_expr:variable.st_planning&runic_power.deficit>20&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Unholy
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Manic Grieftorch (_channel) 2.8 120.59sec

Stats Details: Manic Grieftorch Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.78 0.00 24.98 0.00 0.00 1.3471 0.1500 0.00 0.00 0.00% 0.00 0.00

Action Details: Manic Grieftorch Channel

  • id:377463
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:true
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:377463
  • name:Manic Grieftorch
  • school:fire
  • tooltip:
  • description:Channel for {$d=2 seconds}, unleashing a furious volley of flame around your target, dealing {$=}{{$394954s1=7014}*({$d=2 seconds}/$t)*(1+{$@=}versadmg)} Fire damage to your target with a chance to strike nearby enemies for additional damage. Whenever an allied player dies, this cooldown is reduced by {$s2=90} seconds.

Action Details: Manic Grieftorch Missile

  • id:382136
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382136
  • name:Manic Grieftorch
  • school:fire
  • tooltip:
  • description:Channel for 2 seconds, unleashing a furious volley of flame around your target, dealing [A Lot] fire damage. Whenever an allied player dies, this cooldown is reduced by 90 seconds.
Elemental Potion of Ultimate Power 1.5 306.24sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    cooldowns
    [J]:1.46
  • if_expr:(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Raise Dead 1.0 0.00sec

Stats Details: Raise Dead

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Raise Dead

  • id:46584
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises {$?s207313=false}[an abomination]?s58640[a geist][a ghoul] to fight by your side. You can have a maximum of one {$?s207313=false}[abomination]?s58640[geist][ghoul] at a time.
Algeth'ar Puzzle (solved_the_puzzle) 2.0 183.40sec

Stats Details: Solved The Puzzle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Solved The Puzzle

  • id:383781
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • school:physical
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
Summon Gargoyle 2.0 183.13sec

Stats Details: Summon Gargoyle

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Summon Gargoyle

  • id:49206
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:runic_power
  • energize_amount:50.0

Spelldata

  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:
  • description:Summon a Gargoyle into the area to bombard the target for {$61777d=25 seconds}. The Gargoyle gains {$211947s1=1}% increased damage for every {$s4=1} Runic Power you spend. |cFFFFFFFFGenerates {$=}{{$s5=500}/10} Runic Power.|r

Action Priority List

    cooldowns
    [L]:2.00
  • if_expr:buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
Unholy Strength 24.7 11.92sec

Stats Details: Unholy Strength

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 24.68 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Unholy Strength

  • id:53365
  • school:physical
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Death_Knight_Unholy
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Algeth'ar Puzzle 2.0 2.0 183.4sec 61.1sec 20.0sec 13.52% 0.00% 2.0 (2.0) 2.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_algethar_puzzle
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:4313.38
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:4313.38

Trigger Details

  • interval_min/max:181.6s / 186.5s
  • trigger_min/max:0.0s / 186.5s
  • trigger_pct:100.00%
  • duration_min/max:20.0s / 20.0s

Stack Uptimes

  • algethar_puzzle_1:13.52%

Spelldata

  • id:383781
  • name:Algeth'ar Puzzle
  • tooltip:Mastery increased by {$=}w1.
  • description:Solve a puzzle, increasing your Mastery by {$s1=1768} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 181.3sec 181.3sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 184.4s
  • trigger_min/max:180.0s / 184.4s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
commander_of_the_dead_window 7.0 0.0 45.8sec 45.8sec 4.0sec 9.29% 47.38% 0.0 (0.0) 6.9

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_commander_of_the_dead_window
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 48.4s
  • trigger_min/max:45.0s / 48.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.0s

Stack Uptimes

  • commander_of_the_dead_window_1:9.29%
Dark Transformation 7.0 0.0 45.8sec 45.8sec 23.7sec 55.42% 61.81% 0.0 (0.0) 6.5

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 48.4s
  • trigger_min/max:45.0s / 48.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.0s

Stack Uptimes

  • dark_transformation_1:55.42%

Spelldata

  • id:63560
  • name:Dark Transformation
  • tooltip:{$?=}{$=}w2>0[Transformed into an undead monstrosity.][Gassy.] Damage dealt increased by {$=}w1%.
  • description:Your {$?s207313=false}[abomination]?s58640[geist][ghoul] deals {$344955s1=0} Shadow damage to {$344955s2=5} nearby enemies and transforms into a powerful undead monstrosity for {$d=15 seconds}. {$?s325554=true}[Granting them {$325554s1=100}% energy and the][The] {$?s207313=false}[abomination]?s58640[geist][ghoul]'s abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Air 4.6 1.0 55.2sec 44.0sec 13.0sec 19.98% 0.00% 1.0 (1.0) 4.4

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_elemental_lariat__empowered_air
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 327.0s
  • trigger_min/max:0.2s / 327.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.8s

Stack Uptimes

  • elemental_lariat__empowered_air_1:19.98%

Spelldata

  • id:375342
  • name:Elemental Lariat - Empowered Air
  • tooltip:Haste increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Earth 4.6 0.9 54.9sec 43.7sec 13.0sec 19.94% 0.00% 0.9 (0.9) 4.4

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_elemental_lariat__empowered_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 298.6s
  • trigger_min/max:0.1s / 298.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.4s

Stack Uptimes

  • elemental_lariat__empowered_earth_1:19.94%

Spelldata

  • id:375345
  • name:Elemental Lariat - Empowered Earth
  • tooltip:Mastery increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.3sec 306.3sec 27.3sec 13.06% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:strength
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 326.3s
  • trigger_min/max:300.0s / 326.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.06%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Empower Rune Weapon 2.4 0.0 168.0sec 168.0sec 19.3sec 15.46% 0.00% 7.0 (7.0) 2.2

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_empower_rune_weapon
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:5.00

Trigger Details

  • interval_min/max:120.0s / 273.5s
  • trigger_min/max:120.0s / 273.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • empower_rune_weapon_1:15.46%

Spelldata

  • id:47568
  • name:Empower Rune Weapon
  • tooltip:Haste increased by {$s3=15}%. Generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power every {$t1=5} sec.
  • description:Empower your rune weapon, gaining {$s3=15}% Haste and generating {$s1=1} {$=}LRune:Runes; and {$=}{{$m2=50}/10} Runic Power instantly and every {$t1=5} sec for {$d=20 seconds}. {$?s137006=false}[ If you already know {$@=}spellname47568, instead gain {$392714s1=1} additional {$=}Lcharge:charges; of {$@=}spellname47568.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:strength
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Festermight 13.4 79.4 22.9sec 3.2sec 19.3sec 86.45% 0.00% 0.0 (0.0) 12.5

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_festermight
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 67.2s
  • trigger_min/max:0.8s / 55.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • festermight_1:6.62%
  • festermight_2:7.38%
  • festermight_3:7.90%
  • festermight_4:13.19%
  • festermight_5:10.64%
  • festermight_6:10.67%
  • festermight_7:8.05%
  • festermight_8:6.88%
  • festermight_9:5.50%
  • festermight_10:3.94%
  • festermight_11:2.92%
  • festermight_12:1.78%
  • festermight_13:0.72%
  • festermight_14:0.21%
  • festermight_15:0.03%
  • festermight_16:0.00%

Spelldata

  • id:377591
  • name:Festermight
  • tooltip:Strength increased by {$=}w1%.
  • description:{$@spelldesc377590=Popping a Festering Wound increases your Strength by {$s1=1}% for {$377591d=20 seconds} stacking. Does not refresh duration.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Ghoulish Infusion 13.6 20.1 22.1sec 8.6sec 13.1sec 59.29% 60.29% 20.1 (20.1) 13.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_ghoulish_infusion
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 127.7s
  • trigger_min/max:0.5s / 114.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 86.7s

Stack Uptimes

  • ghoulish_infusion_1:59.29%

Spelldata

  • id:394899
  • name:Ghoulish Infusion
  • tooltip:Damage and Haste increased by {$s1=8}%.
  • description:{$@spelldesc393627=Your primary ghoul's attacks have a {$s1=8}% chance to increase your damage and Haste by {$394899s1=8}% for {$394899d=8 seconds}. This chance is increased to {$s2=15}% during Vile Infusion.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Icy Talons 6.3 102.4 49.9sec 2.7sec 45.5sec 95.25% 86.56% 90.5 (90.5) 5.3

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_icy_talons
  • max_stacks:3
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 279.1s
  • trigger_min/max:0.8s / 16.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 277.6s

Stack Uptimes

  • icy_talons_1:4.30%
  • icy_talons_2:4.40%
  • icy_talons_3:86.55%

Spelldata

  • id:194879
  • name:Icy Talons
  • tooltip:Attack speed increased {$=}w1%.
  • description:{$@spelldesc194878=Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.}
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:194878
  • name:Icy Talons
  • tooltip:
  • description:Your Runic Power spending abilities increase your melee attack speed by {$s1=3}% for {$194879d=6 seconds}, stacking up to {$194879u=3} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Rune Mastery 12.6 9.5 23.5sec 13.1sec 10.9sec 45.70% 0.00% 9.5 (9.5) 12.1

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_rune_mastery
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 143.3s
  • trigger_min/max:0.8s / 143.3s
  • trigger_pct:14.98%
  • duration_min/max:0.0s / 66.2s

Stack Uptimes

  • rune_mastery_1:45.70%

Spelldata

  • id:374585
  • name:Rune Mastery
  • tooltip:Strength increased by {$=}w1%
  • description:{$@spelldesc374574=Consuming a Rune has a chance to increase your Strength by {$s1=3}% for {$374585d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Runic Corruption 45.2 6.9 6.5sec 5.7sec 2.3sec 34.97% 0.00% 6.9 (6.9) 44.8

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_runic_corruption
  • max_stacks:1
  • base duration:3.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 71.1s
  • trigger_min/max:0.8s / 69.9s
  • trigger_pct:47.93%
  • duration_min/max:0.0s / 18.0s

Stack Uptimes

  • runic_corruption_1:34.97%

Spelldata

  • id:51460
  • name:Runic Corruption
  • tooltip:Rune regeneration rate increased by {$=}w1%.
  • description:Increases your rune regeneration rate for {$51460d=3 seconds}.
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:strength
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Sudden Doom 23.4 0.3 12.6sec 12.4sec 0.9sec 7.01% 0.00% 0.3 (0.3) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:attack_speed
  • frequency:2.50
  • modifier:1.00

Trigger Details

  • interval_min/max:1.1s / 51.7s
  • trigger_min/max:1.1s / 51.7s
  • trigger_pct:14.41%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • sudden_doom_1:7.01%

Spelldata

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil{$?s207317=false}[ or Epidemic][] consumes no Runic Power.
  • description:{$@spelldesc49530=Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.}
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:49530
  • name:Sudden Doom
  • tooltip:
  • description:Your auto attacks have a chance to make your next Death Coil{$?s207317=false}[ or Epidemic][] cost no Runic Power.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Unholy Assault 3.7 0.0 90.7sec 90.7sec 19.5sec 24.23% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_unholy_assault
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 93.4s
  • trigger_min/max:90.0s / 93.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • unholy_assault_1:24.23%

Spelldata

  • id:207289
  • name:Unholy Assault
  • tooltip:Haste increased by {$s1=20}%.
  • description:Strike your target dealing {$s2=0} Shadow damage, infecting the target with {$s3=4} Festering Wounds and sending you into an Unholy Frenzy increasing haste by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Unholy Pact 7.0 0.0 45.8sec 45.8sec 14.7sec 34.32% 38.57% 96.0 (96.0) 6.7

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_unholy_pact
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:45.0s / 48.4s
  • trigger_min/max:45.0s / 48.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • unholy_pact_1:34.32%

Spelldata

  • id:319233
  • name:Unholy Pact
  • tooltip:
  • description:{$@spelldesc319230=Dark Transformation creates an unholy pact between you and your pet, igniting flaming chains that deal {$=}{{$319236s1=0}*{$s2=15}} Shadow damage over {$s2=15} sec to enemies between you and your pet.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.4 16.3 36.6sec 11.9sec 26.7sec 74.50% 0.00% 16.3 (16.3) 7.6

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.18
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 187.9s
  • trigger_min/max:0.0s / 50.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 185.8s

Stack Uptimes

  • unholy_strength_1:74.50%

Spelldata

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Zone of Focus 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_zone_of_focus
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:220.30

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • zone_of_focus_1:100.00%

Spelldata

  • id:387336
  • name:Zone of Focus
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc387335=Greatly improves the comfort of your gear, allowing you to enter a Zone of Focus while over {$396377s1=90}% health, granting you {$s1=92} Mastery.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.8 0.0 46.5sec 46.5sec 14.7sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 93.5s
  • trigger_min/max:45.0s / 93.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 46.0sec 46.0sec 14.7sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 93.4s
  • trigger_min/max:45.0s / 93.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 45.9sec 45.9sec 14.7sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 93.4s
  • trigger_min/max:45.0s / 93.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
apoc_ghoul - apoc_ghoul: Commander of the Dead 6.9 0.0 46.0sec 46.0sec 14.7sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_apoc_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 93.5s
  • trigger_min/max:45.0s / 93.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 183.0sec 183.0sec 28.9sec 96.16% 99.99% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.2s / 187.3s
  • trigger_min/max:181.2s / 187.3s
  • trigger_pct:100.00%
  • duration_min/max:26.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:96.16%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 181.9sec 181.9sec 28.3sec 94.34% 99.97% 0.0 (0.0) 0.9

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:179.9s / 187.1s
  • trigger_min/max:179.9s / 187.1s
  • trigger_pct:100.00%
  • duration_min/max:24.5s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:94.34%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 182.3sec 182.3sec 28.6sec 95.13% 99.98% 0.0 (0.0) 0.9

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.4s / 186.6s
  • trigger_min/max:180.4s / 186.6s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:95.13%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 182.8sec 182.8sec 28.8sec 95.91% 99.98% 0.0 (0.0) 0.9

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.9s / 186.1s
  • trigger_min/max:180.9s / 186.1s
  • trigger_pct:100.00%
  • duration_min/max:25.5s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:95.91%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 182.9sec 182.9sec 28.9sec 96.18% 99.99% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.1s / 186.8s
  • trigger_min/max:181.1s / 186.8s
  • trigger_pct:100.00%
  • duration_min/max:26.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:96.18%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 183.0sec 183.0sec 28.8sec 96.08% 99.98% 0.0 (0.0) 0.2

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.2s / 187.2s
  • trigger_min/max:181.2s / 187.2s
  • trigger_pct:100.00%
  • duration_min/max:25.8s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:96.08%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 183.0sec 183.0sec 28.8sec 95.90% 99.97% 0.0 (0.0) 0.3

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.7s / 187.7s
  • trigger_min/max:180.7s / 187.7s
  • trigger_pct:100.00%
  • duration_min/max:25.3s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:95.90%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
army_ghoul - army_ghoul: Commander of the Dead 2.0 0.0 183.1sec 183.1sec 28.7sec 95.56% 99.97% 0.0 (0.0) 0.5

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_army_ghoul
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.2s / 188.2s
  • trigger_min/max:180.2s / 188.2s
  • trigger_pct:100.00%
  • duration_min/max:24.8s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:95.56%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Commander of the Dead 2.0 0.0 183.1sec 183.1sec 25.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.4s / 186.3s
  • trigger_min/max:181.4s / 186.3s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • commander_of_the_dead_1:100.00%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
gargoyle - gargoyle: Dark Empowerment 2.0 0.0 183.9sec 183.9sec 22.8sec 91.21% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_gargoyle
  • cooldown name:buff_dark_empowerment
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:181.8s / 187.5s
  • trigger_min/max:181.8s / 187.5s
  • trigger_pct:100.00%
  • duration_min/max:20.8s / 23.7s

Stack Uptimes

  • dark_empowerment_1:91.21%

Spelldata

  • id:211947
  • name:Dark Empowerment
  • tooltip:Damage dealt increased by {$=}w1%.
  • description:Spending Runic Power increases damage done.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
ghoul - ghoul: Vile Infusion 16.9 75.9 18.0sec 3.2sec 14.9sec 84.23% 81.48% 75.9 (75.9) 16.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_ghoul
  • cooldown name:buff_vile_infusion
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.75
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 107.5s
  • trigger_min/max:0.8s / 55.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 101.0s

Stack Uptimes

  • vile_infusion_1:84.23%

Spelldata

  • id:394863
  • name:Vile Infusion
  • tooltip:Damage increased by {$s1=25}% and Haste increased by {$s2=10}%.
  • description:{$@spelldesc393626=Bursting a Festering Wound grants your ghoul Vile Infusion, increasing their damage by {$394863s1=25}% and Haste by {$394863s2=10}% for {$394863d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 6.6 0.0 48.1sec 48.1sec 17.9sec 95.29% 96.03% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:44.0s / 185.6s
  • trigger_min/max:44.0s / 185.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:95.29%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
magus_of_the_dead - magus_of_the_dead: Commander of the Dead 2.4 0.0 134.6sec 134.6sec 15.7sec 99.54% 99.61% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy_magus_of_the_dead
  • cooldown name:buff_commander_of_the_dead
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.35
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:44.0s / 186.5s
  • trigger_min/max:44.0s / 186.5s
  • trigger_pct:100.00%
  • duration_min/max:5.6s / 30.0s

Stack Uptimes

  • commander_of_the_dead_1:99.54%

Spelldata

  • id:390264
  • name:Commander of the Dead
  • tooltip:All damage done increased by {$s1=35}%.
  • description:{$@spelldesc390259=Dark Transformation also empowers your {$?s207349=false}[Dark Arbiter][Gargoyle] and Army of the Dead for {$390264d=30 seconds}, increasing their damage by {$390264s1=35}%.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 28.2 10.0 50.0 10.4s 1.1s 111.4s
delayed_aa_cast 2.0 2.0 2.0 183.1s 181.4s 186.3s
delayed_aa_channel 1.9 0.0 3.0 140.2s 118.4s 243.4s
Rune ready 175.1 131.0 224.0 1.8s 0.0s 10.7s
Runic Corruption from Runic Power Spent 52.1 29.0 78.0 5.7s 0.8s 69.9s
Festering Wound from Festering Strike 78.6 50.0 108.0 9.3s 0.9s 49.7s
Festering Wound from Infected Claws 35.8 13.0 59.0 8.3s 1.0s 89.7s
Festering Wound from Unholy Assault 14.9 12.0 16.0 90.7s 90.0s 93.4s
Uptime Avg % Min Max Avg Dur Min Max
Runic Power Cap 3.32% 0.00% 13.76% 2.1s 0.0s 20.3s
ghoul - Energy Cap 0.60% 0.25% 1.59% 0.3s 0.0s 1.0s

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=320711)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0931.756 / 0.9896.12329.496
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
41.22257.30375.085 / 74.57594.902123.337

Cooldown Waste Details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Army of the Dead13.4740.01328.93713.7640.00028.937
Apocalypse0.7310.00145.2824.2821.82046.094
Empower Rune Weapon49.5660.001153.49667.75361.014153.496
Summon Gargoyle3.1361.4456.3183.1361.4456.318
Unholy Assault0.9270.0013.3941.8880.0004.782
Dark Transformation0.8970.0013.3734.8391.23010.267
Soul Reaper0.7870.00110.2589.4432.02020.613

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
T29_Death_Knight_Unholy
ApocalypseRune13.9513.887.93%1.000.070.49%
Empower Rune WeaponRunic Power11.6157.152.19%4.920.881.51%
Empower Rune WeaponRune11.6110.405.94%0.901.2110.42%
Festering WoundRunic Power113.43325.8012.46%2.8714.494.26%
Rune RegenerationRune150.80150.8086.13%1.000.000.00%
Runic AttenuationRunic Power84.29407.6915.60%4.8413.773.27%
Army of the DeadRunic Power2.0220.130.77%9.940.120.58%
Festering StrikeRunic Power31.45603.7923.10%19.2025.164.00%
OutbreakRunic Power11.87114.324.37%9.634.383.69%
Scourge StrikeRunic Power85.82840.2032.14%9.7918.032.10%
Soul ReaperRunic Power16.24152.225.82%9.3710.186.27%
Summon GargoyleRunic Power2.0092.503.54%46.257.507.50%
pet - ghoul
Dark TransformationEnergy6.99355.087.53%50.78344.1849.22%
energy_regenEnergy1317.774362.1292.47%3.3167.171.52%
pet - army_ghoul
energy_regenEnergy989.947964.48100.00%8.051392.9514.89%
pet - apoc_ghoul
energy_regenEnergy552.294427.75100.00%8.022029.5531.43%
Usage Type Count Total Avg RPE APR
T29_Death_Knight_Unholy
Army of the DeadRune 2.022.021.001.000.00
Death CoilRunic Power 108.682561.0823.5623.561216.95
Festering StrikeRune 31.4562.892.002.0010439.50
OutbreakRune 11.8711.871.001.003503.41
Scourge StrikeRune 85.8285.821.001.0013991.15
Soul ReaperRune 16.2416.241.001.0080583.74
pet - ghoul
ClawEnergy 40.791631.6140.0040.00117.61
Sweeping ClawsEnergy 78.803151.9140.0040.00294.30
pet - army_ghoul
ClawEnergy 233.289331.2640.0040.0052.02
pet - apoc_ghoul
ClawEnergy 167.266690.5540.0040.0046.56
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Runic Power 0.0 8.71 8.54 94.5 52.7 0.0 100.0
Rune 6.0 0.58 0.60 0.0 2.2 0.0 6.0

Statistics & Data Analysis

Fight Length
T29_Death_Knight_Unholy Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
T29_Death_Knight_Unholy Damage Per Second
Count 7499
Mean 85673.66
Minimum 76654.08
Maximum 98549.88
Spread ( max - min ) 21895.80
Range [ ( max - min ) / 2 * 100% ] 12.78%
Standard Deviation 3734.9955
5th Percentile 80132.11
95th Percentile 92311.21
( 95th Percentile - 5th Percentile ) 12179.11
Mean Distribution
Standard Deviation 43.1309
95.00% Confidence Interval ( 85589.13 - 85758.20 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7301
0.1 Scale Factor Error with Delta=300 119087
0.05 Scale Factor Error with Delta=300 476348
0.01 Scale Factor Error with Delta=300 11908686
Priority Target DPS
T29_Death_Knight_Unholy Priority Target Damage Per Second
Count 7499
Mean 85673.66
Minimum 76654.08
Maximum 98549.88
Spread ( max - min ) 21895.80
Range [ ( max - min ) / 2 * 100% ] 12.78%
Standard Deviation 3734.9955
5th Percentile 80132.11
95th Percentile 92311.21
( 95th Percentile - 5th Percentile ) 12179.11
Mean Distribution
Standard Deviation 43.1309
95.00% Confidence Interval ( 85589.13 - 85758.20 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7301
0.1 Scale Factor Error with Delta=300 119087
0.05 Scale Factor Error with Delta=300 476348
0.01 Scale Factor Error with Delta=300 11908686
DPS(e)
T29_Death_Knight_Unholy Damage Per Second (Effective)
Count 7499
Mean 85673.66
Minimum 76654.08
Maximum 98549.88
Spread ( max - min ) 21895.80
Range [ ( max - min ) / 2 * 100% ] 12.78%
Damage
T29_Death_Knight_Unholy Damage
Count 7499
Mean 11140300.71
Minimum 8264612.69
Maximum 13828624.67
Spread ( max - min ) 5564011.98
Range [ ( max - min ) / 2 * 100% ] 24.97%
DTPS
T29_Death_Knight_Unholy Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
T29_Death_Knight_Unholy Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
T29_Death_Knight_Unholy Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
T29_Death_Knight_Unholy Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
T29_Death_Knight_Unholy Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
T29_Death_Knight_Unholy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
T29_Death_Knight_UnholyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
T29_Death_Knight_Unholy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 raise_dead
5 0.00 fleshcraft
6 0.00 variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
7 0.00 variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
8 0.00 variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
9 0.00 variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
A 0.00 variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit
Default action list Executed every time the actor is available.
# count action,conditions
B 1.00 auto_attack
0.00 mind_freeze,if=target.debuff.casting.react
0.00 variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
Variables
0.00 variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
0.00 variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
0.00 variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
0.00 variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
0.00 variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
0.00 variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
0.00 variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
0.00 invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&runic_power.deficit>20&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
C 2.02 army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
Prioritize Army, Outbreak and Maintaining Plaguebringer
D 11.87 outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
0.00 wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
E 0.00 call_action_list,name=trinkets
Call Action Lists
F 0.00 call_action_list,name=racials
G 0.00 call_action_list,name=cooldowns
H 0.00 run_action_list,name=aoe,if=active_enemies>=4
I 0.00 run_action_list,name=generic,if=active_enemies<=3
actions.cooldowns
# count action,conditions
J 1.46 potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
Potion
0.00 vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
Cooldowns
0.00 raise_dead,if=!pet.ghoul.active
K 2.41 empower_rune_weapon,if=variable.st_planning&runic_power.deficit>20&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
0.00 empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
L 2.00 summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
M 3.72 unholy_assault,if=variable.st_planning
N 6.71 dark_transformation,if=variable.st_planning&cooldown.apocalypse.remains<gcd
O 0.28 dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
P 6.97 apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&(!talent.commander_of_the_dead|talent.commander_of_the_dead&buff.commander_of_the_dead_window.up)
Q 16.24 soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
0.00 soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
0.00 unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
0.00 unholy_blight,if=variable.adds_remain|fight_remains<21
0.00 abomination_limb,if=variable.st_planning&rune<3
0.00 sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd
actions.generic
# count action,conditions
R 108.68 death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
Generic
0.00 any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
S 85.82 wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
T 31.45 festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
0.00 death_coil
actions.racials
# count action,conditions
0.00 arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
Racials
0.00 blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
U 2.00 berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
0.00 lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
0.00 ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
0.00 arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
0.00 fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
0.00 bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)
actions.trinkets
# count action,conditions
V 2.00 use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
Trinkets
0.00 use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
0.00 use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
W 2.78 use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

Sample Sequence

01246789ABCDMNLVJPRKRRUSRSSRTSRSRSRSRSTRDRSSRTWRSSTRSRSSRRSTRSRTTRRDNPSSRRTSRSRSTRSRSRTRSSDRTRSRSRSRTRTMNPSSTRRRDSRSSSRRTRSSRSRSTRSSRSDRSRTRTRNPSSTRWRRSSRSSDRRTSRSSRRTRSSRSSRTRCMDNLVPURKRRQRRSSRSTQRSRSRSSQRTRSSQDRRSTQRRSRRQSTRRTQRNPSQDSRRSQTRSSQRRTRSQRSSRTQRDRSWQSRMSTQRNPSSTQRRSRSRQSDRRSQRTRS

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask T29_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune
Pre precombat 1 food T29_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 2 augmentation T29_Death_Knight_Unholy 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 4 raise_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 6 trinket_1_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 7 trinket_2_sync Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 8 trinket_priority Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat 9 trinket_1_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
Pre precombat A trinket_2_buffs Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
0:00.000 default B auto_attack Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 static_empowerment
0:00.000 default C army_of_the_dead Fluffy_Pillow 0.0/100: 0% runic_power
6.0/6: 100% rune		 bloodlust, static_empowerment
0:00.938 default D outbreak Fluffy_Pillow 10.0/100: 10% runic_power
5.0/6: 83% rune		 bloodlust, static_empowerment
0:01.875 cooldowns M unholy_assault Fluffy_Pillow 20.0/100: 20% runic_power
4.0/6: 67% rune		 bloodlust, static_empowerment(2)
0:02.814 cooldowns N dark_transformation Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, unholy_assault, ghoulish_infusion, static_empowerment(3)
0:03.568 cooldowns L summon_gargoyle Fluffy_Pillow 25.0/100: 25% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, dark_transformation, unholy_assault, unholy_pact, ghoulish_infusion, commander_of_the_dead_window, static_empowerment(4)
0:03.568 trinkets V use_item_algethar_puzzle_box Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, dark_transformation, unholy_assault, unholy_pact, ghoulish_infusion, commander_of_the_dead_window, static_empowerment(4)
0:04.528 cooldowns J potion Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, dark_transformation, unholy_assault, unholy_pact, ghoulish_infusion, commander_of_the_dead_window, algethar_puzzle, static_empowerment(5)
0:04.528 cooldowns P apocalypse Fluffy_Pillow 75.0/100: 75% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, dark_transformation, unholy_assault, unholy_pact, ghoulish_infusion, commander_of_the_dead_window, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.283 generic R death_coil Fluffy_Pillow 92.0/100: 92% runic_power
6.0/6: 100% rune		 bloodlust, unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, commander_of_the_dead_window, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.038 cooldowns K empower_rune_weapon Fluffy_Pillow 62.0/100: 62% runic_power
6.0/6: 100% rune		 bloodlust, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, commander_of_the_dead_window, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.038 generic R death_coil Fluffy_Pillow 67.0/100: 67% runic_power
6.0/6: 100% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, commander_of_the_dead_window, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.792 generic R death_coil Fluffy_Pillow 42.0/100: 42% runic_power
6.0/6: 100% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, commander_of_the_dead_window, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.547 racials U berserking Fluffy_Pillow 12.0/100: 12% runic_power
6.0/6: 100% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.547 generic S scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
6.0/6: 100% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.302 generic R death_coil Fluffy_Pillow 30.0/100: 30% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.056 generic S scourge_strike Fluffy_Pillow 5.0/100: 5% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(5), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.809 generic S scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.563 generic R death_coil Fluffy_Pillow 31.0/100: 31% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.316 generic T festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
5.0/6: 83% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.071 generic S scourge_strike Fluffy_Pillow 26.0/100: 26% runic_power
4.0/6: 67% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.826 generic R death_coil Fluffy_Pillow 44.0/100: 44% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.580 generic S scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune		 bloodlust, berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(8), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.335 generic R death_coil Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.090 generic S scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
5.0/6: 83% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(9), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.843 generic R death_coil Fluffy_Pillow 15.0/100: 15% runic_power
4.0/6: 67% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(10), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.597 generic S scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
6.0/6: 100% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(10), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.351 generic R death_coil Fluffy_Pillow 38.0/100: 38% runic_power
5.0/6: 83% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(11), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.105 generic S scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
5.0/6: 83% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(11), algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.860 generic T festering_strike Fluffy_Pillow 21.0/100: 21% runic_power
4.0/6: 67% rune		 bloodlust, berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.613 generic R death_coil Fluffy_Pillow 46.0/100: 46% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.365 default D outbreak Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.120 generic R death_coil Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(12), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.875 generic S scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(12), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.629 generic S scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune		 bloodlust, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(13), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.383 generic R death_coil Fluffy_Pillow 37.0/100: 37% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(14), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.138 generic T festering_strike Fluffy_Pillow 7.0/100: 7% runic_power
4.0/6: 67% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(14), ghoulish_infusion, algethar_puzzle, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.894 trinkets W use_item_manic_grieftorch Fluffy_Pillow 27.0/100: 27% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, ghoulish_infusion, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.096 generic R death_coil Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, ghoulish_infusion, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.965 generic S scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.900 generic S scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.836 generic T festering_strike Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:29.773 generic R death_coil Fluffy_Pillow 53.0/100: 53% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:30.712 generic S scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(2), static_empowerment(5), elemental_potion_of_ultimate_power
0:31.649 generic R death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:32.587 generic S scourge_strike Fluffy_Pillow 16.0/100: 16% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, icy_talons(3), dark_transformation, festermight(3), static_empowerment(5), elemental_potion_of_ultimate_power
0:33.524 generic S scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
1.0/6: 17% rune		 bloodlust, unholy_strength, icy_talons(3), festermight(4), elemental_lariat__empowered_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:34.462 generic R death_coil Fluffy_Pillow 42.0/100: 42% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(5), elemental_lariat__empowered_earth, static_empowerment(5), elemental_potion_of_ultimate_power
0:35.400 generic R death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(5), elemental_lariat__empowered_earth, static_empowerment(5)
0:36.339 generic S scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(5), elemental_lariat__empowered_earth, static_empowerment(5)
0:37.276 Waiting     0.487 sec 25.0/100: 25% runic_power
1.0/6: 17% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_lariat__empowered_earth, static_empowerment(5)
0:37.763 generic T festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_lariat__empowered_earth, static_empowerment(5)
0:38.699 generic R death_coil Fluffy_Pillow 50.0/100: 50% runic_power
0.0/6: 0% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), festermight(6), elemental_lariat__empowered_earth, static_empowerment(5)
0:39.638 generic S scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 bloodlust, rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(6), elemental_lariat__empowered_earth, static_empowerment(5)
0:40.575 generic R death_coil Fluffy_Pillow 38.0/100: 38% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(7), elemental_lariat__empowered_earth, static_empowerment(5)
0:41.792 generic T festering_strike Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight(7), elemental_lariat__empowered_earth, static_empowerment(5)
0:43.009 Waiting     1.020 sec 28.0/100: 28% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(7), elemental_lariat__empowered_earth, static_empowerment(5)
0:44.029 generic T festering_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
0:45.157 generic R death_coil Fluffy_Pillow 53.0/100: 53% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(7), ghoulish_infusion, static_empowerment(5)
0:46.283 generic R death_coil Fluffy_Pillow 53.0/100: 53% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(7), ghoulish_infusion, static_empowerment(5)
0:47.410 default D outbreak Fluffy_Pillow 23.0/100: 23% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), ghoulish_infusion, static_empowerment(5)
0:48.536 cooldowns N dark_transformation Fluffy_Pillow 33.0/100: 33% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), ghoulish_infusion, static_empowerment(5)
0:49.662 cooldowns P apocalypse Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, ghoulish_infusion, commander_of_the_dead_window, static_empowerment(5)
0:50.790 generic S scourge_strike Fluffy_Pillow 50.0/100: 50% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), ghoulish_infusion, commander_of_the_dead_window, static_empowerment(5)
0:51.918 generic S scourge_strike Fluffy_Pillow 63.0/100: 63% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), ghoulish_infusion, commander_of_the_dead_window, static_empowerment(5)
0:53.045 generic R death_coil Fluffy_Pillow 76.0/100: 76% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
0:54.263 generic R death_coil Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons, dark_transformation, runic_corruption, unholy_pact, festermight(6), static_empowerment(5)
0:55.480 generic T festering_strike Fluffy_Pillow 21.0/100: 21% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
0:56.695 generic S scourge_strike Fluffy_Pillow 41.0/100: 41% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(6), static_empowerment(5)
0:57.911 generic R death_coil Fluffy_Pillow 59.0/100: 59% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
0:59.129 generic S scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), static_empowerment(5)
1:00.347 generic R death_coil Fluffy_Pillow 42.0/100: 42% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
1:01.565 generic S scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(8), static_empowerment(5)
1:02.783 generic T festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(9), static_empowerment(5)
1:04.001 generic R death_coil Fluffy_Pillow 45.0/100: 45% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
1:05.217 generic S scourge_strike Fluffy_Pillow 15.0/100: 15% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(9), static_empowerment(5)
1:06.435 Waiting     0.271 sec 28.0/100: 28% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(10), static_empowerment(5)
1:06.706 generic R death_coil Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(10), static_empowerment(5)
1:07.924 generic S scourge_strike Fluffy_Pillow 3.0/100: 3% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(10), static_empowerment(5)
1:09.142 generic R death_coil Fluffy_Pillow 16.0/100: 16% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, sudden_doom, festermight(11), static_empowerment(5)
1:10.361 generic T festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, static_empowerment(5)
1:11.578 generic R death_coil Fluffy_Pillow 36.0/100: 36% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), ghoulish_infusion, static_empowerment(5)
1:12.706 generic S scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:13.833 generic S scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:14.961 default D outbreak Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:16.088 generic R death_coil Fluffy_Pillow 47.0/100: 47% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(2), ghoulish_infusion, elemental_lariat__empowered_air, elemental_lariat__empowered_earth, static_empowerment(5)
1:17.185 Waiting     0.711 sec 17.0/100: 17% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), ghoulish_infusion, elemental_lariat__empowered_air, elemental_lariat__empowered_earth, static_empowerment(5)
1:17.896 generic T festering_strike Fluffy_Pillow 17.0/100: 17% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), ghoulish_infusion, elemental_lariat__empowered_air, elemental_lariat__empowered_earth, static_empowerment(5)
1:18.994 generic R death_coil Fluffy_Pillow 42.0/100: 42% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), ghoulish_infusion, elemental_lariat__empowered_air, elemental_lariat__empowered_earth, static_empowerment(5)
1:20.092 generic S scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), ghoulish_infusion, elemental_lariat__empowered_air, elemental_lariat__empowered_earth, static_empowerment(5)
1:21.189 generic R death_coil Fluffy_Pillow 25.0/100: 25% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3), ghoulish_infusion, elemental_lariat__empowered_air, elemental_lariat__empowered_earth, static_empowerment(5)
1:22.286 Waiting     0.413 sec 25.0/100: 25% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), ghoulish_infusion, elemental_lariat__empowered_air, elemental_lariat__empowered_earth, static_empowerment(5)
1:22.699 generic S scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(3), ghoulish_infusion, elemental_lariat__empowered_air, elemental_lariat__empowered_earth, static_empowerment(5)
1:23.797 generic R death_coil Fluffy_Pillow 43.0/100: 43% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(4), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
1:24.894 generic S scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(4), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
1:25.991 generic R death_coil Fluffy_Pillow 31.0/100: 31% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(5), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
1:27.088 Waiting     0.766 sec 1.0/100: 1% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(5), ghoulish_infusion, static_empowerment(5)
1:27.854 generic T festering_strike Fluffy_Pillow 6.0/100: 6% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(5), ghoulish_infusion, static_empowerment(5)
1:28.983 Waiting     0.562 sec 26.0/100: 26% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(5), ghoulish_infusion, static_empowerment(5)
1:29.545 generic R death_coil Fluffy_Pillow 31.0/100: 31% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(5), ghoulish_infusion, static_empowerment(5)
1:30.672 Waiting     0.110 sec 1.0/100: 1% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(5), ghoulish_infusion, static_empowerment(5)
1:30.782 generic T festering_strike Fluffy_Pillow 1.0/100: 1% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(5), ghoulish_infusion, static_empowerment(5)
1:31.910 cooldowns M unholy_assault Fluffy_Pillow 26.0/100: 26% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(5), ghoulish_infusion, static_empowerment(5)
1:33.038 Waiting     0.670 sec 26.0/100: 26% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), unholy_assault, ghoulish_infusion, static_empowerment(5)
1:33.708 cooldowns N dark_transformation Fluffy_Pillow 26.0/100: 26% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), unholy_assault, static_empowerment(5)
1:34.725 cooldowns P apocalypse Fluffy_Pillow 26.0/100: 26% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
1:35.740 generic S scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune		 unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, static_empowerment(5)
1:36.756 generic S scourge_strike Fluffy_Pillow 56.0/100: 56% runic_power
3.0/6: 50% rune		 unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(5), commander_of_the_dead_window, static_empowerment(5)
1:37.771 generic T festering_strike Fluffy_Pillow 69.0/100: 69% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
1:38.787 generic R death_coil Fluffy_Pillow 94.0/100: 94% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(6), static_empowerment(5)
1:39.802 generic R death_coil Fluffy_Pillow 64.0/100: 64% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_lariat__empowered_earth, static_empowerment(5)
1:40.817 generic R death_coil Fluffy_Pillow 34.0/100: 34% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(2), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), elemental_lariat__empowered_earth, static_empowerment(5)
1:41.832 default D outbreak Fluffy_Pillow 4.0/100: 4% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:42.772 generic S scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:43.712 generic R death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:44.651 generic S scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:45.592 generic S scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:46.532 generic S scourge_strike Fluffy_Pillow 33.0/100: 33% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(9), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:47.471 generic R death_coil Fluffy_Pillow 46.0/100: 46% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(10), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:48.412 generic R death_coil Fluffy_Pillow 46.0/100: 46% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(10), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:49.353 generic T festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_assault, festermight(10), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:50.293 generic R death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_assault, festermight(10), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:51.234 generic S scourge_strike Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, festermight(10), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:52.176 generic S scourge_strike Fluffy_Pillow 29.0/100: 29% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(11), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:53.304 generic R death_coil Fluffy_Pillow 42.0/100: 42% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(12), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:54.431 generic S scourge_strike Fluffy_Pillow 17.0/100: 17% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight(12), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:55.559 generic R death_coil Fluffy_Pillow 30.0/100: 30% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:56.686 generic S scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
1:57.813 Waiting     0.224 sec 13.0/100: 13% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, elemental_lariat__empowered_earth, static_empowerment(5)
1:58.037 generic T festering_strike Fluffy_Pillow 13.0/100: 13% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, elemental_lariat__empowered_earth, static_empowerment(5)
1:59.255 generic R death_coil Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, elemental_lariat__empowered_earth, static_empowerment(5)
2:00.472 Waiting     2.461 sec 3.0/100: 3% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight, elemental_lariat__empowered_earth, static_empowerment(5)
2:02.933 generic S scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight, elemental_lariat__empowered_earth, static_empowerment(5)
2:04.151 Waiting     1.013 sec 21.0/100: 21% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(2), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
2:05.164 generic S scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(2), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
2:06.291 generic R death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune		 festermight(3), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
2:07.418 generic S scourge_strike Fluffy_Pillow 9.0/100: 9% runic_power
1.0/6: 17% rune		 icy_talons, runic_corruption, festermight(3), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
2:08.545 default D outbreak Fluffy_Pillow 22.0/100: 22% runic_power
1.0/6: 17% rune		 icy_talons, festermight(4), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
2:09.671 generic R death_coil Fluffy_Pillow 37.0/100: 37% runic_power
0.0/6: 0% rune		 icy_talons, festermight(4), ghoulish_infusion, static_empowerment(5)
2:10.798 generic S scourge_strike Fluffy_Pillow 7.0/100: 7% runic_power
1.0/6: 17% rune		 icy_talons(2), festermight(4), ghoulish_infusion, static_empowerment(5)
2:11.926 generic R death_coil Fluffy_Pillow 25.0/100: 25% runic_power
1.0/6: 17% rune		 icy_talons(2), sudden_doom, festermight(5), ghoulish_infusion, static_empowerment(5)
2:13.054 Waiting     0.798 sec 25.0/100: 25% runic_power
1.0/6: 17% rune		 icy_talons(3), runic_corruption, festermight(5), ghoulish_infusion, static_empowerment(5)
2:13.852 generic T festering_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(5), ghoulish_infusion, static_empowerment(5)
2:14.979 generic R death_coil Fluffy_Pillow 45.0/100: 45% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(5), ghoulish_infusion, static_empowerment(5)
2:16.106 generic T festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(5), ghoulish_infusion, static_empowerment(5)
2:17.231 generic R death_coil Fluffy_Pillow 40.0/100: 40% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), ghoulish_infusion, static_empowerment(5)
2:18.360 Waiting     0.311 sec 15.0/100: 15% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), ghoulish_infusion, static_empowerment(5)
2:18.671 cooldowns N dark_transformation Fluffy_Pillow 15.0/100: 15% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), ghoulish_infusion, static_empowerment(5)
2:19.836 cooldowns P apocalypse Fluffy_Pillow 15.0/100: 15% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, ghoulish_infusion, commander_of_the_dead_window, static_empowerment(5)
2:20.965 generic S scourge_strike Fluffy_Pillow 32.0/100: 32% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), ghoulish_infusion, commander_of_the_dead_window, static_empowerment(5)
2:22.093 generic S scourge_strike Fluffy_Pillow 45.0/100: 45% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), ghoulish_infusion, commander_of_the_dead_window, static_empowerment(5)
2:23.220 generic T festering_strike Fluffy_Pillow 58.0/100: 58% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
2:24.318 generic R death_coil Fluffy_Pillow 78.0/100: 78% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, dark_transformation, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
2:25.416 trinkets W use_item_manic_grieftorch Fluffy_Pillow 48.0/100: 48% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
2:27.186 generic R death_coil Fluffy_Pillow 48.0/100: 48% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons, dark_transformation, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
2:28.284 generic R death_coil Fluffy_Pillow 23.0/100: 23% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(2), dark_transformation, sudden_doom, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
2:29.381 generic S scourge_strike Fluffy_Pillow 23.0/100: 23% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
2:30.479 generic S scourge_strike Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), dark_transformation, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
2:31.576 generic R death_coil Fluffy_Pillow 49.0/100: 49% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, unholy_pact, festermight(8), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
2:32.674 generic S scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(8), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
2:33.773 generic S scourge_strike Fluffy_Pillow 32.0/100: 32% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, festermight(9), elemental_lariat__empowered_air, static_empowerment(5)
2:34.959 default D outbreak Fluffy_Pillow 50.0/100: 50% runic_power
3.0/6: 50% rune		 icy_talons(3), dark_transformation, festermight(10), static_empowerment(5)
2:36.177 generic R death_coil Fluffy_Pillow 60.0/100: 60% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, festermight(10), ghoulish_infusion, static_empowerment(5)
2:37.305 generic R death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(10), ghoulish_infusion, static_empowerment(5)
2:38.432 generic T festering_strike Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(10), ghoulish_infusion, static_empowerment(5)
2:39.559 generic S scourge_strike Fluffy_Pillow 20.0/100: 20% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(10), ghoulish_infusion, static_empowerment(5)
2:40.687 generic R death_coil Fluffy_Pillow 33.0/100: 33% runic_power
0.0/6: 0% rune		 rune_mastery, unholy_strength, icy_talons(3), ghoulish_infusion, static_empowerment(5)
2:41.815 generic S scourge_strike Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, ghoulish_infusion, static_empowerment(5)
2:42.942 Waiting     0.655 sec 21.0/100: 21% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, ghoulish_infusion, static_empowerment(5)
2:43.597 generic S scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, ghoulish_infusion, static_empowerment(5)
2:44.725 generic R death_coil Fluffy_Pillow 39.0/100: 39% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(2), ghoulish_infusion, static_empowerment(5)
2:45.853 generic R death_coil Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), ghoulish_infusion, static_empowerment(5)
2:46.981 generic T festering_strike Fluffy_Pillow 14.0/100: 14% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), ghoulish_infusion, static_empowerment(5)
2:48.108 generic R death_coil Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), ghoulish_infusion, static_empowerment(5)
2:49.236 generic S scourge_strike Fluffy_Pillow 9.0/100: 9% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(2), ghoulish_infusion, static_empowerment(5)
2:50.363 generic S scourge_strike Fluffy_Pillow 22.0/100: 22% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), festermight(3), ghoulish_infusion, static_empowerment(5)
2:51.490 generic R death_coil Fluffy_Pillow 40.0/100: 40% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
2:52.708 generic S scourge_strike Fluffy_Pillow 10.0/100: 10% runic_power
2.0/6: 33% rune		 icy_talons(3), runic_corruption, festermight(4), static_empowerment(5)
2:53.926 generic S scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
1.0/6: 17% rune		 icy_talons(3), festermight(5), static_empowerment(5)
2:55.144 generic R death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(6), static_empowerment(5)
2:56.361 generic T festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight(6), static_empowerment(5)
2:57.580 generic R death_coil Fluffy_Pillow 36.0/100: 36% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(6), static_empowerment(5)
2:58.796 Waiting     0.948 sec 11.0/100: 11% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(6), static_empowerment(5)
2:59.744 default C army_of_the_dead Fluffy_Pillow 11.0/100: 11% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(6), static_empowerment(5)
3:00.962 Waiting     0.725 sec 26.0/100: 26% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(6), static_empowerment(5)
3:01.687 cooldowns M unholy_assault Fluffy_Pillow 26.0/100: 26% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(3), festermight(6), static_empowerment(5)
3:03.127 default D outbreak Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune		 icy_talons(3), unholy_assault, static_empowerment(5)
3:04.144 cooldowns N dark_transformation Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune		 unholy_assault, static_empowerment(5)
3:05.161 cooldowns L summon_gargoyle Fluffy_Pillow 41.0/100: 41% runic_power
2.0/6: 33% rune		 dark_transformation, unholy_assault, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:05.161 trinkets V use_item_algethar_puzzle_box Fluffy_Pillow 91.0/100: 91% runic_power
2.0/6: 33% rune		 dark_transformation, unholy_assault, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:06.509 cooldowns P apocalypse Fluffy_Pillow 91.0/100: 91% runic_power
2.0/6: 33% rune		 dark_transformation, unholy_assault, unholy_pact, commander_of_the_dead_window, algethar_puzzle, static_empowerment(5)
3:07.524 racials U berserking Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, algethar_puzzle, static_empowerment(5)
3:07.547 generic R death_coil Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, dark_transformation, unholy_assault, unholy_pact, festermight(4), commander_of_the_dead_window, algethar_puzzle, static_empowerment(5)
3:08.470 cooldowns K empower_rune_weapon Fluffy_Pillow 70.0/100: 70% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:08.470 generic R death_coil Fluffy_Pillow 75.0/100: 75% runic_power
5.0/6: 83% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons, dark_transformation, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:09.273 generic R death_coil Fluffy_Pillow 50.0/100: 50% runic_power
5.0/6: 83% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(2), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:10.077 cooldowns Q soul_reaper Fluffy_Pillow 50.0/100: 50% runic_power
6.0/6: 100% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(4), algethar_puzzle, static_empowerment(5)
3:10.880 generic R death_coil Fluffy_Pillow 60.0/100: 60% runic_power
5.0/6: 83% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, algethar_puzzle, static_empowerment(5)
3:11.634 generic R death_coil Fluffy_Pillow 30.0/100: 30% runic_power
5.0/6: 83% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, algethar_puzzle, static_empowerment(5)
3:12.390 generic S scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
5.0/6: 83% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, algethar_puzzle, static_empowerment(5)
3:13.146 generic S scourge_strike Fluffy_Pillow 13.0/100: 13% runic_power
4.0/6: 67% rune		 berserking, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(5), ghoulish_infusion, algethar_puzzle, static_empowerment(5)
3:13.900 generic R death_coil Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(6), ghoulish_infusion, algethar_puzzle, static_empowerment(5)
3:14.655 generic S scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
4.0/6: 67% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), ghoulish_infusion, algethar_puzzle, static_empowerment(5)
3:15.410 generic T festering_strike Fluffy_Pillow 19.0/100: 19% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, algethar_puzzle, static_empowerment(5)
3:16.164 cooldowns Q soul_reaper Fluffy_Pillow 39.0/100: 39% runic_power
2.0/6: 33% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, algethar_puzzle, static_empowerment(5)
3:16.916 generic R death_coil Fluffy_Pillow 54.0/100: 54% runic_power
2.0/6: 33% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:17.670 generic S scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:18.425 generic R death_coil Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:19.177 generic S scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
3.0/6: 50% rune		 berserking, rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(8), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:19.929 generic R death_coil Fluffy_Pillow 30.0/100: 30% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:20.746 generic S scourge_strike Fluffy_Pillow 0.0/100: 0% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(9), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:21.562 generic S scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, unholy_assault, festermight(10), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:22.380 cooldowns Q soul_reaper Fluffy_Pillow 31.0/100: 31% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(11), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:23.360 generic R death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(11), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:24.342 generic T festering_strike Fluffy_Pillow 16.0/100: 16% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, runic_corruption, festermight(11), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:25.323 generic R death_coil Fluffy_Pillow 36.0/100: 36% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(11), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:26.305 generic S scourge_strike Fluffy_Pillow 6.0/100: 6% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight(11), ghoulish_infusion, elemental_lariat__empowered_earth, algethar_puzzle, static_empowerment(5)
3:27.286 generic S scourge_strike Fluffy_Pillow 24.0/100: 24% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
3:28.269 cooldowns Q soul_reaper Fluffy_Pillow 37.0/100: 37% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, empower_rune_weapon, icy_talons(3), dark_transformation, festermight, ghoulish_infusion, static_empowerment(5)
3:29.361 default D outbreak Fluffy_Pillow 52.0/100: 52% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), dark_transformation, festermight, ghoulish_infusion, static_empowerment(5)
3:30.489 generic R death_coil Fluffy_Pillow 62.0/100: 62% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight, ghoulish_infusion, static_empowerment(5)
3:31.614 generic R death_coil Fluffy_Pillow 32.0/100: 32% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, ghoulish_infusion, static_empowerment(5)
3:32.742 generic S scourge_strike Fluffy_Pillow 2.0/100: 2% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, static_empowerment(5)
3:33.959 generic T festering_strike Fluffy_Pillow 20.0/100: 20% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), static_empowerment(5)
3:35.177 cooldowns Q soul_reaper Fluffy_Pillow 40.0/100: 40% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(2), static_empowerment(5)
3:36.395 generic R death_coil Fluffy_Pillow 55.0/100: 55% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(2), ghoulish_infusion, static_empowerment(5)
3:37.523 generic R death_coil Fluffy_Pillow 55.0/100: 55% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(2), ghoulish_infusion, static_empowerment(5)
3:38.650 generic S scourge_strike Fluffy_Pillow 25.0/100: 25% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(2), ghoulish_infusion, static_empowerment(5)
3:39.780 generic R death_coil Fluffy_Pillow 38.0/100: 38% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), festermight(3), ghoulish_infusion, static_empowerment(5)
3:40.906 generic R death_coil Fluffy_Pillow 8.0/100: 8% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(3), ghoulish_infusion, static_empowerment(5)
3:42.035 cooldowns Q soul_reaper Fluffy_Pillow 8.0/100: 8% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(3), ghoulish_infusion, static_empowerment(5)
3:43.163 generic S scourge_strike Fluffy_Pillow 18.0/100: 18% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(3), ghoulish_infusion, static_empowerment(5)
3:44.289 generic T festering_strike Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(4), ghoulish_infusion, static_empowerment(5)
3:45.416 generic R death_coil Fluffy_Pillow 56.0/100: 56% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), sudden_doom, festermight(4), ghoulish_infusion, static_empowerment(5)
3:46.544 generic R death_coil Fluffy_Pillow 56.0/100: 56% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, festermight(4), ghoulish_infusion, static_empowerment(5)
3:47.671 generic T festering_strike Fluffy_Pillow 31.0/100: 31% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
3:48.889 cooldowns Q soul_reaper Fluffy_Pillow 51.0/100: 51% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
3:50.106 generic R death_coil Fluffy_Pillow 66.0/100: 66% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), static_empowerment(5)
3:51.323 cooldowns N dark_transformation Fluffy_Pillow 36.0/100: 36% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), runic_corruption, static_empowerment(5)
3:52.542 cooldowns P apocalypse Fluffy_Pillow 36.0/100: 36% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, commander_of_the_dead_window, static_empowerment(5)
3:53.758 generic S scourge_strike Fluffy_Pillow 48.0/100: 48% runic_power
6.0/6: 100% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(4), ghoulish_infusion, commander_of_the_dead_window, static_empowerment(5)
3:54.887 cooldowns Q soul_reaper Fluffy_Pillow 61.0/100: 61% runic_power
5.0/6: 83% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), ghoulish_infusion, commander_of_the_dead_window, static_empowerment(5)
3:56.016 default D outbreak Fluffy_Pillow 71.0/100: 71% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_pact, festermight(5), ghoulish_infusion, static_empowerment(5)
3:57.142 generic S scourge_strike Fluffy_Pillow 86.0/100: 86% runic_power
3.0/6: 50% rune		 unholy_strength, dark_transformation, unholy_pact, festermight(5), ghoulish_infusion, static_empowerment(5)
3:58.271 generic R death_coil Fluffy_Pillow 99.0/100: 99% runic_power
2.0/6: 33% rune		 unholy_strength, dark_transformation, unholy_pact, festermight(6), ghoulish_infusion, static_empowerment(5)
3:59.398 generic R death_coil Fluffy_Pillow 69.0/100: 69% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons, dark_transformation, runic_corruption, unholy_pact, festermight(6), ghoulish_infusion, static_empowerment(5)
4:00.526 generic S scourge_strike Fluffy_Pillow 44.0/100: 44% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_pact, festermight(6), ghoulish_infusion, static_empowerment(5)
4:01.654 cooldowns Q soul_reaper Fluffy_Pillow 57.0/100: 57% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(2), dark_transformation, runic_corruption, unholy_pact, festermight(7), ghoulish_infusion, static_empowerment(5)
4:02.782 generic T festering_strike Fluffy_Pillow 67.0/100: 67% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(7), ghoulish_infusion, static_empowerment(5)
4:03.910 generic R death_coil Fluffy_Pillow 87.0/100: 87% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(2), dark_transformation, unholy_pact, festermight(7), static_empowerment(5)
4:05.127 generic S scourge_strike Fluffy_Pillow 57.0/100: 57% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, unholy_pact, festermight(7), static_empowerment(5)
4:06.343 generic S scourge_strike Fluffy_Pillow 70.0/100: 70% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(8), static_empowerment(5)
4:07.560 cooldowns Q soul_reaper Fluffy_Pillow 88.0/100: 88% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(9), ghoulish_infusion, static_empowerment(5)
4:08.781 generic R death_coil Fluffy_Pillow 98.0/100: 98% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(9), ghoulish_infusion, static_empowerment(5)
4:09.908 generic R death_coil Fluffy_Pillow 73.0/100: 73% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(9), ghoulish_infusion, static_empowerment(5)
4:11.035 generic T festering_strike Fluffy_Pillow 43.0/100: 43% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(9), ghoulish_infusion, static_empowerment(5)
4:12.160 generic R death_coil Fluffy_Pillow 68.0/100: 68% runic_power
2.0/6: 33% rune		 rune_mastery, icy_talons(3), runic_corruption, festermight(9), ghoulish_infusion, static_empowerment(5)
4:13.288 generic S scourge_strike Fluffy_Pillow 38.0/100: 38% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), runic_corruption, ghoulish_infusion, static_empowerment(5)
4:14.414 cooldowns Q soul_reaper Fluffy_Pillow 51.0/100: 51% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), runic_corruption, sudden_doom, festermight, ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:15.512 generic R death_coil Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons(3), runic_corruption, sudden_doom, festermight, ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:16.609 generic S scourge_strike Fluffy_Pillow 61.0/100: 61% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight, ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:17.706 generic S scourge_strike Fluffy_Pillow 74.0/100: 74% runic_power
4.0/6: 67% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(2), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:18.805 generic R death_coil Fluffy_Pillow 92.0/100: 92% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:19.903 generic T festering_strike Fluffy_Pillow 92.0/100: 92% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(3), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:21.000 cooldowns Q soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:22.096 generic R death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:23.193 default D outbreak Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, sudden_doom, festermight(3), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:24.293 generic R death_coil Fluffy_Pillow 100.0/100: 100% runic_power
2.0/6: 33% rune		 rune_mastery, unholy_strength, icy_talons(3), sudden_doom, festermight(3), ghoulish_infusion, elemental_lariat__empowered_air, static_empowerment(5)
4:25.391 generic S scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), runic_corruption, festermight(3), ghoulish_infusion, static_empowerment(5)
4:26.520 trinkets W use_item_manic_grieftorch Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons(3), festermight(4), ghoulish_infusion, static_empowerment(5)
4:28.311 cooldowns Q soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
4:29.526 generic S scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 unholy_strength, icy_talons(3), festermight(4), static_empowerment(5)
4:30.744 generic R death_coil Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, sudden_doom, festermight(5), static_empowerment(5)
4:31.962 cooldowns M unholy_assault Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons, festermight(5), ghoulish_infusion, static_empowerment(5)
4:33.089 generic S scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, unholy_strength, icy_talons, unholy_assault, festermight(5), ghoulish_infusion, static_empowerment(5)
4:34.030 generic T festering_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 rune_mastery, icy_talons, unholy_assault, ghoulish_infusion, static_empowerment(5)
4:34.971 cooldowns Q soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons, unholy_assault, ghoulish_infusion, static_empowerment(5)
4:35.912 generic R death_coil Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons, unholy_assault, ghoulish_infusion, static_empowerment(5)
4:36.853 cooldowns N dark_transformation Fluffy_Pillow 75.0/100: 75% runic_power
1.0/6: 17% rune		 rune_mastery, icy_talons(2), unholy_assault, ghoulish_infusion, static_empowerment(5)
4:37.794 cooldowns P apocalypse Fluffy_Pillow 75.0/100: 75% runic_power
2.0/6: 33% rune		 icy_talons(2), dark_transformation, unholy_assault, unholy_pact, ghoulish_infusion, commander_of_the_dead_window, static_empowerment(5)
4:38.734 generic S scourge_strike Fluffy_Pillow 87.0/100: 87% runic_power
4.0/6: 67% rune		 icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(4), ghoulish_infusion, commander_of_the_dead_window, elemental_lariat__empowered_earth, static_empowerment(5)
4:39.675 generic S scourge_strike Fluffy_Pillow 100.0/100: 100% runic_power
4.0/6: 67% rune		 icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(5), commander_of_the_dead_window, elemental_lariat__empowered_earth, static_empowerment(5)
4:40.689 generic T festering_strike Fluffy_Pillow 100.0/100: 100% runic_power
3.0/6: 50% rune		 icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(6), commander_of_the_dead_window, elemental_lariat__empowered_earth, static_empowerment(5)
4:41.705 cooldowns Q soul_reaper Fluffy_Pillow 100.0/100: 100% runic_power
1.0/6: 17% rune		 icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(6), elemental_lariat__empowered_earth, static_empowerment(5)
4:42.722 generic R death_coil Fluffy_Pillow 100.0/100: 100% runic_power
0.0/6: 0% rune		 dark_transformation, unholy_assault, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
4:43.663 generic R death_coil Fluffy_Pillow 70.0/100: 70% runic_power
1.0/6: 17% rune		 icy_talons, dark_transformation, runic_corruption, unholy_assault, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
4:44.604 generic S scourge_strike Fluffy_Pillow 40.0/100: 40% runic_power
3.0/6: 50% rune		 icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(6), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
4:45.547 generic R death_coil Fluffy_Pillow 58.0/100: 58% runic_power
2.0/6: 33% rune		 icy_talons(2), dark_transformation, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
4:46.488 generic S scourge_strike Fluffy_Pillow 28.0/100: 28% runic_power
2.0/6: 33% rune		 icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(7), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
4:47.429 generic R death_coil Fluffy_Pillow 41.0/100: 41% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
4:48.368 cooldowns Q soul_reaper Fluffy_Pillow 11.0/100: 11% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
4:49.309 generic S scourge_strike Fluffy_Pillow 21.0/100: 21% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(8), ghoulish_infusion, elemental_lariat__empowered_earth, static_empowerment(5)
4:50.250 default D outbreak Fluffy_Pillow 34.0/100: 34% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, unholy_assault, unholy_pact, festermight(9), ghoulish_infusion, static_empowerment(5)
4:51.189 generic R death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, sudden_doom, unholy_assault, unholy_pact, festermight(9), ghoulish_infusion, static_empowerment(5)
4:52.130 generic R death_coil Fluffy_Pillow 44.0/100: 44% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(9), ghoulish_infusion, static_empowerment(5)
4:53.255 generic S scourge_strike Fluffy_Pillow 19.0/100: 19% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(9), ghoulish_infusion, static_empowerment(5)
4:54.382 cooldowns Q soul_reaper Fluffy_Pillow 32.0/100: 32% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(10), ghoulish_infusion, static_empowerment(5)
4:55.509 generic R death_coil Fluffy_Pillow 47.0/100: 47% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, festermight(10), static_empowerment(5)
4:56.726 generic T festering_strike Fluffy_Pillow 17.0/100: 17% runic_power
2.0/6: 33% rune		 unholy_strength, icy_talons(3), dark_transformation, runic_corruption, festermight(10), static_empowerment(5)
4:57.943 generic R death_coil Fluffy_Pillow 42.0/100: 42% runic_power
0.0/6: 0% rune		 unholy_strength, icy_talons(3), dark_transformation, static_empowerment(5)
4:59.160 generic S scourge_strike Fluffy_Pillow 12.0/100: 12% runic_power
1.0/6: 17% rune		 unholy_strength, icy_talons(3), dark_transformation, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 2089 1 8375 8069 5445 (4531)
Agility 1734 2 1822 1736 0
Stamina 3463 0 21218 20208 13377
Intellect 1128 -3 1271 1125 0
Spirit 0 0 0 0 0
Health 424360 404160 0
Runic Power 100 100 0
Rune 6 6 0
Spell Power 1271 1125 0
Crit 22.07% 22.07% 2713
Haste 23.58% 23.58% 4008
Versatility 5.40% 2.40% 492
Attack Power 8794 8069 0
Mastery 55.74% 55.74% 4134
Armor 7154 7154 7154
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 422.00
Local Head Maw of the Haunted Frostbrood
ilevel: 424, stats: { 948 Armor, +1383 Sta, +236 Haste, +550 Mastery, +512 StrInt }, gems: { +75 StrAgiInt, +66 Haste }
Local Neck Elemental Lariat
ilevel: 418, stats: { +722 Sta, +592 Crit, +592 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Haste, +33 Mastery, +70 Haste, +33 Mastery }
item effects: { equip: Elemental Lariat }
Local Shoulders Jaws of the Haunted Frostbrood
ilevel: 424, stats: { 869 Armor, +1037 Sta, +392 Crit, +198 Haste, +384 StrInt }
Local Chest Breastplate of the Haunted Frostbrood
ilevel: 421, stats: { 1240 Armor, +1333 Sta, +254 Crit, +520 Mastery, +498 StrInt }, enchant: { +150 StrAgiInt }
Local Waist Primal Molten Greatbelt
ilevel: 418, stats: { 684 Armor, +962 Sta, +286 Mastery, +286 Haste, +363 StrInt }, gems: { +70 Haste, +33 Mastery }
item effects: { equip: Blue Silken Lining }
Local Legs Drake Hunter's Greaves
ilevel: 421, stats: { 1085 Armor, +1333 Sta, +503 Haste, +271 Mastery, +498 StrInt }, enchant: { +105 Sta, +177 StrAgi }
Local Feet Stonestep Boots
ilevel: 421, stats: { 775 Armor, +1000 Sta, +228 Crit, +436 Mastery, +374 StrInt }
Local Wrists Vambraces of the Haunted Frostbrood
ilevel: 424, stats: { 632 Armor, +778 Sta, +144 Crit, +298 Haste, +288 StrInt }, gems: { +70 Haste, +33 Mastery }
Local Hands Grasps of the Haunted Frostbrood
ilevel: 421, stats: { 697 Armor, +1000 Sta, +407 Haste, +174 Vers, +374 StrInt }
Local Finger1 Seal of Filial Duty
ilevel: 430, stats: { +841 Sta, +320 Haste, +967 Mastery }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Vers }
item effects: { equip: Broodkeeper's Barrier }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 421, stats: { +750 Sta, +553 Crit, +657 Haste }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Mastery }
item effects: { equip: Signet of Melandrus }
Local Trinket1 Algeth'ar Puzzle Box
ilevel: 421, stats: { +473 StrAgi }
item effects: { use: Algeth'ar Puzzle }
Local Trinket2 Manic Grieftorch
ilevel: 424, stats: { +487 StrAgi }
item effects: { use: Manic Grieftorch, equip: Manic Grieftorch }
Local Back Fireproof Drape
ilevel: 421, stats: { 224 Armor, +750 Sta, +274 Haste, +162 Mastery, +280 StrAgiInt }
Local Main Hand Incarnate Sky-Splitter
ilevel: 424, weapon: { 902 - 1874, 3.6 }, stats: { +512 Str, +1383 Sta, +550 Crit, +236 Vers }, enchant: rune_of_the_fallen_crusader, temporary_enchant: Howling Rune

Talents

Talent Tables

RowDeath Knight Talents [31]
1
2
3
4
5
6
7
8
9
10
RowUnholy Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

deathknight="T29_Death_Knight_Unholy"
source=default
spec=unholy
level=70
race=troll
role=attack
position=back
talents=BwPAAAAAAAAAAAAAAAAAAAAAAAAIIJJBSAJJRIJSSSkAAAAAAAAAAKJJhIAAgEpkIRSSikA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/fleshcraft
actions.precombat+=/variable,name=trinket_1_sync,op=setif,value=1,value_else=0.5,condition=trinket.1.has_use_buff&(trinket.1.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_2_sync,op=setif,value=1,value_else=0.5,condition=trinket.2.has_use_buff&(trinket.2.cooldown.duration%%45=0)
actions.precombat+=/variable,name=trinket_priority,op=setif,value=2,value_else=1,condition=!trinket.1.has_use_buff&trinket.2.has_use_buff|trinket.2.has_use_buff&((trinket.2.cooldown.duration%trinket.2.proc.any_dps.duration)*(1.5+trinket.2.has_buff.strength)*(variable.trinket_2_sync))>((trinket.1.cooldown.duration%trinket.1.proc.any_dps.duration)*(1.5+trinket.1.has_buff.strength)*(variable.trinket_1_sync))
actions.precombat+=/variable,name=trinket_1_buffs,value=trinket.1.has_buff.strength|trinket.1.has_buff.mastery|trinket.1.has_buff.versatility|trinket.1.has_buff.haste|trinket.1.has_buff.crit
actions.precombat+=/variable,name=trinket_2_buffs,value=trinket.2.has_buff.strength|trinket.2.has_buff.mastery|trinket.2.has_buff.versatility|trinket.2.has_buff.haste|trinket.2.has_buff.crit

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze,if=target.debuff.casting.react
# Variables
actions+=/variable,name=apoc_timing,op=setif,value=8,value_else=4,condition=cooldown.apocalypse.remains<10&debuff.festering_wound.stack<4
actions+=/variable,name=garg_pooling,op=setif,value=(((cooldown.summon_gargoyle.remains+1)%gcd)%((rune+1)*(runic_power+20)))*100,value_else=gcd,condition=cooldown.summon_gargoyle.remains<gcd*2
actions+=/variable,name=festermight_tracker,op=setif,value=debuff.festering_wound.stack>=1,value_else=debuff.festering_wound.stack>=(2-talent.infected_claws),condition=talent.festermight&buff.festermight.up&(buff.festermight.remains%(4*gcd))>=1
actions+=/variable,name=pop_wounds,value=(cooldown.apocalypse.remains>variable.apoc_timing|!talent.apocalypse)&(variable.festermight_tracker|debuff.festering_wound.stack>=1&!talent.apocalypse|debuff.festering_wound.stack>=1&cooldown.unholy_assault.remains<20&talent.unholy_assault&variable.st_planning|debuff.festering_wound.stack>4|fight_remains<debuff.festering_wound.stack*gcd)
actions+=/variable,name=pooling_runic_power,value=talent.vile_contagion&cooldown.vile_contagion.remains<3&runic_power<60&!variable.st_planning
actions+=/variable,name=pooling_runes,value=talent.soul_reaper&rune<2&target.time_to_pct_35<5&fight_remains>5
actions+=/variable,name=st_planning,value=active_enemies<=3&(!raid_event.adds.exists|raid_event.adds.in>15)
actions+=/variable,name=adds_remain,value=active_enemies>=4&(!raid_event.adds.exists|raid_event.adds.exists&raid_event.adds.remains>6)
# When using 'external_buffs.invoke', will use this lines logic to determine when to use Power Infusion. Current, cooldown is defined in the line, please do not change this if you do not know what you are doing.
actions+=/invoke_external_buff,name=power_infusion,line_cd=120,if=variable.st_planning&runic_power.deficit>20&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
# Prioritize Army, Outbreak and Maintaining Plaguebringer
actions+=/army_of_the_dead,if=talent.commander_of_the_dead&(cooldown.dark_transformation.remains<4|buff.commander_of_the_dead_window.up)|!talent.commander_of_the_dead&talent.unholy_assault&cooldown.unholy_assault.remains<10|!talent.unholy_assault&!talent.commander_of_the_dead|fight_remains<=30
actions+=/outbreak,target_if=(dot.virulent_plague.refreshable|talent.superstrain&(dot.frost_fever_superstrain.refreshable|dot.blood_plague_superstrain.refreshable))&(!talent.unholy_blight|talent.unholy_blight&cooldown.unholy_blight.remains>15%((talent.superstrain*3)+(talent.plaguebringer*2)))
actions+=/wound_spender,if=cooldown.apocalypse.remains>variable.apoc_timing&talent.plaguebringer&talent.superstrain&buff.plaguebringer.remains<gcd
# Call Action Lists
actions+=/call_action_list,name=trinkets
actions+=/call_action_list,name=racials
actions+=/call_action_list,name=cooldowns
actions+=/run_action_list,name=aoe,if=active_enemies>=4
actions+=/run_action_list,name=generic,if=active_enemies<=3

# AoE Action List
actions.aoe=any_dnd,if=!death_and_decay.ticking&variable.adds_remain&(talent.festermight&buff.festermight.remains<3|!talent.festermight)&(death_knight.fwounded_targets=active_enemies|death_knight.fwounded_targets=8|!talent.bursting_sores&!talent.vile_contagion|raid_event.adds.exists&raid_event.adds.remains<=11&raid_event.adds.remains>5|(cooldown.vile_contagion.remains|!talent.vile_contagion)&buff.dark_transformation.up&talent.infected_claws&(buff.empower_rune_weapon.up|buff.unholy_assault.up))|fight_remains<10
actions.aoe+=/abomination_limb,if=rune=0&variable.adds_remain
actions.aoe+=/apocalypse,target_if=min:debuff.festering_wound.stack,if=debuff.festering_wound.up&variable.adds_remain&!death_and_decay.ticking&cooldown.death_and_decay.remains&rune<3|death_and_decay.ticking&rune=0
actions.aoe+=/festering_strike,target_if=max:debuff.festering_wound.stack,if=!death_and_decay.ticking&debuff.festering_wound.stack<4&(cooldown.vile_contagion.remains<5|cooldown.apocalypse.ready&cooldown.any_dnd.remains)
actions.aoe+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!death_and_decay.ticking&(cooldown.vile_contagion.remains>5|!talent.vile_contagion)
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=death_and_decay.ticking
actions.aoe+=/death_coil,if=!variable.pooling_runic_power&!talent.epidemic
actions.aoe+=/epidemic,if=!variable.pooling_runic_power
actions.aoe+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=cooldown.death_and_decay.remains>10

# Potion
actions.cooldowns=potion,if=(30>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&30>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=30|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=30)|fight_remains<=30
# Cooldowns
actions.cooldowns+=/vile_contagion,target_if=max:debuff.festering_wound.stack,if=active_enemies>=2&debuff.festering_wound.stack>=4&cooldown.any_dnd.remains<3
actions.cooldowns+=/raise_dead,if=!pet.ghoul.active
actions.cooldowns+=/empower_rune_weapon,if=variable.st_planning&runic_power.deficit>20&(pet.gargoyle.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&talent.army_of_the_damned&pet.army_ghoul.active&pet.apoc_ghoul.active|!talent.summon_gargoyle&!talent.army_of_the_damned&buff.dark_transformation.up|!talent.summon_gargoyle&!talent.summon_gargoyle&buff.dark_transformation.up)|fight_remains<=21
actions.cooldowns+=/empower_rune_weapon,if=variable.adds_remain&buff.dark_transformation.up
actions.cooldowns+=/summon_gargoyle,if=buff.commander_of_the_dead_window.up|!talent.commander_of_the_dead&runic_power>=40
actions.cooldowns+=/unholy_assault,if=variable.st_planning
actions.cooldowns+=/dark_transformation,if=variable.st_planning&cooldown.apocalypse.remains<gcd
actions.cooldowns+=/dark_transformation,if=variable.adds_remain&(cooldown.any_dnd.remains<10&talent.infected_claws&((cooldown.vile_contagion.remains|raid_event.adds.exists&raid_event.adds.in>10)&death_knight.fwounded_targets<active_enemies|!talent.vile_contagion)&(raid_event.adds.remains>5|!raid_event.adds.exists)|!talent.infected_claws)|fight_remains<25
actions.cooldowns+=/apocalypse,target_if=max:debuff.festering_wound.stack,if=active_enemies<=3&(!talent.commander_of_the_dead|talent.commander_of_the_dead&buff.commander_of_the_dead_window.up)
actions.cooldowns+=/soul_reaper,if=active_enemies=1&target.time_to_pct_35<5&target.time_to_die>5
actions.cooldowns+=/soul_reaper,target_if=min:dot.soul_reaper.remains,if=target.time_to_pct_35<5&active_enemies>=2&target.time_to_die>(dot.soul_reaper.remains+5)
actions.cooldowns+=/unholy_blight,if=variable.st_planning&((!talent.apocalypse|cooldown.apocalypse.remains)&talent.morbidity|!talent.morbidity)
actions.cooldowns+=/unholy_blight,if=variable.adds_remain|fight_remains<21
actions.cooldowns+=/abomination_limb,if=variable.st_planning&rune<3
actions.cooldowns+=/sacrificial_pact,if=active_enemies>=2&!buff.dark_transformation.up&cooldown.dark_transformation.remains>6|fight_remains<gcd

# Generic
actions.generic=death_coil,if=!variable.pooling_runic_power&(rune<3|pet.gargoyle.active|buff.sudden_doom.react)
actions.generic+=/any_dnd,if=!death_and_decay.ticking&active_enemies>=2&death_knight.fwounded_targets=active_enemies
actions.generic+=/wound_spender,target_if=max:debuff.festering_wound.stack,if=variable.pop_wounds|active_enemies>=2&death_and_decay.ticking
actions.generic+=/festering_strike,target_if=min:debuff.festering_wound.stack,if=!variable.pop_wounds
actions.generic+=/death_coil

# Racials
actions.racials=arcane_torrent,if=runic_power.deficit>20&(cooldown.summon_gargoyle.remains<gcd|!talent.summon_gargoyle.enabled|pet.gargoyle.active&rune<2&debuff.festering_wound.stack<1)
actions.racials+=/blood_fury,if=(buff.blood_fury.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.blood_fury.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.blood_fury.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.blood_fury.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.blood_fury.duration
actions.racials+=/berserking,if=(buff.berserking.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.berserking.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.berserking.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.berserking.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.berserking.duration
actions.racials+=/lights_judgment,if=buff.unholy_strength.up&(!talent.festermight|buff.festermight.remains<target.time_to_die|buff.unholy_strength.remains<target.time_to_die)
actions.racials+=/ancestral_call,if=(15>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&15>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=15|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=15|active_enemies>=2&death_and_decay.ticking)|fight_remains<=15
actions.racials+=/arcane_pulse,if=active_enemies>=2|(rune.deficit>=5&runic_power.deficit>=60)
actions.racials+=/fireblood,if=(buff.fireblood.duration>=pet.gargoyle.remains&pet.gargoyle.active)|(!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>60)&(buff.dark_transformation.up&buff.fireblood.duration>=buff.dark_transformation.remains|pet.army_ghoul.active&pet.army_ghoul.remains<=buff.fireblood.duration|pet.apoc_ghoul.active&pet.apoc_ghoul.remains<=buff.fireblood.duration|active_enemies>=2&death_and_decay.ticking)|fight_remains<=buff.fireblood.duration
actions.racials+=/bag_of_tricks,if=active_enemies=1&(buff.unholy_strength.up|fight_remains<5)

# Trinkets
actions.trinkets=use_item,slot=trinket1,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=1)|trinket.1.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket2,if=((!talent.summon_gargoyle|talent.summon_gargoyle&pet.gargoyle.active|cooldown.summon_gargoyle.remains>90)&(pet.apoc_ghoul.active|buff.dark_transformation.up)&variable.trinket_priority=2)|trinket.2.proc.any_dps.duration>=fight_remains
actions.trinkets+=/use_item,slot=trinket1,if=!variable.trinket_1_buffs&(trinket.2.cooldown.remains|!variable.trinket_2_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15
actions.trinkets+=/use_item,slot=trinket2,if=!variable.trinket_2_buffs&(trinket.1.cooldown.remains|!variable.trinket_1_buffs|!talent.summon_gargoyle|cooldown.summon_gargoyle.remains>20&!pet.gargoyle.active)|fight_remains<15

head=maw_of_the_haunted_frostbrood,id=200408,bonus_id=4800/4786/1498/6935,gem_id=192985
neck=elemental_lariat,id=193001,bonus_id=6652/7936/7979/1540/8767/8782,gem_id=192961/192948/192948,crafted_stats=32/49
shoulders=jaws_of_the_haunted_frostbrood,id=200410,bonus_id=4800/4786/1498
back=fireproof_drape,id=193763,bonus_id=6808/4786/1643
chest=breastplate_of_the_haunted_frostbrood,id=200405,bonus_id=4800/4786/1498,enchant_id=6625
wrists=vambraces_of_the_haunted_frostbrood,id=200412,bonus_id=1507/6935,gem_id=192948
hands=grasps_of_the_haunted_frostbrood,id=200407,bonus_id=4800/4786/1498
waist=primal_molten_greatbelt,id=190501,bonus_id=8836/8840/8902/8802/8793/8932/8960,ilevel=418,gem_id=192948,crafted_stats=36/40
legs=drake_hunters_greaves,id=193694,bonus_id=6808/4786/1643,enchant_id=6490
feet=stonestep_boots,id=143974,bonus_id=4177/6808/4786/3311,ilevel=421,drop_level=70
finger1=seal_of_filial_duty,id=195526,bonus_id=4800/4786/1497/6935,gem_id=192948,enchant_id=6568
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/6808/4786/3300/6935,ilevel=421,gem_id=192948,enchant_id=6562,drop_level=70
trinket1=algethar_puzzle_box,id=193701,bonus_id=6808/4786/1643
trinket2=manic_grieftorch,id=194308,bonus_id=4800/4786/1498
main_hand=incarnate_skysplitter,id=195528,bonus_id=4800/4786/1498,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=422.20
# gear_strength=5445
# gear_stamina=13377
# gear_crit_rating=2713
# gear_haste_rating=4008
# gear_mastery_rating=4134
# gear_versatility_rating=492
# gear_armor=7154
# set_bonus=tier29_2pc=1
# set_bonus=tier29_4pc=1

T29_Priest_Shadow : 74512 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
74511.7 74511.7 54.8 / 0.074% 9413.1 / 12.6% 262.2
APS APS Error APS Range APR
854.6 3.4 / 0.395% 413.1 / 48.3% 0.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
233.4 232.1 Mana 0.00% 48.4 100.0% 100%
TalentBIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T29_Priest_Shadow 74512
Devouring Plague 19009 25.5% 54.6 5.49sec 104489 100788 Direct 54.6 36887 79115 43082 14.7%
Periodic 133.2 22029 44905 25158 13.7% 86.3%

Stats Details: Devouring Plague

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.56 54.56 133.17 133.17 37.77 1.0367 1.9433 5700792.08 5700792.08 0.00% 18077.95 100788.38
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.33% 46.55 27 66 36886.65 25228 64096 36884.78 33941 39706 1717249 1717249 0.00%
crit 14.67% 8.00 0 24 79115.16 50457 128192 79194.63 0 112669 633256 633256 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.32% 114.95 79 149 22028.60 656 58230 22023.20 19488 24684 2532225 2532225 0.00%
crit 13.68% 18.22 5 35 44904.51 1358 113002 44893.04 32576 59852 818062 818062 0.00%

Action Details: Devouring Plague

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:50.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.701215
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.75

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.582811
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.

Action Priority List

    main
    [N]:54.56
  • if_expr:(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
Halo 0 (769) 0.0% (1.0%) 5.5 57.01sec 42285 41169

Stats Details: Halo

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.45 0.00 0.00 0.00 0.00 1.0272 0.0000 0.00 0.00 0.00% 41168.90 41168.90

Action Details: Halo

  • id:120644
  • school:shadow
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Shadow damage to enemies. Healing reduced beyond {$s1=6} targets.

Action Priority List

    main
    [V]:5.47
  • if_expr:raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
    Halo (_damage) 769 1.0% 5.5 57.01sec 42285 0 Direct 5.4 36674 80698 42529 13.3%

Stats Details: Halo Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.45 5.42 0.00 0.00 0.00 0.0000 0.0000 230463.50 230463.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.70% 4.70 1 8 36674.32 25991 55382 36699.35 25991 50089 172326 172326 0.00%
crit 13.30% 0.72 0 4 80697.76 51981 110764 43530.03 0 110764 58138 58138 0.00%

Action Details: Halo Damage

  • id:390964
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.442000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390964
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Idol of C'Thun 0 (5013) 0.0% (6.7%) 0.0 0.00sec 0 0

Stats Details: Idol Of Cthun

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Idol Of Cthun

  • id:377349
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:377349
  • name:Idol of C'Thun
  • school:physical
  • tooltip:
  • description:Mind Flay and Mind Sear have a chance to spawn a Void Tendril or Void Lasher that channels at your target for {$377355d=15 seconds}, generating {$s1=3} insanity every {$193473t1=1} sec.
    Mind Flay (void_tendril) 10446  / 5013 6.7% 24.5 11.44sec 61318 8187 Periodic 183.9 7271 14739 8187 12.3% 61.3%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.55 0.00 183.88 183.88 0.00 7.4901 1.0000 1505346.88 1505346.88 0.00% 8186.66 8186.66
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 87.74% 161.33 54 382 7270.72 5900 9118 7265.21 6778 7798 1172953 1172953 0.00%
crit 12.26% 22.55 4 60 14738.69 11800 18237 14717.38 13170 16528 332394 332394 0.00%

Action Details: Mind Flay

  • id:193473
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:1.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:1667.76
  • base_td_mult:1.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:{$?=}{$=}w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=30}%.

Action Priority List

    default
    [ ]:3.88
Mind Blast 6954 9.3% 67.8 4.43sec 30758 29850 Direct 67.8 26326 58098 30758 13.9%

Stats Details: Mind Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.78 67.78 0.00 0.00 0.00 1.0304 0.0000 2084893.18 2084893.18 0.00% 29849.86 29849.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.05% 58.33 38 83 26326.08 15531 43023 26319.78 23664 28621 1535545 1535545 0.00%
crit 13.95% 9.46 1 22 58097.80 31063 86046 58163.71 38974 78731 549348 549348 0.00%

Action Details: Mind Blast

  • id:8092
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:9.000
  • cooldown hasted:true
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:6.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.783360
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.{$?s137033=true}[ |cFFFFFFFFGenerates {$/100;s2=0} Insanity|r][]{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [M]:5.12
  • if_expr:(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
    main
    [Q]:61.46
  • if_expr:variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
    main
    [T]:1.39
  • if_expr:raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
Mind Flay 1016 1.4% 7.6 35.36sec 40132 12773 Periodic 45.3 6004 12432 6722 11.2% 7.8%

Stats Details: Mind Flay

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.59 0.00 45.33 45.33 0.00 3.1420 0.5193 304746.95 304746.95 0.00% 12772.83 12772.83
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 88.83% 40.27 0 91 6003.80 4667 8752 6003.41 0 7884 241764 241764 0.00%
crit 11.17% 5.07 0 18 12432.34 9334 17503 12173.54 0 17309 62983 62983 0.00%

Action Details: Mind Flay

  • id:15407
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:2.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.235400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.50
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=4.500 seconds} and slowing their movement speed by {$s2=50}%. |cFFFFFFFFGenerates {$=}{{$s4=6}*{$s3=200}/100} Insanity over the duration.|r

Action Priority List

    main
    [U]:43.60
  • if_expr:buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
    main
    [X]:7.59
  • interrupt_if_expr:ticks>=2
Mind Flay: Insanity 9610 12.9% 43.6 6.77sec 66128 32489 Periodic 173.7 14579 29844 16598 13.2% 29.6%

Stats Details: Mind Flay Insanity

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.60 0.00 173.70 173.70 0.00 2.0355 0.5109 2883030.42 2883030.42 0.00% 32488.51 32488.51
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.77% 150.72 99 211 14578.54 10268 19253 14574.82 13961 15251 2197209 2197209 0.00%
crit 13.23% 22.98 7 42 29844.36 20535 38507 29836.93 26988 32940 685822 685822 0.00%

Action Details: Mind Flay Insanity

  • id:391403
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:per_tick
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.517880
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:391403
  • name:Mind Flay: Insanity
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=70}% and taking Shadow damage every {$t1=0.750} sec.
  • description:Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r
Mind Spike 1562 2.1% 11.6 22.18sec 40307 39350 Direct 11.6 35371 77075 40307 11.8%

Stats Details: Mind Spike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 11.60 11.60 0.00 0.00 0.00 1.0244 0.0000 467591.97 467591.97 0.00% 39349.66 39349.66
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 88.17% 10.23 1 26 35371.23 23792 65905 35496.98 24907 56983 361784 361784 0.00%
crit 11.83% 1.37 0 8 77074.52 47584 131811 56984.51 0 131811 105808 105808 0.00%

Action Details: Mind Spike

  • id:73510
  • school:shadowfrost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:4.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.440000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$s1=0} Shadowfrost damage.{$?s391090=false}[ Mind Spike reduces the cast time of your next Mind Blast by {$391092s1=50}% and increases its critical strike chance by {$391092s2=25}%, stacking up to {$391092=}U times.][] |cFFFFFFFFGenerates {$=}{{$s2=400}/100} Insanity|r{$?s391137=false}[ |cFFFFFFFFand an additional {$=}{{$s3=0}/100} Insanity from a critical strike.|r][.]

Action Priority List

    main
    [W]:11.60
  • if_expr:buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
Mindgames 2251 3.0% 8.0 39.20sec 84542 81042 Direct 8.0 (8.0) 71719 157947 84542 14.9% (14.9%)

Stats Details: Mindgames

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.98 7.98 0.00 0.00 0.00 1.0433 0.0000 674755.72 674755.72 0.00% 81042.00 81042.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.13% 6.79 2 10 71719.27 50693 108018 71575.25 57135 88890 487301 487301 0.00%
crit 14.87% 1.19 0 5 157946.92 101385 216036 114812.69 0 216036 187454 187454 0.00%

Action Details: Mindgames

  • id:375901
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:375901
  • name:Mindgames
  • school:shadow
  • tooltip:The next {$=}w2 damage and {$=}w5 healing dealt will be reversed.
  • description:Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target.

Action Priority List

    main
    [R]:8.01
  • if_expr:spell_targets.mind_sear<5&variable.all_dots_up
Shadow Crash 0 (1917) 0.0% (2.6%) 8.7 32.79sec 66140 63051

Stats Details: Shadow Crash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.70 0.00 0.00 0.00 0.00 1.0490 0.0000 0.00 0.00 0.00% 63050.64 63050.64

Action Details: Shadow Crash

  • id:205385
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:15.0

Spelldata

  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r

Action Priority List

    main
    [S]:8.70
  • if_expr:raid_event.adds.in>10
    Shadow Crash (_damage) 1917 2.6% 9.6 32.59sec 59615 0 Direct 9.6 50857 110710 59615 14.6%

Stats Details: Shadow Crash Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 9.65 0.00 0.00 0.00 0.0000 0.0000 575274.04 575274.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.37% 8.24 3 12 50857.23 27491 78951 50700.53 40985 58940 418956 418956 0.00%
crit 14.63% 1.41 0 7 110710.22 54981 157902 87483.82 0 157902 156318 156318 0.00%

Action Details: Shadow Crash Damage

  • id:205386
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.103750
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadow Weaving 1967 2.6% 143.7 2.04sec 4098 0 Direct 142.7 4126 0 4126 0.0%

Stats Details: Shadow Weaving

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 143.67 142.67 0.00 0.00 0.00 0.0000 0.0000 588715.96 588715.96 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 142.67 104 178 4126.49 2057 9644 4125.49 3704 4711 588716 588716 0.00%

Action Details: Shadow Weaving

  • id:346111
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3373.85
  • base_dd_max:3373.85
  • base_dd_mult:1.00

Spelldata

  • id:346111
  • name:Shadow Weaving
  • school:shadow
  • tooltip:
  • description:{$@spelldesc343690=Your damage is increased by {$=}{{$m1=0}}.1% for each of Shadow Word: Pain, Vampiric Touch and Devouring Plague on the target. During Voidform, all targets receive the maximum effect.}
Shadow Word: Death 2028 2.7% 13.2 23.50sec 45998 43891 Direct 13.2 39985 82905 45997 14.0%

Stats Details: Shadow Word Death

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.19 13.19 0.00 0.00 0.00 1.0480 0.0000 606755.35 606755.35 0.00% 43891.45 43891.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.99% 11.34 4 18 39985.07 16853 87723 39920.92 25771 56471 453544 453544 0.00%
crit 14.01% 1.85 0 8 82905.23 33705 175447 71802.85 0 175447 153211 153211 0.00%

Action Details: Shadow Word Death

  • id:32379
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1250.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.850000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=0} Shadow damage to the target. If the target is not killed by Shadow Word: Death, the caster takes damage equal to the damage inflicted upon the target. {$?=}A364675[Damage increased by {$=}{{$s3=150}+{$364675s2=100}}% to targets below {$=}{{$s2=20}+{$364675s1=30}}% health.][Damage increased by {$s3=150}% to targets below {$s2=20}% health.]{$?=}c3[][]

Action Priority List

    main
    [L]:3.76
  • if_expr:pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
    main
    [O]:9.43
  • target_if_expr:(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
Shadow Word: Pain 3819 5.1% 9.6 32.59sec 118670 0 Periodic 217.0 4619 9488 5277 13.5% 99.3%

Stats Details: Shadow Word Pain

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 0.00 217.00 217.00 227.68 0.0000 1.3723 1145155.82 1145155.82 0.00% 3845.70 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.48% 187.66 134 235 4618.91 487 6176 4617.96 4449 4780 866767 866767 0.00%
crit 13.52% 29.34 9 54 9487.85 6587 12351 9487.05 8603 10462 278389 278389 0.00%

Action Details: Shadow Word Pain

  • id:589
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:3.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.095880
  • base_td:0.00
  • base_td_mult:1.73
  • dot_duration:21.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=2} sec.
  • description:A word of darkness that causes {$?a390707=false}[{$=}{{$s1=0}*(1+{$390707s1=15}/100)}][{$s1=0}] Shadow damage instantly, and an additional {$?a390707=false}[{$=}{{$=}o2*(1+{$390707s1=15}/100)}][{$=}o2] Shadow damage over {$d=16 seconds}.{$?s137033=true}[ |cFFFFFFFFGenerates {$=}{{$m3=300}/100} Insanity.|r][]
Shadowy Apparitions 0 (2170) 0.0% (2.9%) 122.3 2.44sec 5323 0

Stats Details: Shadowy Apparitions

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 122.34 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowy Apparitions

  • id:341491
  • school:physical
  • range:0.0
  • travel_speed:6.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:341491
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:Mind Blast, Devouring Plague, and Void Bolt have a {$s4=100}% chance to conjure Shadowy Apparitions and Mind Sear has a {$s3=50}% chance to conjure Shadowy Apparitions. Shadowy Apparitions float towards all targets afflicted by your Vampiric Touch for {$148859s1=0} Shadow damage. Critical strikes with Mind Blast, Devouring Plague, and Void Bolt increase the damage of the Shadowy Apparitions they conjure by {$s2=100}%.
    Shadowy Apparition 2170 2.9% 120.4 2.44sec 5409 0 Direct 118.5 5497 0 5497 0.0%

Stats Details: Shadowy Apparition

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 120.41 118.48 0.00 0.00 0.00 0.0000 0.0000 651265.22 651265.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 118.48 84 160 5496.69 3876 8259 5493.86 5206 5807 651265 651265 0.00%

Action Details: Shadowy Apparition

  • id:148859
  • school:shadow
  • range:100.0
  • travel_speed:6.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.187000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Spelldata

  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals $148859sw1 Shadow damage.}
Soulseeker Arrow 2380 3.2% 8.0 34.31sec 89497 0 Periodic 99.2 7190 0 7190 0.0% 41.8%

Stats Details: Soulseeker Arrow

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.97 0.00 99.25 99.25 2.92 0.0000 1.2650 713624.22 713624.22 0.00% 5684.12 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 99.25 21 219 7190.45 5 7385 7187.01 7020 7378 713624 713624 0.00%

Action Details: Soulseeker Arrow

  • id:388755
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:6573.97
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:388755
  • name:Soulseeker Arrow
  • school:shadow
  • tooltip:Suffering {$=}w1 Shadow damage every {$t1=2} sec.
  • description:{$@spelldesc383920=Your damaging spells have a chance to fire a Soulseeker Arrow towards your target, inflicting {$=}{{$s2=1747}*({$388755d=20 seconds}/{$388755t1=2}+1)*(1+{$@=}versadmg)} Shadow damage over {$388755d=20 seconds}. If the target dies while affected, your next damaging spells will fire an arrow. }
Vampiric Touch 5777 7.8% 9.6 32.59sec 179556 0 Periodic 180.4 8417 17299 9605 13.4% 99.2%

Stats Details: Vampiric Touch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.65 0.00 180.39 180.39 227.68 0.0000 1.6495 1732702.41 1732702.41 0.00% 5823.25 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 86.62% 156.26 111 199 8416.80 2125 11263 8415.58 8111 8719 1315187 1315187 0.00%
crit 13.38% 24.14 8 45 17298.74 12012 22525 17296.94 15367 19356 417515 417515 0.00%

Action Details: Vampiric Touch

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:insanity
  • energize_amount:4.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.201960
  • base_td:0.00
  • base_td_mult:1.50
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Action Priority List

    main
    [P]:0.00
  • target_if_expr:(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
pet - mindbender 17481 / 8270
Inescapable Torment 0 (4843) 0.0% (6.5%) 44.9 6.55sec 32275 0

Stats Details: Inescapable Torment

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.91 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Inescapable Torment

  • id:373427
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:373427
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.
    Inescapable Torment (_damage) 10230 6.5% 44.9 6.55sec 32275 0 Direct 44.9 27025 56948 32274 17.5%

Stats Details: Inescapable Torment Damage

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.91 44.91 0.00 0.00 0.00 0.0000 0.0000 1449529.83 1449529.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.46% 37.03 18 62 27025.37 16817 37626 27013.70 24032 29396 1000841 1000841 0.00%
crit 17.54% 7.88 0 18 56947.58 33634 75251 56946.88 0 73243 448689 448689 0.00%

Action Details: Inescapable Torment Damage

  • id:373442
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:5
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.923780
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:373442
  • name:Inescapable Torment
  • school:shadow
  • tooltip:
  • description:{$@spelldesc373427=Mind Blast and Shadow Word: Death cause your Mindbender to teleport behind your target, slashing up to {$s2=5} nearby enemies for {$=}<value> Shadow damage and increasing the duration of Mindbender by {$=}{{$s3=1}}.1 sec.}
melee 7251 4.6% 143.7 2.04sec 7139 7386 Direct 143.7 6059 12318 7139 17.3%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 143.67 143.67 0.00 0.00 0.00 0.9665 0.0000 1025615.64 1025615.64 0.00% 7385.86 7385.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 118.88 73 151 6058.93 5231 7647 6057.52 5723 6354 720299 720299 0.00%
crit 17.25% 24.79 8 46 12317.99 10461 15295 12317.26 11079 13590 305317 305317 0.00%

Action Details: Melee

  • id:0
  • school:shadow
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
Healing & Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
T29_Priest_Shadow 0
Mental Fortitude 855 100.0% 360.3 0.83sec 709 0 Direct 372.6 686 0 686 0.0%

Stats Details: Mental Fortitude

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
absorb 360.26 372.63 0.00 0.00 0.00 0.0000 0.0000 255496.38 12396436.89 97.94% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 372.63 279 462 685.65 0 45189 687.40 371 1028 255496 12396437 97.93%

Action Details: Mental Fortitude

  • id:377065
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35098.00
  • base_dd_max:35098.00
  • base_dd_mult:1.00

Spelldata

  • id:377065
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
Simple Action Stats Execute Interval
T29_Priest_Shadow
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Blood Fury 2.9 123.25sec

Stats Details: Blood Fury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.94 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Blood Fury

  • id:33702
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.

Action Priority List

    default
    [D]:2.94
  • if_expr:buff.power_infusion.up|fight_remains<=15
Dark Ascension 5.3 61.72sec

Stats Details: Dark Ascension

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.32 0.00 102.99 0.00 0.00 1.0884 1.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Dark Ascension

  • id:391109
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:insanity
  • energize_amount:30.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:391109
  • name:Dark Ascension
  • school:shadow
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r

Action Priority List

    cds
    [G]:5.34
  • if_expr:pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
Desperate Prayer 0.2 0.00sec

Stats Details: Desperate Prayer

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.20 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Desperate Prayer

  • id:19236
  • school:holy
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:19236
  • name:Desperate Prayer
  • school:holy
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.

Action Priority List

    cds
    [J]:0.20
  • if_expr:health.pct<=75
Devouring Plague (_heal) 187.7 1.59sec

Stats Details: Devouring Plague Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 187.73 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Devouring Plague Heal

  • id:335467
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:insanity
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:335467
  • name:Devouring Plague
  • school:shadow
  • tooltip:Suffering {$=}w2 damage every {$t2=3} sec.
  • description:Afflicts the target with a disease that instantly causes {$s1=0 + 70.1%} Shadow damage plus an additional {$=}o2 Shadow damage over {$d=6 seconds}. Heals you for {$=}{{$=}e2*100}% of damage dealt. If this effect is reapplied, any remaining damage will be added to the new Devouring Plague.
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Halo (_heal) 5.5 57.01sec

Stats Details: Halo Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 5.45 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Halo Heal

  • id:390971
  • school:shadow
  • range:30.0
  • travel_speed:15.0000
  • radius:100.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Priest_Shadow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.610000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:390971
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120517=Creates a ring of Holy energy around you that quickly expands to a 30 yd radius, healing allies for {$120692s1=0} and dealing {$120696s1=0} Holy damage to enemies. Healing reduced beyond {$s1=6} targets.}
Mindbender 5.4 60.65sec

Stats Details: Mindbender

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.45 0.00 0.00 0.00 0.00 1.0903 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindbender

  • id:200174
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:60.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$=}{{$200010s1=300}/100} Insanity each time the Mindbender attacks.|r

Action Priority List

    cds
    [I]:5.45
  • if_expr:(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
Mindgames (_damage_reversal) 8.0 39.20sec

Stats Details: Mindgames Damage Reversal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 7.98 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mindgames Damage Reversal

  • id:323706
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Priest_Shadow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.25

Spelldata

  • id:323706
  • name:Mindgames
  • school:shadow
  • tooltip:
  • description:{$@spelldesc323673=Assault an enemy's mind, dealing {$=}{{$s1=0}*{$m3=100}/100} Shadow damage and briefly reversing their perception of reality. {$?=}c3[For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing generate up to {$=}{{$323706s2=10}*2} Insanity.|r] ][For {$d=5 seconds}, the next {$=}<damage> damage they deal will heal their target, and the next {$=}<healing> healing they deal will damage their target. |cFFFFFFFFReversed damage and healing restore up to {$=}{{$323706s3=2}*2}% mana.|r]}
Elemental Potion of Ultimate Power 1.4 308.61sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.40 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [C]:1.40
  • if_expr:buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
Power Infusion 2.9 123.45sec

Stats Details: Power Infusion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.92 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Power Infusion

  • id:10060
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.

Action Priority List

    cds
    [F]:2.92
  • if_expr:(buff.voidform.up|buff.dark_ascension.up)
Shadow Crash (_dots) 8.7 32.79sec

Stats Details: Shadow Crash Dots

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.70 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadow Crash Dots

  • id:391286
  • school:shadow
  • range:100.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:391286
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within {$205386=}A1 yards and applying Vampiric Touch to {$391286s1=8} of them. |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r}
Shadowform 1.0 0.00sec

Stats Details: Shadowform

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shadowform

  • id:232698
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
Vampiric Touch (_heal) 180.4 1.65sec

Stats Details: Vampiric Touch Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 180.39 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Vampiric Touch Heal

  • id:34914
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:T29_Priest_Shadow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4137.49
  • base_dd_max:4137.49
  • base_dd_mult:1.00

Spelldata

  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering {$=}w2 Shadow damage every {$t2=3} sec.
  • description:A touch of darkness that causes {$34914=}o2 Shadow damage over {$34914d=21 seconds}, and heals you for {$=}{{$=}e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates {$=}{{$m3=400}/100} Insanity.|r

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ancient Madness 5.3 0.0 61.7sec 61.7sec 19.4sec 34.37% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_ancient_madness
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.1s / 69.3s
  • trigger_min/max:61.1s / 69.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • ancient_madness_1:1.67%
  • ancient_madness_2:1.67%
  • ancient_madness_3:1.68%
  • ancient_madness_4:1.68%
  • ancient_madness_5:1.69%
  • ancient_madness_6:1.69%
  • ancient_madness_7:1.70%
  • ancient_madness_8:1.70%
  • ancient_madness_9:1.71%
  • ancient_madness_10:1.72%
  • ancient_madness_11:1.72%
  • ancient_madness_12:1.73%
  • ancient_madness_13:1.73%
  • ancient_madness_14:1.74%
  • ancient_madness_15:1.74%
  • ancient_madness_16:1.75%
  • ancient_madness_17:1.76%
  • ancient_madness_18:1.76%
  • ancient_madness_19:1.77%
  • ancient_madness_20:1.77%

Spelldata

  • id:341240
  • name:Ancient Madness
  • tooltip:
  • description:Voidform and Dark Ascension increase your critical strike chance by {$s1=10}% for {$194249d=20 seconds}, reducing by {$=}{{$s3=5}/10}.1% every sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 123.3sec 123.3sec 14.7sec 14.49% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:583.46

Trigger Details

  • interval_min/max:120.0s / 133.5s
  • trigger_min/max:120.0s / 133.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • blood_fury_1:14.49%

Spelldata

  • id:33702
  • name:Blood Fury
  • tooltip:Intellect increased by {$=}w1.
  • description:Increases your Intellect by {$s1=583} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Coalescing Shadows 60.6 160.3 5.0sec 1.4sec 3.1sec 63.31% 75.68% 78.2 (78.2) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_coalescing_shadows
  • max_stacks:3
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 47.4s
  • trigger_min/max:0.0s / 41.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • coalescing_shadows_1:22.13%
  • coalescing_shadows_2:14.31%
  • coalescing_shadows_3:26.87%

Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Coalescing Shadows (_dot) 1.8 58.1 134.6sec 5.0sec 159.9sec 98.42% 99.07% 58.1 (58.1) 0.9

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_coalescing_shadows_dot
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.1s / 353.3s
  • trigger_min/max:0.0s / 44.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.2s

Stack Uptimes

  • coalescing_shadows_dot_1:98.42%

Spelldata

  • id:391244
  • name:Coalescing Shadows
  • tooltip:Your periodic damage is increased by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391243
  • name:Coalescing Shadows
  • tooltip:Increases the damage of your next Mind Blast or Mind spike by {$s1=10}%.
  • description:{$@spelldesc391242=Mind Sear and Shadow Word: Pain damage has a {$s1=4}% chance to grant you Coalescing Shadows and Mind Flay has a {$s2=15}% chance to grant you Coalescing Shadows, stacking up to 3 times. Mind Blast and Mind Spike consume all Coalescing Shadows to deal {$391243s1=10}% increased damage per stack, and consuming at least 1 increases the damage of your periodic effects by {$391244s1=10}% for {$391244d=15 seconds}.}
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Ascension 5.3 0.0 61.7sec 61.7sec 19.4sec 34.37% 41.83% 98.0 (98.0) 5.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_dark_ascension
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:61.1s / 69.3s
  • trigger_min/max:61.1s / 69.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • dark_ascension_1:34.37%

Spelldata

  • id:391109
  • name:Dark Ascension
  • tooltip:Your non-periodic Shadow damage is increased by {$=}w1%. {$?s341240=true}[Critical strike chance increased by {$=}{{$=}W4}.1%.][]
  • description:Increases your non-periodic Shadow damage by {$s1=25}% for 20 sec. |cFFFFFFFFGenerates {$=}{{$m2=3000}/100} Insanity.|r
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Dark Evangelism 1.0 218.0 295.2sec 1.3sec 293.1sec 97.71% 98.16% 214.0 (214.0) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_dark_evangelism
  • max_stacks:5
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:196.1s / 330.9s
  • trigger_min/max:0.3s / 32.1s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 353.9s

Stack Uptimes

  • dark_evangelism_1:0.12%
  • dark_evangelism_2:0.12%
  • dark_evangelism_3:0.12%
  • dark_evangelism_4:0.84%
  • dark_evangelism_5:96.52%

Spelldata

  • id:391099
  • name:Dark Evangelism
  • tooltip:Periodic Shadow damage increased by {$=}w1%.
  • description:{$@spelldesc391095=Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.}
  • max_stacks:5
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:391095
  • name:Dark Evangelism
  • tooltip:
  • description:Your Mind Flay, Mind Sear, and Void Torrent damage increases the damage of your periodic Shadow effects by {$s2=1}%, stacking up to {$391099=}U times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Dark Reveries 6.7 47.8 46.0sec 5.5sec 42.3sec 94.79% 0.00% 47.8 (47.8) 5.8

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_dark_reveries
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

Trigger Details

  • interval_min/max:8.0s / 309.4s
  • trigger_min/max:0.8s / 22.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 308.4s

Stack Uptimes

  • dark_reveries_1:94.79%

Spelldata

  • id:394963
  • name:Dark Reveries
  • tooltip:Haste increased by {$s1=4}%.
  • description:{$@spelldesc393685=Devouring Plague and Mind Sear increase your haste by {$394963s1=4}% for {$394963d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_insanity_gain) 0.4 0.0 0.0sec 0.0sec 0.0sec 0.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_death_and_madness_insanity_gain
  • max_stacks:1
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 0.0s

Stack Uptimes

Spelldata

  • id:321973
  • name:Death and Madness
  • tooltip:{$=}{{$m1=750}/100} Insanity generated every {$t1=1} sec.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_reset) 2.8 0.0 22.0sec 22.0sec 16.8sec 15.85% 0.00% 0.0 (0.0) 1.9

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_death_and_madness_reset
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.9s / 35.1s
  • trigger_min/max:20.9s / 35.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • death_and_madness_reset_1:15.85%

Spelldata

  • id:390628
  • name:Death and Madness
  • tooltip:
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:321291
  • name:Death and Madness
  • tooltip:
  • description:If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Desperate Prayer 0.2 0.0 0.0sec 0.0sec 9.2sec 0.59% 0.00% 1.6 (1.6) 0.2

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_desperate_prayer
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.0s

Stack Uptimes

  • desperate_prayer_1:0.60%

Spelldata

  • id:19236
  • name:Desperate Prayer
  • tooltip:Maximum health increased by {$=}w1%.
  • description:Increases maximum health by {$?s373450=true}[{$=}{{$s1=25}+{$373450s1=8}}][{$s1=25}]% for {$d=10 seconds}, and instantly heals you for that amount.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Devoured Pride 1.5 0.0 60.7sec 0.0sec 23.2sec 11.19% 12.89% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_devoured_pride
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 63.3s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.0s / 34.0s

Stack Uptimes

  • devoured_pride_1:11.19%

Spelldata

  • id:373316
  • name:Devoured Pride
  • tooltip:Damage increased by {$s1=5}%.
  • description:{$@spelldesc373310=Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373310
  • name:Idol of Y'Shaarj
  • tooltip:
  • description:Summoning {$?s123040=true}|s200174[Mindbender][Shadowfiend] causes you to gain a benefit based on your target's current state or increases its duration by {$373320s1=5} sec if no state matches. |cffffffffHealthy|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373316s1=5}% additional damage. |cffffffffEnraged|r: Devours the Enraged effect, increasing your Haste by {$373318s1=5}%. |cffffffffStunned|r: Generates {$=}{{$373317s1=500}/100} Insanity every {$373317t1=1} sec. |cffffffffFeared|r: You and your {$?s123040=true}|s200174[Mindbender][Shadowfiend] deal {$373319s1=15}% increased damage and do not break Fear effects.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Air 3.3 0.4 66.6sec 56.9sec 12.5sec 13.65% 0.00% 0.4 (0.4) 3.1

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_elemental_lariat__empowered_air
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 323.3s
  • trigger_min/max:0.7s / 323.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.6s

Stack Uptimes

  • elemental_lariat__empowered_air_1:13.65%

Spelldata

  • id:375342
  • name:Elemental Lariat - Empowered Air
  • tooltip:Haste increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Earth 3.3 0.4 66.8sec 57.0sec 12.5sec 13.65% 0.00% 0.4 (0.4) 3.1

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_elemental_lariat__empowered_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 345.2s
  • trigger_min/max:0.8s / 345.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.7s

Stack Uptimes

  • elemental_lariat__empowered_earth_1:13.65%

Spelldata

  • id:375345
  • name:Elemental Lariat - Empowered Earth
  • tooltip:Mastery increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Flame 3.3 0.4 67.2sec 57.5sec 12.5sec 13.58% 0.00% 0.4 (0.4) 3.1

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_elemental_lariat__empowered_flame
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 329.7s
  • trigger_min/max:0.8s / 329.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 40.2s

Stack Uptimes

  • elemental_lariat__empowered_flame_1:13.58%

Spelldata

  • id:375335
  • name:Elemental Lariat - Empowered Flame
  • tooltip:Critical strike increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.4 0.0 308.7sec 308.7sec 27.4sec 12.59% 0.00% 0.0 (0.0) 1.2

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:305.6s / 317.9s
  • trigger_min/max:305.6s / 317.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:12.59%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Gathering Shadows 46.5 21.3 6.5sec 4.4sec 3.1sec 48.67% 84.49% 0.4 (0.4) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_gathering_shadows
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 22.6s
  • trigger_min/max:0.0s / 14.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.7s

Stack Uptimes

  • gathering_shadows_1:37.46%
  • gathering_shadows_2:9.78%
  • gathering_shadows_3:1.43%

Spelldata

  • id:394961
  • name:Gathering Shadows
  • tooltip:Damage of next Mind Sear or Devouring Plague increased by {$s1=12}%.
  • description:{$@spelldesc393684=Mind Blast increases the damage of your next Devouring Plague or Mind Sear by {$394961s1=12}%, stacking up to {$394961u=3} times.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Mental Fortitude 4.7 355.6 77.2sec 0.8sec 61.4sec 96.18% 100.00% 355.6 (355.6) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Absorb Details

  • school:chaos
  • high priority:no

Trigger Details

  • interval_min/max:0.1s / 338.8s
  • trigger_min/max:0.0s / 18.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 328.3s

Stack Uptimes

  • mental_fortitude_1:96.18%

Spelldata

  • id:377065
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch and Devouring Plague when you are at maximum health will shield you for the same amount. Shield cannot exceed {$=}{{$=}MHP*{$s1=10}/100} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Mind Devourer 6.7 0.2 39.3sec 38.2sec 2.0sec 4.37% 12.01% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_mind_devourer
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 330.9s
  • trigger_min/max:0.1s / 330.9s
  • trigger_pct:10.08%
  • duration_min/max:0.0s / 10.2s

Stack Uptimes

  • mind_devourer_1:4.37%

Spelldata

  • id:373204
  • name:Mind Devourer
  • tooltip:Your next Devouring Plague or Mind Sear costs 0 insanity.
  • description:{$@spelldesc373202=Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:373202
  • name:Mind Devourer
  • tooltip:
  • description:Mind Blast has a {$s1=15}% chance to make your next Devouring Plague or Mind Sear cost no insanity.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Mind Flay: Insanity 44.1 10.5 6.8sec 5.5sec 3.0sec 43.94% 0.00% 10.5 (10.5) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_mind_flay_insanity
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:1.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.1s / 29.7s
  • trigger_min/max:0.8s / 22.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.4s

Stack Uptimes

  • mind_flay_insanity_1:43.94%

Spelldata

  • id:391401
  • name:Mind Flay: Insanity
  • tooltip:Mind Flay is temporarily empowered.
  • description:{$@spelldesc391399=Devouring Plague transforms your next Mind Flay into Mind Flay: Insanity. Lasts {$391401d=10 seconds}. {$@=}spellicon391403 {$@=}spellname391403 {$@spelldesc391403=Assaults the target's mind with Shadow energy, causing {$=}o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=70}%. |cFFFFFFFFGenerates {$=}{{$s4=4}*{$s3=400}/100} Insanity over the duration.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Power Infusion 2.9 0.0 123.5sec 123.5sec 19.4sec 18.97% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:122.2s / 133.5s
  • trigger_min/max:122.2s / 133.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • power_infusion_1:18.97%

Spelldata

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$=}w1%.
  • description:Infuses the target with power for {$d=20 seconds}, increasing haste by {$s1=25}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • shadowform_1:100.00%

Spelldata

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 18.7 0.7 15.6sec 15.0sec 1.2sec 7.73% 27.31% 0.7 (0.7) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

RPPM Details

  • scaling:haste
  • frequency:2.40
  • modifier:1.00

Trigger Details

  • interval_min/max:0.9s / 66.3s
  • trigger_min/max:0.9s / 66.3s
  • trigger_pct:8.96%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • shadowy_insight_1:7.73%

Spelldata

  • id:375981
  • name:Shadowy Insight
  • tooltip:Your next Mind Blast is instant cast.
  • description:{$@spelldesc375888=Mind Blast gains an additional charge. Shadow Word: Pain periodic damage has a chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 61.0sec 45.6sec 16.5sec 23.77% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:932.20

Trigger Details

  • interval_min/max:15.0s / 213.8s
  • trigger_min/max:0.0s / 212.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.0s

Stack Uptimes

  • sophic_devotion_1:23.77%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Surge of Darkness 13.4 16.0 22.2sec 9.9sec 12.3sec 54.87% 100.00% 4.0 (4.0) 7.4

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_surge_of_darkness
  • max_stacks:3
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 161.5s
  • trigger_min/max:0.0s / 153.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 112.6s

Stack Uptimes

  • surge_of_darkness_1:26.15%
  • surge_of_darkness_2:14.99%
  • surge_of_darkness_3:13.73%

Spelldata

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike is instant cast, and deals {$s2=200}% additional damage.
  • description:{$@spelldesc162448=Your Vampiric Touch and Devouring Plague damage has a chance to cause your next Mind Spike to be instant cast and deal {$87160s2=200}% additional damage. Stacks up to {$87160u=3} times.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Twist of Fate 1.0 221.3 0.0sec 0.5sec 104.5sec 34.82% 33.00% 221.3 (221.3) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 4.4s
  • trigger_pct:100.00%
  • duration_min/max:82.0s / 125.9s

Stack Uptimes

  • twist_of_fate_1:34.82%

Spelldata

  • id:390978
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$=}w1%.
  • description:{$@spelldesc390972=After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390972
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s3=35}% health, gain {$s1=5}% increased damage and healing for {$390978d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Valarjar's Path 2.9 0.0 123.5sec 123.5sec 28.7sec 27.98% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_valarjars_path
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Horn of Valor

Stat Details

  • stat:intellect
  • amount:1263.71

Trigger Details

  • interval_min/max:122.2s / 133.5s
  • trigger_min/max:122.2s / 133.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • valarjars_path_1:27.98%

Spelldata

  • id:215956
  • name:Valarjar's Path
  • tooltip:Primary stat increased by {$s4=605}.
  • description:Sound the horn, increasing your primary stat by {$215956s1=605} for {$215956d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:120.00
  • default_chance:0.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Zone of Focus 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_zone_of_focus
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:220.30

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • zone_of_focus_1:100.00%

Spelldata

  • id:387336
  • name:Zone of Focus
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc387335=Greatly improves the comfort of your gear, allowing you to enter a Zone of Focus while over {$396377s1=90}% health, granting you {$s1=92} Mastery.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Shadowy Apparition from Devouring Plague 54.6 36.0 74.0 5.5s 0.8s 22.9s
Shadowy Apparition from Mind Blast 67.8 49.0 93.0 4.4s 0.0s 14.3s
Mind Devourer free Devouring Plague proc 6.8 0.0 18.0 38.2s 0.1s 330.9s
Void Tendril proc from Idol of C'Thun 12.6 4.0 29.0 22.6s 0.3s 102.5s
Shadowy Insight procs 18.7 8.0 34.0 15.6s 0.9s 66.3s
Shadowy Insight procs lost to overflow 0.7 0.0 6.0 89.6s 0.9s 347.8s
Coalescing Shadows from Mind Fay 54.8 28.0 86.0 5.3s 0.3s 77.2s
Coalescing Shadows from Shadow Word: Pain 13.0 1.0 28.0 21.5s 0.9s 216.2s
Coalescing Shadows from Shadowy Apparition 9.5 1.0 24.0 27.8s 0.0s 239.7s
Surge of Darkness from Vampiric Touch 14.4 3.0 32.0 19.6s 0.8s 194.6s
Surge of Darkness from Devouring Plague 15.0 2.0 33.0 18.7s 0.0s 211.0s
Mind Flay: Insanity casts that did not channel for full ticks 0.3 0.0 1.0 0.0s 0.0s 0.0s
Idol of Y'Shaarj Devoured Violence procs 4.0 3.0 5.0 60.7s 60.0s 63.2s
Mindgames casts without full Mastery value 0.3 0.0 4.0 103.4s 34.1s 299.6s
Inescapable Torment expired when Mind Blast was ready 3.6 0.0 8.0 88.0s 0.0s 336.7s
Inescapable Torment expired when Shadow Word: Death was ready 0.5 0.0 5.0 155.2s 0.1s 335.8s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 81.26% 74.46% 85.48% 10.1s 0.0s 43.2s

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
T29_Priest_Shadow
Auspicious SpiritsInsanity118.48118.204.84%1.000.290.24%
Insanity Gained from Idol of C'thun Mind Flay'sInsanity183.89365.8214.97%1.991.960.53%
MindbenderInsanity143.67428.9117.55%2.992.090.49%
Throes of PainInsanity1.004.950.20%4.950.051.05%
Dark AscensionInsanity5.32154.436.32%29.025.213.26%
mana_regenMana892.8469628.66100.00%77.99409819.6085.48%
Mind BlastInsanity67.78405.1116.58%5.981.590.39%
Mind FlayInsanity45.2490.163.69%1.990.320.36%
Mind Flay: InsanityInsanity171.19684.0227.99%4.000.750.11%
Mind SpikeInsanity11.6046.401.90%4.000.000.00%
Shadow CrashInsanity9.70145.475.95%15.000.000.00%
Vampiric TouchInsanity0.000.000.00%4.000.000.00%
Usage Type Count Total Avg RPE APR
T29_Priest_Shadow
Devouring PlagueInsanity 54.562396.9143.9343.932378.40
HaloMana 5.4513625.852500.002500.0716.91
MindgamesMana 7.9839906.685000.005000.0016.91
Shadow Word: DeathMana 13.1916488.631250.001250.0036.80
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 350980.0 418.86 409.46 4089307.5 347268.0 138379.6 350980.0
Mana 49999.0 232.09 233.40 409820.0 49606.4 43616.6 49999.0
Insanity 15.0 8.14 7.99 12.3 46.6 5.0 100.0

Statistics & Data Analysis

Fight Length
T29_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
T29_Priest_Shadow Damage Per Second
Count 7499
Mean 74511.73
Minimum 67222.86
Maximum 86137.69
Spread ( max - min ) 18914.83
Range [ ( max - min ) / 2 * 100% ] 12.69%
Standard Deviation 2422.1850
5th Percentile 70690.90
95th Percentile 78702.06
( 95th Percentile - 5th Percentile ) 8011.16
Mean Distribution
Standard Deviation 27.9708
95.00% Confidence Interval ( 74456.91 - 74566.56 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4060
0.1 Scale Factor Error with Delta=300 50084
0.05 Scale Factor Error with Delta=300 200336
0.01 Scale Factor Error with Delta=300 5008392
Priority Target DPS
T29_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 74511.73
Minimum 67222.86
Maximum 86137.69
Spread ( max - min ) 18914.83
Range [ ( max - min ) / 2 * 100% ] 12.69%
Standard Deviation 2422.1850
5th Percentile 70690.90
95th Percentile 78702.06
( 95th Percentile - 5th Percentile ) 8011.16
Mean Distribution
Standard Deviation 27.9708
95.00% Confidence Interval ( 74456.91 - 74566.56 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4060
0.1 Scale Factor Error with Delta=300 50084
0.05 Scale Factor Error with Delta=300 200336
0.01 Scale Factor Error with Delta=300 5008392
DPS(e)
T29_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 74511.73
Minimum 67222.86
Maximum 86137.69
Spread ( max - min ) 18914.83
Range [ ( max - min ) / 2 * 100% ] 12.69%
Damage
T29_Priest_Shadow Damage
Count 7499
Mean 18359766.84
Minimum 13686623.12
Maximum 22793927.78
Spread ( max - min ) 9107304.66
Range [ ( max - min ) / 2 * 100% ] 24.80%
DTPS
T29_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 409.58
Minimum 12.69
Maximum 1856.40
Spread ( max - min ) 1843.71
Range [ ( max - min ) / 2 * 100% ] 225.08%
HPS
T29_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
T29_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
T29_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
T29_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 418.53
Minimum 12.69
Maximum 1750.51
Spread ( max - min ) 1737.81
Range [ ( max - min ) / 2 * 100% ] 207.61%
TMI
T29_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
T29_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
T29_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 arcane_torrent
7 0.00 use_item,name=shadowed_orb_of_torment
8 0.00 variable,name=mind_sear_cutoff,op=set,value=2
9 0.00 shadow_crash,if=talent.shadow_crash.enabled
A 0.00 mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
B 0.00 vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled
Default action list Executed every time the actor is available.
# count action,conditions
C 1.40 potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
0.00 variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
0.00 variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
0.00 variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
0.00 variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
0.00 variable,name=is_vt_possible,op=set,value=0,default=1
0.00 variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
0.00 variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
0.00 variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
0.00 variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
0.00 fireblood,if=buff.power_infusion.up|fight_remains<=8
0.00 berserking,if=buff.power_infusion.up|fight_remains<=12
D 2.94 blood_fury,if=buff.power_infusion.up|fight_remains<=15
0.00 ancestral_call,if=buff.power_infusion.up|fight_remains<=15
0.00 variable,name=pool_amount,op=set,value=60
E 0.00 run_action_list,name=main
actions.cds
# count action,conditions
F 2.92 power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
0.00 void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
G 5.34 dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
H 0.00 call_action_list,name=trinkets
I 5.45 mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
J 0.20 desperate_prayer,if=health.pct<=75
actions.main
# count action,conditions
K 0.00 call_action_list,name=cds
0.00 mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
L 3.76 shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
M 5.12 mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
0.00 damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
0.00 void_bolt,if=variable.dots_up&insanity<=85
0.00 mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
0.00 mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
N 54.56 devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
O 9.43 shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
P 0.00 vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
0.00 shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
Q 61.46 mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
R 8.01 mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
S 8.70 shadow_crash,if=raid_event.adds.in>10
0.00 dark_void,if=raid_event.adds.in>20
0.00 devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
0.00 void_torrent,if=insanity<=35,target_if=variable.dots_up
T 1.39 mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
0.00 vampiric_touch,if=buff.unfurling_darkness.up
U 43.60 mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
V 5.47 halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
0.00 divine_star,if=spell_targets.divine_star>1
Use when it will hit at least 2 targets.
0.00 lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
W 11.60 mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
X 7.59 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
0.00 shadow_crash,if=raid_event.adds.in>30
Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
0.00 shadow_word_death,target_if=target.health.pct<20
Use Shadow Word: Death while moving as a low-priority action in execute
0.00 divine_star
Use Divine Star while moving as a low-priority action
0.00 shadow_word_death
Use Shadow Word: Death while moving as a low-priority action
0.00 shadow_word_pain
Use Shadow Word: Pain while moving as a low-priority action
actions.trinkets
# count action,conditions
0.00 use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
0.00 use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
0.00 use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
0.00 use_item,name=architects_ingenuity_core
Use this on CD for max CDR
Y 2.92 use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10
Default fallback for usable items: Use on cooldown in order by trinket slot.

Sample Sequence

012589IMGCFDYNOQRNQUVWQNUWWQNUWQNUWXQNQUQQSNUQWRNUQTXNNQUVNQQUNQUIGNOQQNSUNQRUNQUNULNQUQNUVWQSXNQQUNUQRXNQIOGFDYMNQUWNQSUNQQUNUQOQNUQVNRUQNUWWQSXNQQUXNQQUIONQGQNQRUNQSUNUONQUQNUNUQVWXNQUSQNQRUNQUNILLQNGFDYNQUXNQUSNQUQLLNQQUNQRUNUQVXNOOQSUQNUQQW

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask T29_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity
Pre precombat 1 food T29_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 2 augmentation T29_Priest_Shadow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 5 shadowform Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 8 mind_sear_cutoff Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 static_empowerment
Pre precombat 9 shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
0.0/100: 0% insanity		 static_empowerment
0:00.000 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity		 bloodlust, static_empowerment
0:00.903 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity		 bloodlust, coalescing_shadows, static_empowerment
0:01.806 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity		 bloodlust, mind_devourer, coalescing_shadows_dot, gathering_shadows, static_empowerment(2)
0:02.710 default C potion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity		 bloodlust, ancient_madness(20), mind_devourer, coalescing_shadows, coalescing_shadows_dot, dark_ascension, gathering_shadows, static_empowerment(3)
0:02.710 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity		 bloodlust, ancient_madness(20), mind_devourer, coalescing_shadows, coalescing_shadows_dot, dark_ascension, gathering_shadows, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.710 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity		 bloodlust, power_infusion, ancient_madness(20), mind_devourer, coalescing_shadows, coalescing_shadows_dot, dark_ascension, gathering_shadows, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.710 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(20), mind_devourer, coalescing_shadows, coalescing_shadows_dot, dark_ascension, gathering_shadows, static_empowerment(3), elemental_potion_of_ultimate_power
0:02.710 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(20), mind_devourer, coalescing_shadows, coalescing_shadows_dot, dark_ascension, gathering_shadows, valarjars_path, static_empowerment(3), elemental_potion_of_ultimate_power
0:03.465 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
60.0/100: 60% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(20), mental_fortitude, coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, static_empowerment(4), elemental_potion_of_ultimate_power
0:04.218 main Q mind_blast Fluffy_Pillow 49953.8/49999: 100% mana
63.0/100: 63% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(19), mental_fortitude, coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:04.973 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
72.0/100: 72% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(18), mental_fortitude, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.727 main N devouring_plague Fluffy_Pillow 45098.2/49999: 90% mana
78.0/100: 78% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(17), mental_fortitude, coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:06.483 main Q mind_blast Fluffy_Pillow 46307.8/49999: 93% mana
31.0/100: 31% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(17), surge_of_darkness, mental_fortitude, coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.238 main U mind_flay Fluffy_Pillow 47515.8/49999: 95% mana
40.0/100: 40% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(16), surge_of_darkness, mental_fortitude, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.628 main V halo Fluffy_Pillow 49739.8/49999: 99% mana
62.0/100: 62% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(15), surge_of_darkness, mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.383 main W mind_spike Fluffy_Pillow 47599.8/49999: 95% mana
65.0/100: 65% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(14), surge_of_darkness(2), mental_fortitude, dark_evangelism(4), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.139 main Q mind_blast Fluffy_Pillow 48809.4/49999: 98% mana
72.0/100: 72% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(13), surge_of_darkness(2), mental_fortitude, dark_evangelism(4), coalescing_shadows, coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.071 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(12), surge_of_darkness(3), mental_fortitude, dark_evangelism(4), coalescing_shadows_dot, dark_ascension, gathering_shadows(2), dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.825 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(11), surge_of_darkness(3), mental_fortitude, dark_evangelism(4), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.214 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(10), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, dark_reveries, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.969 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(9), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.725 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(8), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:15.480 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(8), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.234 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(7), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.623 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 bloodlust, blood_fury, power_infusion, ancient_madness(6), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.377 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity		 bloodlust, power_infusion, ancient_madness(5), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.378 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity		 bloodlust, power_infusion, ancient_madness(4), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.132 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity		 bloodlust, power_infusion, ancient_madness(3), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:21.520 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity		 bloodlust, power_infusion, ancient_madness(2), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.275 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 bloodlust, power_infusion, ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.357 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
74.0/100: 74% insanity		 bloodlust, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_reveries, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.227 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
80.0/100: 80% insanity		 bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_flame, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.097 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity		 bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_flame, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.967 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity		 bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, elemental_lariat__empowered_flame, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:28.700 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity		 bloodlust, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_flame, valarjars_path, sophic_devotion, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.569 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, elemental_lariat__empowered_flame, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:30.440 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity		 bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(3), dark_reveries, elemental_lariat__empowered_flame, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:31.312 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
79.0/100: 79% insanity		 bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(3), dark_reveries, elemental_lariat__empowered_flame, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:32.180 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
29.0/100: 29% insanity		 bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_flame, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:33.911 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity		 bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_reveries, elemental_lariat__empowered_flame, static_empowerment(5)
0:34.779 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity		 bloodlust, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_flame, static_empowerment(5)
0:35.649 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity		 bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_flame, static_empowerment(5)
0:36.534 main N devouring_plague Fluffy_Pillow 45005.4/49999: 90% mana
57.0/100: 57% insanity		 bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
0:37.403 main U mind_flay Fluffy_Pillow 46395.8/49999: 93% mana
10.0/100: 10% insanity		 bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
0:39.135 main Q mind_blast Fluffy_Pillow 49167.0/49999: 98% mana
27.0/100: 27% insanity		 bloodlust, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_reveries, static_empowerment(5)
0:40.006 main T mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity		 mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
0:41.136 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity		 mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, static_empowerment(5)
0:44.512 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity		 mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows(2), dark_reveries, static_empowerment(5)
0:45.641 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
0:46.770 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
0:47.899 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, static_empowerment(5)
0:50.152 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
0:51.280 main N devouring_plague Fluffy_Pillow 47505.4/49999: 95% mana
73.0/100: 73% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
0:52.408 main Q mind_blast Fluffy_Pillow 49310.2/49999: 99% mana
25.0/100: 25% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
0:53.536 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, static_empowerment(5)
0:54.664 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity		 mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows(2), dark_reveries, static_empowerment(5)
0:56.915 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity		 surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, static_empowerment(5)
0:58.043 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
0:59.256 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, static_empowerment(5)
1:01.508 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
91.0/100: 91% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
1:02.637 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
96.0/100: 96% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
1:03.835 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
100.0/100: 100% insanity		 ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, static_empowerment(5)
1:04.962 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 ancient_madness(19), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, static_empowerment(5)
1:06.090 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity		 ancient_madness(18), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, static_empowerment(5)
1:07.218 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
75.0/100: 75% insanity		 ancient_madness(17), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, static_empowerment(5)
1:08.347 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
86.0/100: 86% insanity		 ancient_madness(16), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows(2), dark_reveries, sophic_devotion, static_empowerment(5)
1:09.476 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity		 ancient_madness(15), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, sophic_devotion, static_empowerment(5)
1:10.605 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 ancient_madness(14), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, sophic_devotion, static_empowerment(5)
1:12.856 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
88.0/100: 88% insanity		 ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, dark_reveries, sophic_devotion, static_empowerment(5)
1:13.987 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity		 ancient_madness(10), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, sophic_devotion, static_empowerment(5)
1:15.115 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity		 ancient_madness(9), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
1:16.242 main U mind_flay Fluffy_Pillow 45003.8/49999: 90% mana
61.0/100: 61% insanity		 ancient_madness(8), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
1:18.493 main N devouring_plague Fluffy_Pillow 48605.4/49999: 97% mana
89.0/100: 89% insanity		 ancient_madness(6), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
1:19.622 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity		 ancient_madness(5), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, sophic_devotion, static_empowerment(5)
1:20.751 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity		 ancient_madness(4), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
1:23.003 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
84.0/100: 84% insanity		 ancient_madness, surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
1:24.130 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity		 surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, sophic_devotion, static_empowerment(5)
1:26.385 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
66.0/100: 66% insanity		 surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_reveries, sophic_devotion, static_empowerment(5)
1:27.512 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
71.0/100: 71% insanity		 surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_reveries, sophic_devotion, static_empowerment(5)
1:28.639 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity		 surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, sophic_devotion, static_empowerment(5)
1:29.766 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
1:32.019 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
1:33.148 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, sophic_devotion, static_empowerment(5)
1:34.276 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, sophic_devotion, static_empowerment(5)
1:36.526 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_reveries, sophic_devotion, static_empowerment(5)
1:37.655 main W mind_spike Fluffy_Pillow 47507.0/49999: 95% mana
21.0/100: 21% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_reveries, static_empowerment(5)
1:38.785 main Q mind_blast Fluffy_Pillow 49315.0/49999: 99% mana
25.0/100: 25% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_reveries, static_empowerment(5)
1:39.914 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
1:41.041 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
1:44.416 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
65.0/100: 65% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows, static_empowerment(5)
1:45.590 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity		 surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
1:46.720 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
1:47.846 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows(2), dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
1:50.097 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
56.0/100: 56% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
1:51.225 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
1:53.477 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
1:54.606 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
1:55.734 main X mind_flay Fluffy_Pillow 45005.4/49999: 90% mana
42.0/100: 42% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
1:59.113 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity		 surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, gathering_shadows, static_empowerment(5)
2:00.288 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity		 surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
2:01.418 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
20.0/100: 20% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, static_empowerment(5)
2:02.635 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, static_empowerment(5)
2:03.763 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, static_empowerment(5)
2:04.957 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity		 ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, static_empowerment(5)
2:04.957 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity		 power_infusion, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, static_empowerment(5)
2:04.957 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity		 blood_fury, power_infusion, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, static_empowerment(5)
2:04.957 main M mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
68.0/100: 68% insanity		 blood_fury, power_infusion, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
2:05.860 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
76.0/100: 76% insanity		 blood_fury, power_infusion, ancient_madness(20), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows(2), dark_reveries, valarjars_path, static_empowerment(5)
2:06.763 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity		 blood_fury, power_infusion, ancient_madness(19), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, static_empowerment(5)
2:07.665 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity		 blood_fury, power_infusion, ancient_madness(18), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
2:09.466 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity		 blood_fury, power_infusion, ancient_madness(16), surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
2:10.370 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
77.0/100: 77% insanity		 blood_fury, power_infusion, ancient_madness(15), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
2:11.275 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity		 blood_fury, power_infusion, ancient_madness(14), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, static_empowerment(5)
2:12.178 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
43.0/100: 43% insanity		 blood_fury, power_infusion, ancient_madness(13), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:13.082 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
63.0/100: 63% insanity		 blood_fury, power_infusion, ancient_madness(12), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:14.883 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
85.0/100: 85% insanity		 blood_fury, power_infusion, ancient_madness(11), surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:15.786 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
38.0/100: 38% insanity		 blood_fury, power_infusion, ancient_madness(10), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:16.688 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity		 blood_fury, power_infusion, ancient_madness(9), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:17.590 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 blood_fury, power_infusion, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows(2), dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:19.390 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
81.0/100: 81% insanity		 blood_fury, power_infusion, ancient_madness(6), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows(2), dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:20.292 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
34.0/100: 34% insanity		 power_infusion, ancient_madness(5), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:22.092 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity		 power_infusion, ancient_madness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:22.995 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
67.0/100: 67% insanity		 power_infusion, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:23.898 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity		 power_infusion, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
2:24.801 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
79.0/100: 79% insanity		 power_infusion, ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_ascension, gathering_shadows(2), dark_reveries, valarjars_path, static_empowerment(5)
2:25.705 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_reveries, valarjars_path, static_empowerment(5)
2:27.957 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
57.0/100: 57% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_reveries, valarjars_path, static_empowerment(5)
2:29.206 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
2:30.335 main N devouring_plague Fluffy_Pillow 47507.0/49999: 95% mana
73.0/100: 73% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
2:31.464 main R mindgames Fluffy_Pillow 49313.4/49999: 99% mana
26.0/100: 26% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, valarjars_path, static_empowerment(5)
2:32.592 main U mind_flay Fluffy_Pillow 45005.4/49999: 90% mana
27.0/100: 27% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_air, valarjars_path, static_empowerment(5)
2:34.788 main Q mind_blast Fluffy_Pillow 48519.0/49999: 97% mana
43.0/100: 43% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_reveries, elemental_lariat__empowered_air, valarjars_path, static_empowerment(5)
2:35.889 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_air, static_empowerment(5)
2:36.991 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
1.0/100: 1% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_air, static_empowerment(5)
2:39.188 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
17.0/100: 17% insanity		 surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_reveries, elemental_lariat__empowered_air, static_empowerment(5)
2:40.288 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
22.0/100: 22% insanity		 surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_reveries, elemental_lariat__empowered_air, static_empowerment(5)
2:41.391 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, dark_reveries, elemental_lariat__empowered_air, static_empowerment(5)
2:42.494 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_air, static_empowerment(5)
2:43.596 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_air, static_empowerment(5)
2:46.888 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows, static_empowerment(5)
2:48.059 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
12.0/100: 12% insanity		 shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
2:49.187 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, static_empowerment(5)
2:50.314 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows(2), dark_reveries, static_empowerment(5)
2:52.567 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity		 mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, static_empowerment(5)
2:55.944 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity		 surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows(2), static_empowerment(5)
2:57.118 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
6.0/100: 6% insanity		 surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
2:58.247 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
15.0/100: 15% insanity		 surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, static_empowerment(5)
2:59.375 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity		 surge_of_darkness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows(2), dark_reveries, static_empowerment(5)
3:01.628 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity		 surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows(2), dark_reveries, sophic_devotion, static_empowerment(5)
3:02.758 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
49.0/100: 49% insanity		 surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, sophic_devotion, static_empowerment(5)
3:03.886 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
54.0/100: 54% insanity		 surge_of_darkness(2), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, sophic_devotion, static_empowerment(5)
3:05.015 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
11.0/100: 11% insanity		 surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, sophic_devotion, static_empowerment(5)
3:06.143 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity		 surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
3:07.271 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
59.0/100: 59% insanity		 ancient_madness(20), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
3:08.400 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity		 ancient_madness(19), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows(2), dark_reveries, sophic_devotion, static_empowerment(5)
3:09.529 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity		 ancient_madness(18), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, sophic_devotion, static_empowerment(5)
3:10.658 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity		 ancient_madness(17), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_flame, sophic_devotion, static_empowerment(5)
3:11.785 main U mind_flay Fluffy_Pillow 45003.8/49999: 90% mana
42.0/100: 42% insanity		 ancient_madness(16), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, elemental_lariat__empowered_flame, sophic_devotion, static_empowerment(5)
3:14.037 main N devouring_plague Fluffy_Pillow 48607.0/49999: 97% mana
65.0/100: 65% insanity		 ancient_madness(14), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, elemental_lariat__empowered_flame, sophic_devotion, static_empowerment(5)
3:15.167 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
19.0/100: 19% insanity		 twist_of_fate, ancient_madness(13), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, elemental_lariat__empowered_flame, sophic_devotion, static_empowerment(5)
3:16.303 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
28.0/100: 28% insanity		 twist_of_fate, ancient_madness(11), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, elemental_lariat__empowered_flame, sophic_devotion, static_empowerment(5)
3:17.431 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity		 twist_of_fate, ancient_madness(10), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, elemental_lariat__empowered_flame, static_empowerment(5)
3:19.682 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
70.0/100: 70% insanity		 twist_of_fate, ancient_madness(8), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, elemental_lariat__empowered_flame, static_empowerment(5)
3:20.814 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity		 twist_of_fate, ancient_madness(7), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, elemental_lariat__empowered_flame, static_empowerment(5)
3:23.068 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity		 twist_of_fate, ancient_madness(5), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
3:24.195 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
50.0/100: 50% insanity		 twist_of_fate, ancient_madness(4), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, dark_reveries, static_empowerment(5)
3:25.323 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
3.0/100: 3% insanity		 twist_of_fate, ancient_madness(2), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, static_empowerment(5)
3:26.452 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity		 twist_of_fate, ancient_madness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, static_empowerment(5)
3:28.706 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
3:29.835 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity		 twist_of_fate, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, static_empowerment(5)
3:30.965 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
3:33.216 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
58.0/100: 58% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_reveries, static_empowerment(5)
3:34.343 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
9.0/100: 9% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
3:36.596 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_reveries, static_empowerment(5)
3:37.725 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
32.0/100: 32% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
3:38.852 main W mind_spike Fluffy_Pillow 47503.8/49999: 95% mana
32.0/100: 32% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
3:39.981 main X mind_flay Fluffy_Pillow 49310.2/49999: 99% mana
38.0/100: 38% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, static_empowerment(5)
3:43.358 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows, static_empowerment(5)
3:44.532 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
1.0/100: 1% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_reveries, static_empowerment(5)
3:45.660 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
7.0/100: 7% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
3:47.912 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
24.0/100: 24% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
3:49.041 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
3:50.170 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity		 twist_of_fate, surge_of_darkness, mind_devourer, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, sophic_devotion, static_empowerment(5)
3:51.300 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
45.0/100: 45% insanity		 twist_of_fate, surge_of_darkness, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, sophic_devotion, static_empowerment(5)
3:52.428 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
3:53.556 main U mind_flay Fluffy_Pillow 45005.4/49999: 90% mana
52.0/100: 52% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, sophic_devotion, static_empowerment(5)
3:55.809 main N devouring_plague Fluffy_Pillow 48610.2/49999: 97% mana
71.0/100: 71% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, sophic_devotion, static_empowerment(5)
3:56.937 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_earth, sophic_devotion, static_empowerment(5)
3:58.065 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
31.0/100: 31% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, sophic_devotion, static_empowerment(5)
4:00.317 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity		 twist_of_fate, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, sophic_devotion, static_empowerment(5)
4:01.446 cds I mindbender Fluffy_Pillow 49999.0/49999: 100% mana
8.0/100: 8% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
4:02.756 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
13.0/100: 13% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
4:03.882 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
18.0/100: 18% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
4:05.011 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
23.0/100: 23% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
4:06.141 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
37.0/100: 37% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, mind_devourer, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
4:07.269 cds G dark_ascension Fluffy_Pillow 49999.0/49999: 100% mana
42.0/100: 42% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
4:08.397 cds F power_infusion Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity		 twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
4:08.397 default D blood_fury Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity		 power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
4:08.397 trinkets Y use_items Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, static_empowerment(5)
4:08.397 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
78.0/100: 78% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
4:09.300 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
30.0/100: 30% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(20), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
4:10.205 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(19), surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
4:12.004 main X mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
62.0/100: 62% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(17), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
4:14.703 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
83.0/100: 83% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(14), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
4:15.606 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
36.0/100: 36% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(13), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, elemental_lariat__empowered_earth, valarjars_path, static_empowerment(5)
4:16.509 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
47.0/100: 47% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(12), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
4:18.309 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
69.0/100: 69% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(11), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
4:19.210 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
88.0/100: 88% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(10), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
4:20.112 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(9), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, static_empowerment(5)
4:21.015 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
51.0/100: 51% insanity		 blood_fury, power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(8), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
4:22.814 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
73.0/100: 73% insanity		 blood_fury, power_infusion, twist_of_fate, ancient_madness(6), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
4:23.718 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
82.0/100: 82% insanity		 power_infusion, twist_of_fate, ancient_madness(5), surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, dark_ascension, gathering_shadows(2), dark_reveries, valarjars_path, static_empowerment(5)
4:24.786 main L shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
89.0/100: 89% insanity		 power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(4), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows(2), dark_reveries, valarjars_path, static_empowerment(5)
4:25.688 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
92.0/100: 92% insanity		 power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(3), surge_of_darkness(3), shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_ascension, gathering_shadows(2), dark_reveries, valarjars_path, static_empowerment(5)
4:26.592 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
46.0/100: 46% insanity		 power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness(2), surge_of_darkness(3), shadowy_insight, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_ascension, dark_reveries, valarjars_path, static_empowerment(5)
4:27.496 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
55.0/100: 55% insanity		 power_infusion, twist_of_fate, death_and_madness_reset, ancient_madness, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, mind_flay_insanity, dark_ascension, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
4:28.400 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
64.0/100: 64% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows(2), dark_reveries, valarjars_path, static_empowerment(5)
4:30.651 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
87.0/100: 87% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, valarjars_path, static_empowerment(5)
4:31.781 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
41.0/100: 41% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, valarjars_path, static_empowerment(5)
4:32.909 main R mindgames Fluffy_Pillow 49999.0/49999: 100% mana
48.0/100: 48% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, valarjars_path, static_empowerment(5)
4:34.039 main U mind_flay Fluffy_Pillow 45008.6/49999: 90% mana
48.0/100: 48% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, elemental_lariat__empowered_air, valarjars_path, static_empowerment(5)
4:36.236 main N devouring_plague Fluffy_Pillow 48523.8/49999: 97% mana
65.0/100: 65% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_air, valarjars_path, static_empowerment(5)
4:37.338 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
16.0/100: 16% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness(3), mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, elemental_lariat__empowered_air, valarjars_path, static_empowerment(5)
4:39.536 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
33.0/100: 33% insanity		 twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, dark_reveries, elemental_lariat__empowered_air, sophic_devotion, static_empowerment(5)
4:40.637 main V halo Fluffy_Pillow 49999.0/49999: 100% mana
39.0/100: 39% insanity		 twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_air, sophic_devotion, static_empowerment(5)
4:41.737 main X mind_flay Fluffy_Pillow 47503.8/49999: 95% mana
40.0/100: 40% insanity		 twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, elemental_lariat__empowered_air, sophic_devotion, static_empowerment(5)
4:45.029 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
53.0/100: 53% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, gathering_shadows, elemental_lariat__empowered_air, sophic_devotion, static_empowerment(5)
4:46.175 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
3.0/100: 3% insanity		 twist_of_fate, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, sophic_devotion, static_empowerment(5)
4:47.304 main O shadow_word_death Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, sophic_devotion, static_empowerment(5)
4:48.434 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
4.0/100: 4% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows(3), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, sophic_devotion, static_empowerment(5)
4:49.560 main S shadow_crash Fluffy_Pillow 49999.0/49999: 100% mana
10.0/100: 10% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
4:50.687 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
26.0/100: 26% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
4:52.941 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows, coalescing_shadows_dot, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
4:54.068 main N devouring_plague Fluffy_Pillow 49999.0/49999: 100% mana
52.0/100: 52% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(2), sophic_devotion, static_empowerment(5)
4:55.241 main U mind_flay Fluffy_Pillow 49999.0/49999: 100% mana
5.0/100: 5% insanity		 twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, mind_flay_insanity, dark_reveries, sophic_devotion, static_empowerment(5)
4:57.493 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
27.0/100: 27% insanity		 twist_of_fate, death_and_madness_reset, shadowy_insight, mental_fortitude, dark_evangelism(5), coalescing_shadows(2), coalescing_shadows_dot, dark_reveries, sophic_devotion, static_empowerment(5)
4:58.621 main Q mind_blast Fluffy_Pillow 49999.0/49999: 100% mana
35.0/100: 35% insanity		 twist_of_fate, death_and_madness_reset, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows, dark_reveries, sophic_devotion, static_empowerment(5)
4:59.750 main W mind_spike Fluffy_Pillow 49999.0/49999: 100% mana
44.0/100: 44% insanity		 twist_of_fate, death_and_madness_reset, surge_of_darkness, mental_fortitude, dark_evangelism(5), coalescing_shadows_dot, gathering_shadows(2), dark_reveries, sophic_devotion, static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1212 3 1301 1215 0
Agility 1734 -3 1817 1731 0
Stamina 3463 1 17549 16714 13250
Intellect 2089 -1 9934 9162 6638 (280)
Spirit 0 0 0 0 0
Health 350980 334280 0
Mana 49999 49999 0
Insanity 100 100 0
Spell Power 9934 9162 0
Crit 9.06% 9.06% 731
Haste 28.21% 28.21% 4795
Versatility 6.98% 3.98% 816
Mana Regen 1600 1600 0
Mastery 19.02% 19.02% 5407
Armor 2034 2034 2034
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 421.00
Local Head Draconic Hierophant's Archcowl
ilevel: 424, stats: { 249 Armor, +512 Int, +1383 Sta, +244 Haste, +542 Mastery }, gems: { +75 StrAgiInt, +66 Haste }
Local Neck Elemental Lariat
ilevel: 418, stats: { +722 Sta, +592 Mastery, +592 Haste }, gems: { +70 Haste, +33 Mastery, +62 Haste, +70 Haste, +33 Crit }
item effects: { equip: Elemental Lariat }
Local Shoulders Draconic Hierophant's Wisdom
ilevel: 424, stats: { 228 Armor, +384 Int, +1037 Sta, +179 Crit, +411 Haste }
Local Chest Arcanist's Resonant Robes
ilevel: 421, stats: { 326 Armor, +498 Int, +1333 Sta, +470 Haste, +304 Mastery }, enchant: { +150 StrAgiInt }
Local Waist Sky Saddle Cord
ilevel: 421, stats: { 183 Armor, +374 Int, +1000 Sta, +365 Haste, +216 Mastery }, gems: { +70 Haste, +33 Mastery }
Local Legs Draconic Hierophant's Britches
ilevel: 415, stats: { 274 Armor, +471 Int, +1237 Sta, +263 Vers, +489 Mastery }, enchant: { +177 Int, +105 Sta }
Local Feet Sandals of the Wild Sovereign
ilevel: 424, stats: { 207 Armor, +384 Int, +1037 Sta, +420 Haste, +169 Mastery }
Local Wrists Vibrant Wildercloth Wristwraps
ilevel: 418, stats: { 160 Armor, +272 Int, +722 Sta, +215 Mastery, +215 Haste }, gems: { +70 Haste, +33 Mastery }
item effects: { equip: Blue Silken Lining }
Local Hands Draconic Hierophant's Grips
ilevel: 421, stats: { 183 Armor, +374 Int, +1000 Sta, +174 Haste, +407 Mastery }
Local Finger1 Seal of Filial Duty
ilevel: 430, stats: { +841 Sta, +320 Haste, +967 Mastery }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Haste }
item effects: { equip: Broodkeeper's Barrier }
Local Finger2 Woe-Bearer's Band
ilevel: 421, stats: { +750 Sta, +519 Crit, +692 Mastery }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Haste }
Local Trinket1 Horn of Valor
ilevel: 421, stats: { +553 Vers }
item effects: { use: Valarjar's Path }
Local Trinket2 Furious Ragefeather
ilevel: 421, stats: { +473 Int }
item effects: { equip: Furious Ragefeather }
Local Back Fireproof Drape
ilevel: 421, stats: { 224 Armor, +750 Sta, +274 Haste, +162 Mastery, +280 StrAgiInt }
Local Main Hand Final Grade
ilevel: 421, weapon: { 573 - 777, 3.6 }, stats: { +498 Int, +1716 Int, +1333 Sta, +288 Haste, +487 Mastery }, enchant: sophic_devotion_3, temporary_enchant: Howling Rune

Talents

Talent Tables

RowPriest Talents [31]
1
2
3
4
5
6
7
8
9
10
RowShadow Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

priest="T29_Priest_Shadow"
source=default
spec=shadow
level=70
race=orc
role=spell
position=ranged_back
talents=BIQAAAAAAAAAAAAAAAAAAAAAAIk04ABAAAAAAAAAAAAQikkSESRLJRSJhEBpRSSiECSQIFpFSCA
class_talents=dispel_magic:1/improved_flash_heal:1/protective_light:1/angelic_feather:1/phantasm:1/death_and_madness:1/leap_of_faith:1/dominate_mind:1/mass_dispel:1/power_infusion:1/vampiric_embrace:1/tithe_evasion:1/improved_mass_dispel:1/body_and_soul:1/twins_of_the_sun_priestess:1/sanlayn:1/twist_of_fate:2/throes_of_pain:2/halo:1/translucent_image:1/mindgames:1/lights_inspiration:2/improved_fade:2/manipulation:2/angelic_bulwark:1/shattered_perceptions:1
spec_talents=devouring_plague:1/dispersion:1/shadowy_apparitions:1/silence:1/mental_fortitude:1/misery:1/coalescing_shadows:1/mind_spike:1/puppet_master:1/mental_decay:1/dark_ascension:1/surge_of_darkness:1/harnessed_shadows:1/shadowy_insight:1/ancient_madness:2/shadow_crash:1/dark_evangelism:2/auspicious_spirits:1/mindbender:1/mind_flay_insanity:1/encroaching_shadows:1/inescapable_torment:2/screams_of_the_void:2/mind_devourer:1/idol_of_yshaarj:1/idol_of_cthun:1

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic_augment_rune
temporary_enchant=main_hand:howling_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/fleshcraft,if=soulbind.pustule_eruption|soulbind.volatile_solvent
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/arcane_torrent
actions.precombat+=/use_item,name=shadowed_orb_of_torment
actions.precombat+=/variable,name=mind_sear_cutoff,op=set,value=2
actions.precombat+=/shadow_crash,if=talent.shadow_crash.enabled
actions.precombat+=/mind_blast,if=talent.damnation.enabled&!talent.shadow_crash.enabled
actions.precombat+=/vampiric_touch,if=!talent.damnation.enabled&!talent.shadow_crash.enabled

# Executed every time the actor is available.
actions=potion,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up
actions+=/variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions+=/variable,name=all_dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking&dot.devouring_plague.ticking
actions+=/variable,name=max_vts,op=set,default=1,value=spell_targets.vampiric_touch
actions+=/variable,name=max_vts,op=set,value=(spell_targets.mind_sear<=5)*spell_targets.mind_sear,if=buff.voidform.up
actions+=/variable,name=is_vt_possible,op=set,value=0,default=1
actions+=/variable,name=is_vt_possible,op=set,value=1,target_if=max:(target.time_to_die*dot.vampiric_touch.refreshable),if=target.time_to_die>=18
actions+=/variable,name=vts_applied,op=set,value=active_dot.vampiric_touch>=variable.max_vts|!variable.is_vt_possible
actions+=/variable,name=pool_for_cds,op=set,value=(cooldown.void_eruption.remains<=gcd.max*3&talent.void_eruption|cooldown.dark_ascension.up&talent.dark_ascension)
actions+=/variable,name=dp_cutoff,op=set,value=!talent.mind_sear|(spell_targets.mind_sear<=variable.mind_sear_cutoff&(!buff.mind_devourer.up|spell_targets.mind_sear=1))
actions+=/fireblood,if=buff.power_infusion.up|fight_remains<=8
actions+=/berserking,if=buff.power_infusion.up|fight_remains<=12
actions+=/blood_fury,if=buff.power_infusion.up|fight_remains<=15
actions+=/ancestral_call,if=buff.power_infusion.up|fight_remains<=15
actions+=/variable,name=pool_amount,op=set,value=60
actions+=/run_action_list,name=main

actions.cds=power_infusion,if=(buff.voidform.up|buff.dark_ascension.up)
actions.cds+=/void_eruption,if=!cooldown.fiend.up&(pet.fiend.active|!talent.mindbender)&(cooldown.mind_blast.charges=0|time>15|buff.shadowy_insight.up&cooldown.mind_blast.charges=buff.shadowy_insight.stack)
actions.cds+=/dark_ascension,if=pet.fiend.active&cooldown.mind_blast.charges<2|!talent.mindbender&!cooldown.fiend.up&cooldown.fiend.remains>=15
actions.cds+=/call_action_list,name=trinkets
actions.cds+=/mindbender,if=(dot.shadow_word_pain.ticking&variable.vts_applied|action.shadow_crash.in_flight)
actions.cds+=/desperate_prayer,if=health.pct<=75

actions.main=call_action_list,name=cds
# Use Mind Blast when capped on charges and talented into Mind Devourer to fish for the buff. Only use when facing 3-7 targets.
actions.main+=/mind_blast,if=cooldown.mind_blast.charges>=2&talent.mind_devourer&spell_targets.mind_sear>=3&spell_targets.mind_sear<=7&!buff.mind_devourer.up
actions.main+=/shadow_word_death,if=pet.fiend.active&talent.inescapable_torment&(pet.fiend.remains<=gcd|target.health.pct<20)&spell_targets.mind_sear<=7
actions.main+=/mind_blast,if=(cooldown.mind_blast.full_recharge_time<=gcd.max|pet.fiend.remains<=cast_time+gcd.max)&pet.fiend.active&talent.inescapable_torment&pet.fiend.remains>cast_time&spell_targets.mind_sear<=7
actions.main+=/damnation,target_if=dot.vampiric_touch.refreshable&variable.is_vt_possible|dot.shadow_word_pain.refreshable
actions.main+=/void_bolt,if=variable.dots_up&insanity<=85
# Use Mind Devourer Procs on Mind Sear when facing 2 or more targets or Voidform is active.
actions.main+=/mind_sear,target_if=(spell_targets.mind_sear>1|buff.voidform.up)&buff.mind_devourer.up
# Use Mind Sear on 3+ targets and either you have at least 75 insanity, 4pc buff is inactive, or 2pc buff is at 3 stacks.
actions.main+=/mind_sear,target_if=spell_targets.mind_sear>variable.mind_sear_cutoff&(insanity>=75|((!set_bonus.tier29_4pc&!set_bonus.tier29_2pc)|!buff.dark_reveries.up)|(!set_bonus.tier29_2pc|buff.gathering_shadows.stack=3)),chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
actions.main+=/devouring_plague,if=(refreshable&!variable.pool_for_cds|insanity>75|talent.void_torrent&cooldown.void_torrent.remains<=3*gcd|buff.mind_devourer.up&cooldown.mind_blast.full_recharge_time<=2*gcd.max&!cooldown.void_eruption.up&talent.void_eruption)&variable.dp_cutoff
actions.main+=/shadow_word_death,target_if=(target.health.pct<20&spell_targets.mind_sear<4)&(!talent.inescapable_torment|cooldown.fiend.remains>=10)|(pet.fiend.active&talent.inescapable_torment&spell_targets.mind_sear<=7)|buff.deathspeaker.up&(cooldown.fiend.remains+gcd.max)>buff.deathspeaker.remains
actions.main+=/vampiric_touch,target_if=(refreshable&target.time_to_die>=18&(dot.vampiric_touch.ticking|!variable.vts_applied)&variable.max_vts>0|(talent.misery.enabled&dot.shadow_word_pain.refreshable))&cooldown.shadow_crash.remains>=dot.vampiric_touch.remains&!action.shadow_crash.in_flight
actions.main+=/shadow_word_pain,target_if=refreshable&target.time_to_die>=18&!talent.misery.enabled
actions.main+=/mind_blast,if=variable.vts_applied&(!buff.mind_devourer.up|cooldown.void_eruption.up&talent.void_eruption)
actions.main+=/mindgames,if=spell_targets.mind_sear<5&variable.all_dots_up
actions.main+=/shadow_crash,if=raid_event.adds.in>10
actions.main+=/dark_void,if=raid_event.adds.in>20
actions.main+=/devouring_plague,if=buff.voidform.up&variable.dots_up&variable.dp_cutoff
actions.main+=/void_torrent,if=insanity<=35,target_if=variable.dots_up
actions.main+=/mind_blast,if=raid_event.movement.in>cast_time+0.5&(!talent.inescapable_torment|!cooldown.fiend.up&talent.inescapable_torment|variable.vts_applied)
actions.main+=/vampiric_touch,if=buff.unfurling_darkness.up
actions.main+=/mind_flay,if=buff.mind_flay_insanity.up&variable.dots_up&(!buff.surge_of_darkness.up|talent.screams_of_the_void)
# Use Halo if all DoTS are active and you are not in Voidform or it will hit at least 2 targets. Save up to 20s if adds are coming soon.
actions.main+=/halo,if=raid_event.adds.in>20&(spell_targets.halo>1|(variable.all_dots_up&!buff.voidform.up))
# Use when it will hit at least 2 targets.
actions.main+=/divine_star,if=spell_targets.divine_star>1
actions.main+=/lights_judgment,if=!raid_event.adds.exists|raid_event.adds.in>75
actions.main+=/mind_spike,if=buff.surge_of_darkness.up|(!talent.mental_decay|dot.vampiric_touch.remains>=(cooldown.shadow_crash.remains+action.shadow_crash.travel_time))&(talent.mind_melt|!talent.idol_of_cthun)
actions.main+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2
# Use Shadow Crash while moving as a low-priority action when adds will not come in 30 seconds.
actions.main+=/shadow_crash,if=raid_event.adds.in>30
# Use Shadow Word: Death while moving as a low-priority action in execute
actions.main+=/shadow_word_death,target_if=target.health.pct<20
# Use Divine Star while moving as a low-priority action
actions.main+=/divine_star
# Use Shadow Word: Death while moving as a low-priority action
actions.main+=/shadow_word_death
# Use Shadow Word: Pain while moving as a low-priority action
actions.main+=/shadow_word_pain

actions.trinkets=use_item,name=scars_of_fraternal_strife,if=(!buff.scars_of_fraternal_strife_4.up&time>1)|(buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10)
actions.trinkets+=/use_item,name=macabre_sheet_music,if=cooldown.void_eruption.remains>10|cooldown.dark_ascension.remains>10
actions.trinkets+=/use_item,name=soulletting_ruby,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10,target_if=min:target.health.pct
# Use this on CD for max CDR
actions.trinkets+=/use_item,name=architects_ingenuity_core
# Default fallback for usable items: Use on cooldown in order by trinket slot.
actions.trinkets+=/use_items,if=buff.voidform.up|buff.power_infusion.up|buff.dark_ascension.up|cooldown.void_eruption.remains>10

head=draconic_hierophants_archcowl,id=200327,bonus_id=4800/4786/1498,gem_id=192985
neck=elemental_lariat,id=193001,bonus_id=1540/8793/6652/7936/7979/8767/8782,gem_id=192948/192953/192945
shoulders=draconic_hierophants_wisdom,id=200329,bonus_id=4800/4786/1498
back=fireproof_drape,id=193763,bonus_id=6808/4786/1643
chest=arcanists_resonant_robes,id=134415,bonus_id=1795/6808/4786/3300/6935,enchant=waking_stats_3
wrists=vibrant_wildercloth_wristwraps,id=193510,bonus_id=8836/8840/8902/8802/8793/8932,ilevel=418,gem_id=192948
hands=draconic_hierophants_grips,id=200326,bonus_id=4800/4786/1498
waist=sky_saddle_cord,id=193691,bonus_id=6808/4786/1643,gem_id=192948
legs=draconic_hierophants_britches,id=200328,bonus_id=4800/4786/1498,enchant=frozen_spellthread_3
feet=sandals_of_the_wild_sovereign,id=195532,bonus_id=4800/4786/1498
finger1=seal_of_filial_duty,id=195526,bonus_id=4800/4786/1497/6935,gem_id=192948,enchant_id=6556
finger2=woebearers_band,id=133638,bonus_id=1795/6808/4786/3300/6935,gem_id=192948,enchant_id=6556
trinket1=horn_of_valor,id=133642,bonus_id=1795/6808/4786/3300/6935
trinket2=furious_ragefeather,id=193677,bonus_id=6808/4786/1643
main_hand=final_grade,id=193707,bonus_id=6808/4786/1643,enchant=sophic_devotion_3

# Gear Summary
# gear_ilvl=421.40
# gear_stamina=13250
# gear_intellect=6638
# gear_crit_rating=731
# gear_haste_rating=4795
# gear_mastery_rating=5407
# gear_versatility_rating=816
# gear_armor=2034
# set_bonus=tier29_2pc=1
# set_bonus=tier29_4pc=1

T29_Shaman_Elemental : 85564 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
85563.7 85563.7 95.0 / 0.111% 16405.8 / 19.2% 474.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
177.2 176.7 Mana 0.00% 43.2 100.0% 100%
TalentBYQAAAAAAAAAAAAAAAAAAAAAAAAAAAAgUiikAQSJJFKhDIJJRAAAAAAAAIABAEUCQAB
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T29_Shaman_Elemental 85564
Ascendance (_dre) 0 (3185) 0.0% (3.7%) 7.9 32.62sec 121588 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.86 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114050
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114050
  • name:Ascendance
  • school:fire
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.{$?=}{$=}w4>0[ Haste increased by {$=}w4%][].
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance. When you transform into the Flame Ascendant, instantly cast a Lava Burst at all enemies affected by your Flame Shock, and refresh your Flame Shock durations to {$188389d=18 seconds}.
    Lava Burst (_dre) 1737 (3185) 2.0% (3.7%) 7.9 32.62sec 121588 0 Direct 7.8 (14.5) 0 66455 66455 100.0% (100.0%)

Stats Details: Lava Burst Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.86 7.84 0.00 0.00 0.00 0.0000 0.0000 521076.60 521076.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 7.84 0 21 66454.93 51136 101608 66435.92 0 83224 521077 521077 0.00%

Action Details: Lava Burst Dre

  • id:51505
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:maelstrom
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.972000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.38

Spelldata

  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$285452s1=0} Fire damage. Lava Burst will always critically strike if the target is affected by Flame Shock.{$?a343725=true}[ |cFFFFFFFFGenerates {$343725s3=10} Maelstrom.|r][]
        Lava Burst Overload (_dre) 1448 1.7% 6.7 36.75sec 64707 0 Direct 6.7 0 64837 64837 100.0%

Stats Details: Lava Burst Overload Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.71 6.70 0.00 0.00 0.00 0.0000 0.0000 434248.93 434248.93 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 6.70 0 21 64837.10 49646 115247 64849.32 0 90305 434249 434249 0.00%

Action Details: Lava Burst Overload Dre

  • id:285466
  • school:fire
  • range:100.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:maelstrom
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.972000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.34

Spelldata

  • id:285466
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:{$@spelldesc51505=Hurls molten lava at the target, dealing {$285452s1=0} Fire damage. Lava Burst will always critically strike if the target is affected by Flame Shock.{$?a343725=true}[ |cFFFFFFFFGenerates {$343725s3=10} Maelstrom.|r][]}
Elemental Blast 21810 (30623) 25.5% (35.8%) 45.5 6.46sec 201803 123588 Direct 45.4 (82.3) 104912 267461 144074 24.1% (24.1%)

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 45.49 45.38 0.00 0.00 0.00 1.6329 0.0000 6538396.90 6538396.90 0.00% 123587.51 123587.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.91% 34.45 19 55 104911.85 66127 153074 105016.02 96215 114515 3613871 3613871 0.00%
crit 24.09% 10.93 2 24 267460.77 169286 386949 267773.84 209665 320752 2924526 2924526 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:0.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:maelstrom
  • base_cost:90.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.86

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=false}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single_target
    [F]:45.74
    Elemental Blast Overload 8814 10.3% 37.0 7.88sec 71482 0 Direct 36.9 52196 132976 71654 24.1%

Stats Details: Elemental Blast Overload

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.96 36.87 0.00 0.00 0.00 0.0000 0.0000 2641930.23 2641930.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.91% 27.99 11 47 52195.56 33064 76537 52252.19 46975 57428 1460947 1460947 0.00%
crit 24.09% 8.88 1 21 132975.95 84643 193475 133118.67 97569 181178 1180983 1180983 0.00%

Action Details: Elemental Blast Overload

  • id:120588
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.86

Spelldata

  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=false}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
Flame Shock 3037 3.5% 18.8 16.24sec 48540 110713 Direct 18.8 4455 11381 5876 20.5%
Periodic 228.4 2657 6790 3505 20.5% 99.2%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.76 18.76 228.38 228.38 25.62 0.4385 1.3029 910615.89 910615.89 0.00% 2978.06 110713.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.48% 14.91 6 23 4455.02 4159 5452 4456.36 4207 4749 66424 66424 0.00%
crit 20.52% 3.85 0 12 11380.89 10647 13956 11183.78 0 13956 43818 43818 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.49% 181.53 127 234 2656.62 2474 3243 2657.65 2589 2758 482255 482255 0.00%
crit 20.51% 46.85 22 77 6789.89 6334 8302 6792.19 6495 7280 318119 318119 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:4.500
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.64

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:1.64
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single_target
    [C]:6.53
  • if_expr:active_enemies=1&refreshable&!buff.surge_of_power.up
  • target_if_expr:dot.flame_shock.remains
Flametongue Weapon 0 (17) 0.0% (0.0%) 1.0 0.00sec 4988 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=false}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=true}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 17 0.0% 65.7 5.57sec 76 0 Direct 65.7 58 148 76 20.1%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.68 65.68 0.00 0.00 0.00 0.0000 0.0000 4988.50 4988.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.94% 52.50 23 85 57.85 58 58 57.85 58 58 3038 3038 0.00%
crit 20.06% 13.17 3 31 148.10 148 148 148.10 148 148 1951 1951 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.013708
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.08

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Frost Shock 2401 2.8% 14.8 18.67sec 48517 40000 Direct 14.8 36650 93797 48518 20.8%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.83 14.83 0.00 0.00 0.00 1.2129 0.0000 719284.62 719284.62 0.00% 40000.26 40000.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.23% 11.75 0 25 36649.85 30248 47578 36672.83 0 43396 430518 430518 0.00%
crit 20.77% 3.08 0 11 93797.23 77436 121800 89505.52 0 121800 288766 288766 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.19

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single_target
    [H]:13.16
  • if_expr:buff.icefury.up&talent.flux_melting.enabled&!buff.flux_melting.up
    single_target
    [I]:1.67
  • if_expr:buff.icefury.up&(talent.electrified_shocks.enabled&!debuff.electrified_shocks.up|buff.icefury.remains<6)
Icefury 479 (868) 0.6% (1.0%) 7.2 42.33sec 35889 22136 Direct 7.2 (13.3) 15116 38454 19847 20.3% (20.3%)

Stats Details: Icefury

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.25 7.23 0.00 0.00 0.00 1.6214 0.0000 143501.41 143501.41 0.00% 22136.40 22136.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.73% 5.76 0 10 15115.67 12188 19171 15130.04 0 17795 87136 87136 0.00%
crit 20.27% 1.47 0 6 38453.70 31201 49077 30718.75 0 49077 56366 56366 0.00%

Action Details: Icefury

  • id:210714
  • school:frost
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:maelstrom
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.907500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.08

Spelldata

  • id:210714
  • name:Icefury
  • school:frost
  • tooltip:Frost Shock damage increased by {$=}w2%.
  • description:Hurls frigid ice at the target, dealing {$s1=0} Frost damage and causing your next {$=}n Frost Shocks to deal {$s2=225}% increased damage and generate {$343725s7=8} Maelstrom. |cFFFFFFFFGenerates {$343725s8=25} Maelstrom.|r

Action Priority List

    single_target
    [J]:7.28
    Icefury Overload 389 0.5% 6.1 48.67sec 19194 0 Direct 6.1 14646 37157 19235 20.4%

Stats Details: Icefury Overload

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 6.06 0.00 0.00 0.00 0.0000 0.0000 116579.21 116579.21 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.61% 4.83 0 9 14646.13 11833 18612 14642.76 0 18612 70671 70671 0.00%
crit 20.39% 1.24 0 6 37156.75 30292 47648 27249.21 0 47648 45908 45908 0.00%

Action Details: Icefury Overload

  • id:219271
  • school:frost
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:maelstrom
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.907500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:219271
  • name:Icefury Overload
  • school:frost
  • tooltip:
  • description:Hurls frigid ice at the target, dealing {$s1=0} Frost damage. |cFFFFFFFFGenerates {$s2=0} Maelstrom.|r
Lava Burst 21541 (39298) 25.2% (45.9%) 111.9 2.67sec 105268 77410 Direct 111.7 (207.4) 0 57814 57814 100.0% (100.0%)

Stats Details: Lava Burst

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 111.92 111.70 0.00 0.00 0.00 1.3599 0.0000 6457704.71 6457704.71 0.00% 77409.53 77409.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 111.70 75 149 57814.04 44736 101608 57816.92 54913 62130 6457705 6457705 0.00%

Action Details: Lava Burst

  • id:51505
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:8.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:maelstrom
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.972000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.38

Spelldata

  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$285452s1=0} Fire damage. Lava Burst will always critically strike if the target is affected by Flame Shock.{$?a343725=true}[ |cFFFFFFFFGenerates {$343725s3=10} Maelstrom.|r][]

Action Priority List

    single_target
    [D]:69.34
  • if_expr:cooldown_react&buff.lava_surge.up
    single_target
    [E]:7.43
  • if_expr:talent.master_of_the_elements.enabled&!buff.master_of_the_elements.up&maelstrom>=50&talent.swelling_maelstrom.enabled&maelstrom<=130
    single_target
    [G]:35.36
  • if_expr:enemies=1&talent.deeply_rooted_elements.enabled
  • target_if_expr:dot.flame_shock.remains>2
    Lava Burst Overload 17757 20.8% 95.9 3.11sec 55524 0 Direct 95.7 0 55630 55630 100.0%

Stats Details: Lava Burst Overload

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 95.88 95.69 0.00 0.00 0.00 0.0000 0.0000 5323483.20 5323483.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 95.69 61 133 55630.09 43433 98648 55644.71 52953 59330 5323483 5323483 0.00%

Action Details: Lava Burst Overload

  • id:285466
  • school:fire
  • range:100.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:maelstrom
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.972000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.34

Spelldata

  • id:285466
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:{$@spelldesc51505=Hurls molten lava at the target, dealing {$285452s1=0} Fire damage. Lava Burst will always critically strike if the target is affected by Flame Shock.{$?a343725=true}[ |cFFFFFFFFGenerates {$343725s3=10} Maelstrom.|r][]}
Lightning Bolt 658 (1209) 0.8% (1.4%) 10.7 23.84sec 33768 21147 Direct 10.7 (19.7) 13313 34115 18396 24.4% (24.4%)

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.71 10.71 0.00 0.00 0.00 1.5969 0.0000 197040.62 197040.62 0.00% 21146.85 21146.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.57% 8.09 0 23 13313.48 11906 18728 13304.17 0 17451 107762 107762 0.00%
crit 24.43% 2.62 0 10 34114.92 30481 47944 31414.95 0 44674 89278 89278 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.01

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=true}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single_target
    [K]:10.76
    Lightning Bolt Overload 551 0.6% 8.9 28.07sec 18407 0 Direct 8.9 13331 34133 18406 24.4%

Stats Details: Lightning Bolt Overload

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.95 8.95 0.00 0.00 0.00 0.0000 0.0000 164655.15 164655.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.60% 6.76 0 18 13331.37 11906 18728 13288.90 0 17451 90157 90157 0.00%
crit 24.40% 2.18 0 9 34132.98 30481 47944 30090.85 0 44674 74498 74498 0.00%

Action Details: Lightning Bolt Overload

  • id:45284
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.01

Spelldata

  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=0} Nature damage.
main_hand 202 0.2% 65.7 5.57sec 922 640 Direct 65.7 763 1557 922 20.0%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.68 65.68 0.00 0.00 0.00 1.4418 0.0000 60561.40 86518.49 30.00% 639.57 639.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.96% 52.52 25 86 763.08 763 763 763.08 763 763 40075 57252 30.00%
crit 20.04% 13.16 2 29 1556.69 1557 1557 1556.69 1557 1557 20486 29267 30.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 429 (3358) 0.5% (3.9%) 12.3 25.39sec 82098 67074 Direct 12.2 (34.5) 8693 17702 10515 20.2% (71.7%)

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.26 12.23 0.00 0.00 0.00 1.2240 0.0000 128644.90 128644.90 0.00% 67073.84 67073.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.77% 9.76 2 15 8693.29 8072 10580 8697.07 8072 9460 84842 84842 0.00%
crit 20.23% 2.47 0 8 17702.28 16466 21584 16605.81 0 21584 43803 43803 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=true}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=true}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=false}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single_target
    [B]:12.26
  • if_expr:!buff.primordial_wave.up&!buff.splintered_elements.up
  • target_if_expr:dot.flame_shock.remains
    Lava Burst (_pw) 1624 (2929) 1.9% (3.4%) 12.2 25.42sec 71906 0 Direct 12.2 (22.3) 0 39933 39933 100.0% (100.0%)

Stats Details: Lava Burst Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.21 12.19 0.00 0.00 0.00 0.0000 0.0000 486697.66 486697.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 12.19 9 15 39932.84 35789 67392 39932.66 36929 45097 486698 486698 0.00%

Action Details: Lava Burst Pw

  • id:51505
  • school:fire
  • range:40.0
  • travel_speed:50.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:maelstrom
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.972000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.38

Spelldata

  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$285452s1=0} Fire damage. Lava Burst will always critically strike if the target is affected by Flame Shock.{$?a343725=true}[ |cFFFFFFFFGenerates {$343725s3=10} Maelstrom.|r][]
        Lava Burst Overload (_pw) 1305 1.5% 10.1 29.83sec 38738 0 Direct 10.1 0 38811 38811 100.0%

Stats Details: Lava Burst Overload Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 10.10 10.08 0.00 0.00 0.00 0.0000 0.0000 391301.57 391301.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
crit 100.00% 10.08 3 15 38811.30 34746 63135 38810.29 34746 44198 391302 391302 0.00%

Action Details: Lava Burst Overload Pw

  • id:285466
  • school:fire
  • range:100.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:maelstrom
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.972000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.34

Spelldata

  • id:285466
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:{$@spelldesc51505=Hurls molten lava at the target, dealing {$285452s1=0} Fire damage. Lava Burst will always critically strike if the target is affected by Flame Shock.{$?a343725=true}[ |cFFFFFFFFGenerates {$343725s3=10} Maelstrom.|r][]}
pet - greater_fire_elemental 5819 / 1366
Fire Blast 5819 1.6% 30.2 8.37sec 13589 6037 Direct 30.2 11208 23222 13589 19.8%

Stats Details: Fire Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.21 30.21 0.00 0.00 0.00 2.2511 0.0000 410573.93 410573.93 0.00% 6036.52 6036.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.18% 24.23 12 37 11208.08 9972 13071 11233.02 10490 12178 271528 271528 0.00%
crit 19.82% 5.99 0 18 23221.66 20742 27188 23216.64 0 27188 139046 139046 0.00%

Action Details: Fire Blast

  • id:57984
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:4.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.742500
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.03

Spelldata

  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.

Action Priority List

    default
    [ ]:32.70
Simple Action Stats Execute Interval
T29_Shaman_Elemental
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Shaman_Elemental
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Fire Elemental 2.5 150.51sec

Stats Details: Fire Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.49 0.00 0.00 0.00 0.00 1.1658 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Fire Elemental

  • id:198067
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:150.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:{$188592s2=25}%
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=30 seconds}. While the Fire Elemental is active, Flame Shock deals damage {$=}{100*(1/(1+{$188592s2=25}/100)-1)}% faster, and newly applied Flame Shocks last {$188592s3=100}% longer.

Action Priority List

    single_target
    [A]:2.49
Phial of Static Empowerment 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:370652
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Shaman_Elemental
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Shaman_Elemental
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 6.6 0.0 40.1sec 40.1sec 7.1sec 15.54% 18.19% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 296.7s
  • trigger_min/max:6.0s / 296.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.0s

Stack Uptimes

  • ascendance_1:15.54%

Spelldata

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.{$?=}{$=}w4>0[ Haste increased by {$=}w4%][].
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance. When you transform into the Flame Ascendant, instantly cast a Lava Burst at all enemies affected by your Flame Shock, and refresh your Flame Shock durations to {$188389d=18 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Burning Intensity 4.2 0.0 62.1sec 62.1sec 19.3sec 27.12% 0.00% 0.0 (0.0) 3.9

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_burning_intensity
  • max_stacks:20
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Infernal Writ

Stat Details

  • stat:crit_rating
  • amount:164.87

Trigger Details

  • interval_min/max:20.0s / 213.3s
  • trigger_min/max:20.0s / 213.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • burning_intensity_1:1.40%
  • burning_intensity_2:1.40%
  • burning_intensity_3:1.39%
  • burning_intensity_4:1.39%
  • burning_intensity_5:1.38%
  • burning_intensity_6:1.38%
  • burning_intensity_7:1.37%
  • burning_intensity_8:1.37%
  • burning_intensity_9:1.36%
  • burning_intensity_10:1.36%
  • burning_intensity_11:1.35%
  • burning_intensity_12:1.35%
  • burning_intensity_13:1.34%
  • burning_intensity_14:1.34%
  • burning_intensity_15:1.33%
  • burning_intensity_16:1.33%
  • burning_intensity_17:1.32%
  • burning_intensity_18:1.32%
  • burning_intensity_19:1.31%
  • burning_intensity_20:1.31%

Spelldata

  • id:215816
  • name:Burning Intensity
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc215813=Your damaging spells have a chance to grant you {$215816s1=68} Critical Strike every {$215815t2=1} sec for {$215815d=20 seconds}.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 11.3 16.2 26.2sec 10.4sec 16.2sec 60.93% 0.00% 16.2 (16.2) 10.7

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 133.8s
  • trigger_min/max:0.4s / 123.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 108.3s

Stack Uptimes

  • elemental_blast_critical_strike_1:60.93%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=false}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 11.0 16.5 27.0sec 10.4sec 16.5sec 60.31% 0.00% 16.5 (16.5) 10.3

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 147.4s
  • trigger_min/max:0.4s / 135.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 108.0s

Stack Uptimes

  • elemental_blast_haste_1:60.31%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=false}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 11.0 16.4 26.9sec 10.4sec 16.5sec 60.43% 0.00% 16.4 (16.4) 10.4

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 145.6s
  • trigger_min/max:0.4s / 129.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 112.0s

Stack Uptimes

  • elemental_blast_mastery_1:60.43%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=false}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Mastery 30.5 15.0 9.7sec 6.5sec 6.5sec 65.67% 0.00% 15.0 (15.0) 29.9

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_elemental_mastery
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 48.9s
  • trigger_min/max:1.3s / 24.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.0s

Stack Uptimes

  • elemental_mastery_1:65.67%

Spelldata

  • id:394670
  • name:Elemental Mastery
  • tooltip:Mastery increased by {$=}{{$s1=4}*{$168534=}bc1}%.
  • description:{$@spelldesc393690=Casting {$?s117014=true}[Elemental Blast][Earth Shock] or Earthquake increases your Mastery by {$=}{{$394670s1=4}*{$168534=}bc1}%. for {$394670d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:393690
  • name:Shaman Elemental Class Set 4pc
  • tooltip:
  • description:Casting {$?s117014=true}[Elemental Blast][Earth Shock] or Earthquake increases your Mastery by {$=}{{$394670s1=4}*{$168534=}bc1}%. for {$394670d=5 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 28.0sec 9.46% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.0s / 28.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.46%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Fire Elemental 2.5 0.0 150.5sec 150.5sec 28.5sec 23.54% 30.69% 0.0 (0.0) 2.2

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_fire_elemental
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:150.0s / 151.6s
  • trigger_min/max:150.0s / 151.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • fire_elemental_1:23.54%

Spelldata

  • id:188592
  • name:Fire Elemental
  • tooltip:Flame Shock deals damage {$s2=25}% faster. {$?=}{$=}w3!>0[Newly applied Flame Shocks have {$=}w3% increased duration.][]
  • description:{$@spelldesc198067=Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=30 seconds}. While the Fire Elemental is active, Flame Shock deals damage {$=}{100*(1/(1+{$188592s2=25}/100)-1)}% faster, and newly applied Flame Shocks last {$188592s3=100}% longer.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Flux Melting 13.2 1.7 21.2sec 18.7sec 3.7sec 16.06% 7.61% 1.7 (1.7) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_flux_melting
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.9s / 203.3s
  • trigger_min/max:1.0s / 203.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.5s

Stack Uptimes

  • flux_melting_1:16.06%

Spelldata

  • id:381777
  • name:Flux Melting
  • tooltip:Your next Lava Burst will deal {$s1=20}% increased damage.
  • description:{$@spelldesc381776=Casting Frost Shock increases the damage of your next Lava Burst by {$381777s1=20}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icefury 7.2 0.0 42.4sec 42.4sec 23.5sec 56.82% 100.00% 0.0 (0.0) 5.6

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_icefury
  • max_stacks:4
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:31.3s / 167.0s
  • trigger_min/max:31.3s / 167.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • icefury_1:3.11%
  • icefury_2:11.78%
  • icefury_3:21.95%
  • icefury_4:19.98%

Spelldata

  • id:210714
  • name:Icefury
  • tooltip:Frost Shock damage increased by {$=}w2%.
  • description:Hurls frigid ice at the target, dealing {$s1=0} Frost damage and causing your next {$=}n Frost Shocks to deal {$s2=225}% increased damage and generate {$343725s7=8} Maelstrom. |cFFFFFFFFGenerates {$343725s8=25} Maelstrom.|r
  • max_stacks:0
  • duration:25.00
  • cooldown:30.00
  • default_chance:100.00%
Lava Surge 74.2 8.4 4.0sec 3.6sec 1.0sec 24.60% 59.22% 8.7 (8.7) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 21.9s
  • trigger_min/max:0.0s / 21.9s
  • trigger_pct:99.59%
  • duration_min/max:0.0s / 7.6s

Stack Uptimes

  • lava_surge_1:24.60%

Spelldata

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Magma Chamber 46.4 182.0 6.5sec 1.3sec 5.7sec 88.65% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_magma_chamber
  • max_stacks:20
  • base duration:21.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 24.1s
  • trigger_min/max:0.8s / 1.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.4s

Stack Uptimes

  • magma_chamber_1:20.16%
  • magma_chamber_2:17.85%
  • magma_chamber_3:14.92%
  • magma_chamber_4:12.49%
  • magma_chamber_5:9.49%
  • magma_chamber_6:6.30%
  • magma_chamber_7:3.57%
  • magma_chamber_8:2.03%
  • magma_chamber_9:1.03%
  • magma_chamber_10:0.47%
  • magma_chamber_11:0.20%
  • magma_chamber_12:0.08%
  • magma_chamber_13:0.03%
  • magma_chamber_14:0.01%
  • magma_chamber_15:0.00%
  • magma_chamber_16:0.00%
  • magma_chamber_17:0.00%
  • magma_chamber_18:0.00%
  • magma_chamber_19:0.00%

Spelldata

  • id:381933
  • name:Magma Chamber
  • tooltip:Increases the damage of your next {$?s117014=true}[Elemental Blast][Earth Shock] or Earthquake by {$=}{{$=}W1}.1%.
  • description:{$@spelldesc381932=Flame Shock damage increases the damage of your next Earth Shock, Elemental Blast, or Earthquake by {$=}{{$=}S2/10}.1%, stacking up to {$381933u=20} times.}
  • max_stacks:20
  • duration:21.00
  • cooldown:0.00
  • default_chance:101.00%
Master of the Elements 56.8 75.2 5.3sec 2.3sec 3.8sec 71.53% 71.79% 75.2 (75.2) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_master_of_the_elements
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 20.3s
  • trigger_min/max:0.0s / 14.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.0s

Stack Uptimes

  • master_of_the_elements_1:71.53%

Spelldata

  • id:260734
  • name:Master of the Elements
  • tooltip:Your next Nature, Physical, or Frost spell will deal {$s1=0}% increased damage or healing.
  • description:{$@spelldesc16166=Casting Lava Burst increases the damage or healing of your next Nature, Physical, or Frost spell by {$s2=10}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 299.5 (299.5) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_phial_of_static_empowerment
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_static_empowerment_1:100.00%

Spelldata

  • id:370652
  • name:Phial of Static Empowerment
  • tooltip:{$=}pri is increased by up to {$=}w1 while stationary. Movement consumes the effect, granting up to {$=}w2 Speed for {$370773d=5 seconds}.
  • description:Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Primordial Surge 12.3 0.0 25.4sec 25.4sec 11.8sec 48.15% 0.00% 36.1 (36.1) 11.8

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_primordial_surge
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 34.0s
  • trigger_min/max:15.0s / 34.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • primordial_surge_1:48.15%

Spelldata

  • id:387622
  • name:Primordial Surge
  • tooltip:
  • description:{$@spelldesc387474={$@spelldesc387363=The Primal Tsunami unleashes several globules of water, inflicting {$387474s1=15} Frost damage to players within {$387474=}A1 yards of each impact. The Infused Globule then drifts about, applying Waterlogged to players on contact. After {$s2=11} sec, the Globule explodes, inflicting {$s1=45} Frost damage to players within {$=}a1 yards.}}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Surge (_lava_burst_buff) 60.2 0.0 5.0sec 5.0sec 1.0sec 20.62% 38.17% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_primordial_surge_lava_burst_buff
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.0s / 22.3s
  • trigger_min/max:3.0s / 22.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.6s

Stack Uptimes

  • primordial_surge_lava_burst_buff_1:20.62%

Spelldata

  • id:396484
  • name:Primordial Surge
  • tooltip:
  • description:{$@spelldesc387474={$@spelldesc387363=The Primal Tsunami unleashes several globules of water, inflicting {$387474s1=15} Frost damage to players within {$387474=}A1 yards of each impact. The Infused Globule then drifts about, applying Waterlogged to players on contact. After {$s2=11} sec, the Globule explodes, inflicting {$s1=45} Frost damage to players within {$=}a1 yards.}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Wave 12.3 0.0 25.4sec 25.4sec 1.2sec 5.04% 10.92% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 34.0s
  • trigger_min/max:15.0s / 34.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 3.1s

Stack Uptimes

  • primordial_wave_1:5.04%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=true}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=true}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=true}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=true}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=true}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=true}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=false}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Seismic Accumulation 44.4 219.9 6.8sec 1.1sec 5.9sec 86.75% 95.71% 81.5 (81.5) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_seismic_accumulation
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 22.3s
  • trigger_min/max:0.0s / 13.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.3s

Stack Uptimes

  • seismic_accumulation_1:7.88%
  • seismic_accumulation_2:24.49%
  • seismic_accumulation_3:4.95%
  • seismic_accumulation_4:12.93%
  • seismic_accumulation_5:36.50%

Spelldata

  • id:394651
  • name:Seismic Accumulation
  • tooltip:{$?s117014=true}[Elemental Blast][Earth Shock] and Earthquake damage increased by {$=}W1%.
  • description:{$@spelldesc393688=Lightning Bolt, Chain Lightning, and Lava Burst increase the damage of your next {$?s117014=true}[Elemental Blast][Earth Shock] or Earthquake by {$=}{{$394651=}S1}.1%, stacking up to {$394651u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:393688
  • name:Shaman Elemental Class Set 2pc
  • tooltip:
  • description:Lightning Bolt, Chain Lightning, and Lava Burst increase the damage of your next {$?s117014=true}[Elemental Blast][Earth Shock] or Earthquake by {$=}{{$394651=}S1}.1%, stacking up to {$394651u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.1 60.7sec 46.0sec 16.5sec 23.80% 0.00% 1.1 (1.1) 4.1

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:932.20

Trigger Details

  • interval_min/max:15.0s / 232.1s
  • trigger_min/max:0.0s / 203.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 81.0s

Stack Uptimes

  • sophic_devotion_1:23.80%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Static Empowerment 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 295.5 (295.5) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_static_empowerment
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:intellect
  • amount:124.60

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • static_empowerment_1:0.34%
  • static_empowerment_2:0.34%
  • static_empowerment_3:0.34%
  • static_empowerment_4:0.34%
  • static_empowerment_5:98.65%

Spelldata

  • id:370772
  • name:Static Empowerment
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc370652=Remaining stationary will increase your {$=}pri up to {$s1=316} over 5 sec. Movement consumes the effect, granting up to {$s2=314} Speed for {$370773d=5 seconds}.|n|n{$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:5
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Valarjar's Path 3.0 0.0 120.8sec 120.8sec 28.7sec 28.76% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_valarjars_path
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Horn of Valor

Stat Details

  • stat:intellect
  • amount:1263.71

Trigger Details

  • interval_min/max:120.0s / 121.9s
  • trigger_min/max:120.0s / 121.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • valarjars_path_1:28.76%

Spelldata

  • id:215956
  • name:Valarjar's Path
  • tooltip:Primary stat increased by {$s4=605}.
  • description:Sound the horn, increasing your primary stat by {$215956s1=605} for {$215956d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:120.00
  • default_chance:0.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Elemental
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 11.0 1.0 24.0 25.8s 1.1s 254.9s
delayed_aa_cast 103.4 76.0 133.0 2.9s 1.3s 16.2s
Lava Surge 22.8 6.0 46.0 12.7s 0.8s 144.4s
Lava Surge: Primordial Surge 64.0 46.0 86.0 5.0s 3.0s 22.0s
Lava Surge: Wasted 4.7 0.0 15.0 47.2s 0.8s 307.0s
Lava Surge: During Lava Burst 18.7 5.0 34.0 15.9s 0.0s 147.6s
Aftershock 11.3 1.0 32.0 23.4s 1.3s 271.5s
Magma Chamber 1 1.4 0.0 8.0 75.2s 1.3s 331.3s
Magma Chamber 2 8.4 0.0 25.0 28.6s 1.3s 305.9s
Magma Chamber 3 3.9 0.0 16.0 51.5s 2.2s 315.5s
Magma Chamber 4 7.1 0.0 21.0 34.3s 2.7s 259.0s
Magma Chamber 5 6.0 0.0 16.0 41.5s 3.5s 297.3s
Magma Chamber 6 7.3 0.0 18.0 35.5s 4.5s 270.6s
Magma Chamber 7 4.9 0.0 13.0 53.3s 5.1s 329.7s
Magma Chamber 8 3.0 0.0 10.0 66.6s 6.0s 321.3s
Magma Chamber 9 1.9 0.0 8.0 88.1s 6.7s 347.3s
Magma Chamber 10 1.0 0.0 6.0 104.5s 8.0s 321.6s
Magma Chamber 11 0.4 0.0 4.0 110.0s 8.9s 309.3s
Magma Chamber 12 0.2 0.0 3.0 123.8s 19.6s 283.6s
Magma Chamber 13 0.1 0.0 3.0 122.4s 26.1s 284.2s
Magma Chamber 14 0.0 0.0 2.0 140.5s 125.3s 148.5s
Magma Chamber 15 0.0 0.0 2.0 145.5s 134.2s 156.7s
Magma Chamber 16 0.0 0.0 1.0 0.0s 0.0s 0.0s
Magma Chamber 17 0.0 0.0 1.0 0.0s 0.0s 0.0s
Magma Chamber 18 0.0 0.0 1.0 0.0s 0.0s 0.0s
Magma Chamber 19 0.0 0.0 1.0 0.0s 0.0s 0.0s
Set Bonus: Tier29 2PC Elemental spender empowerement, stack 0 2.0 0.0 9.0 66.6s 1.3s 327.8s
Set Bonus: Tier29 2PC Elemental spender empowerement, stack 1 1.1 0.0 7.0 81.8s 2.2s 326.3s
Set Bonus: Tier29 2PC Elemental spender empowerement, stack 2 8.9 0.0 26.0 28.0s 2.2s 274.6s
Set Bonus: Tier29 2PC Elemental spender empowerement, stack 3 1.1 0.0 6.0 87.1s 2.5s 327.6s
Set Bonus: Tier29 2PC Elemental spender empowerement, stack 4 4.6 0.0 15.0 49.5s 2.2s 317.6s
Set Bonus: Tier29 2PC Elemental spender empowerement, stack 5 27.9 16.0 40.0 10.6s 3.2s 56.2s
Flametongue: main_hand 65.7 35.0 104.0 5.5s 1.1s 32.3s
Master of the Elements: Elemental Blast 38.9 21.0 59.0 7.5s 2.2s 44.3s
Master of the Elements: Icefury 5.7 1.0 10.0 53.4s 31.3s 280.8s
Master of the Elements: Frost Shock 9.3 1.0 21.0 29.4s 1.9s 277.1s
Master of the Elements: Lightning Bolt 2.2 0.0 8.0 80.1s 2.2s 316.1s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 81.00% 72.12% 87.43% 5.7s 0.0s 27.9s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Fire Elemental0.6260.0011.5690.7730.0002.897
Primordial Wave0.6880.0012.9956.8700.82614.716
Flame Shock32.8145.335207.607181.3310.000298.461
Lava Burst0.8350.00110.49837.79713.91996.131
Icefury11.0730.001135.36267.1487.969195.589

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
T29_Shaman_Elemental
AftershockMaelstrom11.32848.7924.37%75.000.000.00%
Frost ShockMaelstrom14.83118.603.40%8.000.000.00%
IcefuryMaelstrom7.25181.175.20%25.000.000.00%
Icefury OverloadMaelstrom6.0772.882.09%12.000.000.00%
Lava BurstMaelstrom131.981566.8444.98%11.8716.971.07%
Lava Burst OverloadMaelstrom112.69552.3515.86%4.9011.101.97%
Lightning BoltMaelstrom10.71107.123.07%10.000.000.00%
Lightning Bolt OverloadMaelstrom8.9535.781.03%4.000.000.00%
mana_regenMana533.1953009.85100.00%99.42426088.4088.94%
Usage Type Count Total Avg RPE APR
T29_Shaman_Elemental
Elemental BlastMaelstrom 45.493411.8975.0075.002690.69
Fire ElementalMana 2.496229.172500.002499.870.00
Flame ShockMana 6.534894.65750.00260.91186.04
Frost ShockMana 14.837412.68500.00500.0097.03
IcefuryMana 7.2510870.151500.001499.9923.93
Lightning BoltMana 10.715355.89500.00500.0367.53
Primordial WaveMana 12.2618392.351500.001500.0154.73
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 176.70 177.18 426088.3 49854.9 46640.0 50000.0
Maelstrom 0.0 11.61 11.37 28.1 71.6 0.0 150.0

Statistics & Data Analysis

Fight Length
T29_Shaman_Elemental Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
T29_Shaman_Elemental Damage Per Second
Count 7499
Mean 85563.73
Minimum 71935.35
Maximum 101896.77
Spread ( max - min ) 29961.42
Range [ ( max - min ) / 2 * 100% ] 17.51%
Standard Deviation 4197.4731
5th Percentile 78897.33
95th Percentile 92696.25
( 95th Percentile - 5th Percentile ) 13798.92
Mean Distribution
Standard Deviation 48.4715
95.00% Confidence Interval ( 85468.72 - 85658.73 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9245
0.1 Scale Factor Error with Delta=300 150405
0.05 Scale Factor Error with Delta=300 601617
0.01 Scale Factor Error with Delta=300 15040405
Priority Target DPS
T29_Shaman_Elemental Priority Target Damage Per Second
Count 7499
Mean 85563.73
Minimum 71935.35
Maximum 101896.77
Spread ( max - min ) 29961.42
Range [ ( max - min ) / 2 * 100% ] 17.51%
Standard Deviation 4197.4731
5th Percentile 78897.33
95th Percentile 92696.25
( 95th Percentile - 5th Percentile ) 13798.92
Mean Distribution
Standard Deviation 48.4715
95.00% Confidence Interval ( 85468.72 - 85658.73 )
Normalized 95.00% Confidence Interval ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9245
0.1 Scale Factor Error with Delta=300 150405
0.05 Scale Factor Error with Delta=300 601617
0.01 Scale Factor Error with Delta=300 15040405
DPS(e)
T29_Shaman_Elemental Damage Per Second (Effective)
Count 7499
Mean 85563.73
Minimum 71935.35
Maximum 101896.77
Spread ( max - min ) 29961.42
Range [ ( max - min ) / 2 * 100% ] 17.51%
Damage
T29_Shaman_Elemental Damage
Count 7499
Mean 25240711.49
Minimum 17349955.76
Maximum 34222200.89
Spread ( max - min ) 16872245.13
Range [ ( max - min ) / 2 * 100% ] 33.42%
DTPS
T29_Shaman_Elemental Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
T29_Shaman_Elemental Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
T29_Shaman_Elemental Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
T29_Shaman_Elemental Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
T29_Shaman_Elemental Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
T29_Shaman_Elemental Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
T29_Shaman_ElementalTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
T29_Shaman_Elemental Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 flametongue_weapon,if=talent.improved_flametongue_weapon.enabled
Ensure weapon enchant is applied.
5 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
0.00 spiritwalkers_grace,moving=1,if=movement.distance>6
Enable more movement.
0.00 wind_shear
Interrupt of casts.
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 bag_of_tricks,if=!talent.ascendance.enabled|!buff.ascendance.up
6 2.99 use_items
7 1.00 auto_attack
0.00 natures_swiftness
8 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
9 0.00 run_action_list,name=single_target
actions.single_target
# count action,conditions
A 2.49 fire_elemental
Keep your cooldowns rolling.
0.00 storm_elemental
Keep your cooldowns rolling.
0.00 totemic_recall,if=cooldown.liquid_magma_totem.remains>45
Reset LMT CD as early as possible.
0.00 liquid_magma_totem
Keep your cooldowns rolling.
B 12.26 primordial_wave,target_if=min:dot.flame_shock.remains,if=!buff.primordial_wave.up&!buff.splintered_elements.up
Use Primordial Wave as much as possible without wasting buffs.
C 6.53 flame_shock,target_if=min:dot.flame_shock.remains,if=active_enemies=1&refreshable&!buff.surge_of_power.up
0.00 flame_shock,target_if=min:dot.flame_shock.remains,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&refreshable&!buff.surge_of_power.up&(talent.deeply_rooted_elements.enabled|talent.ascendance.enabled|talent.primordial_wave.enabled|talent.searing_flames.enabled|talent.magma_chamber.enabled),cycle_targets=1
Spread Flame Shock to multiple targets only if talents were selected that benefit from it.
0.00 stormkeeper,if=!buff.ascendance.up&!buff.stormkeeper.up
0.00 ascendance,if=!buff.stormkeeper.up
0.00 lightning_bolt,if=buff.stormkeeper.up&buff.surge_of_power.up
Stormkeeper is strong and should be used.
0.00 lava_beam,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&buff.stormkeeper.up&!talent.surge_of_power.enabled
Stormkeeper is strong and should be used.
0.00 chain_lightning,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&buff.stormkeeper.up&!talent.surge_of_power.enabled
Stormkeeper is strong and should be used.
0.00 lava_burst,if=buff.stormkeeper.up&!buff.master_of_the_elements.up&!talent.surge_of_power.enabled&talent.master_of_the_elements.enabled
Buff stormkeeper with MotE when not using Surge.
0.00 lightning_bolt,if=buff.stormkeeper.up&!talent.surge_of_power.enabled&buff.master_of_the_elements.up
Stormkeeper is strong and should be used.
0.00 lightning_bolt,if=buff.stormkeeper.up&!talent.surge_of_power.enabled&!talent.master_of_the_elements.enabled
Stormkeeper is strong and should be used.
0.00 lightning_bolt,if=buff.surge_of_power.up
Surge of Power is strong and should be used.
0.00 icefury,if=talent.electrified_shocks.enabled
0.00 frost_shock,if=buff.icefury.up&talent.electrified_shocks.enabled&(!debuff.electrified_shocks.up|buff.icefury.remains<=gcd)
0.00 frost_shock,if=buff.icefury.up&talent.electrified_shocks.enabled&maelstrom>=50&debuff.electrified_shocks.remains<2*gcd&buff.stormkeeper.up
0.00 lava_beam,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&buff.power_of_the_maelstrom.up
0.00 lava_burst,if=buff.windspeakers_lava_resurgence.up
Windspeaker's Lava Resurgence is strong. Don't sit on it.
D 69.34 lava_burst,if=cooldown_react&buff.lava_surge.up
Lava Surge is neat. Utilize it.
0.00 lava_burst,if=talent.master_of_the_elements.enabled&!buff.master_of_the_elements.up&maelstrom>=50&!talent.swelling_maelstrom.enabled&maelstrom<=80
Buff your next Maelstrom Spender with MotE if it won't cap your maelstrom.
E 7.43 lava_burst,if=talent.master_of_the_elements.enabled&!buff.master_of_the_elements.up&maelstrom>=50&talent.swelling_maelstrom.enabled&maelstrom<=130
Buff your next Maelstrom Spender with MotE if it won't cap your maelstrom.
0.00 earthquake,if=buff.echoes_of_great_sundering.up&(!talent.elemental_blast.enabled&active_enemies<2|active_enemies>1)
Use the talents you selected. Did you invest only 1 point in it? In this case this'll be a DPS decrease. Additionally Elemental Blast is stronger than EoGS. In this case don't use Earthquake on single target.
0.00 earthquake,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&!talent.echoes_of_great_sundering.enabled&!talent.elemental_blast.enabled
Use Earthquake against two enemies unless you have to alternate because of Echoes of Great Sundering.
F 45.74 elemental_blast
0.00 earth_shock
0.00 lava_burst,target_if=dot.flame_shock.remains>2,if=buff.flux_melting.up&active_enemies>1
Utilize present buffs.
G 35.36 lava_burst,target_if=dot.flame_shock.remains>2,if=enemies=1&talent.deeply_rooted_elements.enabled
Single target Lava Burst is stronk.
H 13.16 frost_shock,if=buff.icefury.up&talent.flux_melting.enabled&!buff.flux_melting.up
Spread out your Icefury usage if you can get more use out of accompanied buffs.
I 1.67 frost_shock,if=buff.icefury.up&(talent.electrified_shocks.enabled&!debuff.electrified_shocks.up|buff.icefury.remains<6)
Spread out your Icefury usage if you can get more use out of accompanied buffs.
0.00 lightning_bolt,if=buff.power_of_the_maelstrom.up&talent.unrelenting_calamity.enabled
Utilize the Power of the Maelstrom buff if your Lightning Bolt is empowered by Unrelenting Calamity.
J 7.28 icefury
0.00 lightning_bolt,if=pet.storm_elemental.active&debuff.lightning_rod.up&(debuff.electrified_shocks.up|buff.power_of_the_maelstrom.up)
Spam Lightning Bolt if Storm Elemental is active. But honor all previous priorities.
0.00 frost_shock,if=buff.icefury.up&buff.master_of_the_elements.up&!buff.lava_surge.up&!talent.electrified_shocks.enabled&!talent.flux_melting.enabled&cooldown.lava_burst.charges_fractional<1.0&talent.echoes_of_the_elements.enabled
If you have MotE up and aren't at risk of capping LvB, spend MotE on FrS/LB.
0.00 lightning_bolt,if=buff.master_of_the_elements.up&!buff.lava_surge.up&(cooldown.lava_burst.charges_fractional<1.0&talent.echoes_of_the_elements.enabled)
If you have MotE up and aren't at risk of capping LvB, spend MotE on FrS/LB.
0.00 lava_burst,target_if=dot.flame_shock.remains>2
0.00 frost_shock,if=buff.icefury.up&!talent.electrified_shocks.enabled&!talent.flux_melting.enabled
Use your Icefury buffs if you didn't improve the talent.
0.00 chain_lightning,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)
Casting Chain Lightning at two targets is mor efficient than Lightning Bolt.
K 10.76 lightning_bolt
Filler spell. Always available. Always the bottom line.
0.00 flame_shock,moving=1,target_if=refreshable
0.00 flame_shock,moving=1,if=movement.distance>6
0.00 frost_shock,moving=1
Frost Shock is our movement filler.

Sample Sequence

0124567ABDGGGDFGDDFDGJHFKKGHBDDFDGDFFDFDGHIKFKGJHFBDFDGDFDGDFGGHIBDDDDDFDFDGJFHCGHGHBDFDGDHEFDFGK6CEDFFBDFDGDFDJDFGGGACFBDGDFDFDGDFFGDJHFBDGDHDFGGDHKFGCGGKBDFDFDGDFDJEFCDHGBDFDFDF6DGDFFFCEFFJEBDFDGDFDHEGFHICGHKKBDFDGDFGG

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask T29_Shaman_Elemental 50000.0/50000: 100% mana
0.0/150: 0% maelstrom
Pre precombat 1 food T29_Shaman_Elemental 50000.0/50000: 100% mana
0.0/150: 0% maelstrom		 static_empowerment
Pre precombat 2 augmentation T29_Shaman_Elemental 50000.0/50000: 100% mana
0.0/150: 0% maelstrom		 static_empowerment
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana
0.0/150: 0% maelstrom		 static_empowerment
Pre precombat 5 potion Fluffy_Pillow 50000.0/50000: 100% mana
0.0/150: 0% maelstrom		 static_empowerment
0:00.000 default 6 use_items Fluffy_Pillow 50000.0/50000: 100% mana
0.0/150: 0% maelstrom		 static_empowerment, elemental_potion_of_ultimate_power
0:00.000 default 7 auto_attack Fluffy_Pillow 50000.0/50000: 100% mana
0.0/150: 0% maelstrom		 bloodlust, valarjars_path, static_empowerment, elemental_potion_of_ultimate_power
0:00.000 single_target A fire_elemental Fluffy_Pillow 50000.0/50000: 100% mana
0.0/150: 0% maelstrom		 bloodlust, valarjars_path, static_empowerment, elemental_potion_of_ultimate_power
0:01.012 single_target B primordial_wave Fluffy_Pillow 49119.2/50000: 98% mana
0.0/150: 0% maelstrom		 bloodlust, fire_elemental, valarjars_path, static_empowerment(2), elemental_potion_of_ultimate_power
0:02.023 single_target D lava_burst Fluffy_Pillow 49236.8/50000: 98% mana
0.0/150: 0% maelstrom		 bloodlust, primordial_wave, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, fire_elemental, valarjars_path, static_empowerment(3), elemental_potion_of_ultimate_power
0:03.036 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
24.0/150: 16% maelstrom		 bloodlust, seismic_accumulation(2), master_of_the_elements, primordial_surge, magma_chamber, fire_elemental, valarjars_path, static_empowerment(4), elemental_potion_of_ultimate_power
0:04.384 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
48.0/150: 32% maelstrom		 bloodlust, ascendance, seismic_accumulation(4), master_of_the_elements, primordial_surge, magma_chamber(2), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:05.731 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
70.0/150: 47% maelstrom		 bloodlust, ascendance, seismic_accumulation(5), master_of_the_elements, primordial_surge, magma_chamber(4), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:07.080 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
82.0/150: 55% maelstrom		 bloodlust, ascendance, seismic_accumulation(5), lava_surge, master_of_the_elements, primordial_surge, magma_chamber(6), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:08.091 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
104.0/150: 69% maelstrom		 bloodlust, ascendance, seismic_accumulation(5), master_of_the_elements, primordial_surge, magma_chamber(7), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:09.438 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
29.0/150: 19% maelstrom		 bloodlust, ascendance, elemental_blast_critical_strike, elemental_mastery, primordial_surge, fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:10.789 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
41.0/150: 27% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation, elemental_mastery, lava_surge, master_of_the_elements, primordial_surge, magma_chamber(2), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:11.746 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
63.0/150: 42% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(4), elemental_mastery, lava_surge, master_of_the_elements, primordial_surge, magma_chamber(3), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:12.700 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
75.0/150: 50% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), elemental_mastery, master_of_the_elements, primordial_surge, magma_chamber(4), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:13.971 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
0.0/150: 0% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:14.928 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
17.0/150: 11% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, master_of_the_elements, magma_chamber, fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:16.201 single_target J icefury Fluffy_Pillow 50000.0/50000: 100% mana
29.0/150: 19% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, master_of_the_elements, magma_chamber(2), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:17.473 single_target H frost_shock Fluffy_Pillow 48506.4/50000: 97% mana
59.0/150: 39% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, icefury(4), magma_chamber(4), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:18.430 single_target F elemental_blast Fluffy_Pillow 49537.6/50000: 99% mana
79.0/150: 53% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, icefury(3), flux_melting, magma_chamber(5), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:19.703 single_target K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana
4.0/150: 3% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, icefury(3), flux_melting, fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:20.976 single_target K lightning_bolt Fluffy_Pillow 49508.0/50000: 99% mana
14.0/150: 9% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation, elemental_mastery, icefury(3), flux_melting, magma_chamber, fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:22.324 single_target G lava_burst Fluffy_Pillow 49506.4/50000: 99% mana
24.0/150: 16% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(3), flux_melting, magma_chamber(3), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:23.673 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
40.0/150: 27% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, icefury(3), master_of_the_elements, magma_chamber(4), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:24.685 single_target B primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana
53.0/150: 35% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, icefury(2), flux_melting, magma_chamber(5), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:25.697 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
53.0/150: 35% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), primordial_wave, lava_surge, icefury(2), flux_melting, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(6), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:26.710 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
87.0/150: 58% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), lava_surge, icefury(2), master_of_the_elements, primordial_surge, magma_chamber(8), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:27.722 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
104.0/150: 69% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), lava_surge, icefury(2), master_of_the_elements, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(9), fire_elemental, valarjars_path, static_empowerment(5), elemental_potion_of_ultimate_power
0:29.070 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
29.0/150: 19% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(2), primordial_surge_lava_burst_buff, primordial_surge, fire_elemental, valarjars_path, static_empowerment(5)
0:30.083 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
46.0/150: 31% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(2), master_of_the_elements, primordial_surge, magma_chamber(2), static_empowerment(5)
0:31.355 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
58.0/150: 39% maelstrom		 bloodlust, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, lava_surge, icefury(2), master_of_the_elements, primordial_surge, magma_chamber(3), static_empowerment(5)
0:32.311 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
80.0/150: 53% maelstrom		 bloodlust, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, icefury(2), master_of_the_elements, primordial_surge, magma_chamber(4), static_empowerment(5)
0:33.585 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
80.0/150: 53% maelstrom		 bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, icefury(2), primordial_surge, static_empowerment(5)
0:34.859 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
80.0/150: 53% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(2), primordial_surge_lava_burst_buff, primordial_surge, static_empowerment(5)
0:35.812 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
92.0/150: 61% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation, elemental_mastery, lava_surge, icefury(2), master_of_the_elements, primordial_surge, magma_chamber, static_empowerment(5)
0:37.085 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
17.0/150: 11% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(2), primordial_surge_lava_burst_buff, static_empowerment(5)
0:38.040 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
34.0/150: 23% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(2), master_of_the_elements, magma_chamber, static_empowerment(5)
0:39.312 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
46.0/150: 31% maelstrom		 bloodlust, elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(3), elemental_mastery, icefury(2), master_of_the_elements, magma_chamber(2), static_empowerment(5)
0:40.267 single_target I frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
59.0/150: 39% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(4), elemental_mastery, icefury, flux_melting, magma_chamber(3), static_empowerment(5)
0:41.507 single_target K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana
67.0/150: 45% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(4), elemental_mastery, flux_melting, magma_chamber(4), static_empowerment(5)
0:43.159 single_target F elemental_blast Fluffy_Pillow 49504.8/50000: 99% mana
77.0/150: 51% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), flux_melting, magma_chamber(5), static_empowerment(5)
0:44.813 single_target K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana
6.0/150: 4% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, flux_melting, static_empowerment(5)
0:46.467 single_target G lava_burst Fluffy_Pillow 49508.0/50000: 99% mana
16.0/150: 11% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation, elemental_mastery, flux_melting, magma_chamber, static_empowerment(5)
0:48.121 single_target J icefury Fluffy_Pillow 50000.0/50000: 100% mana
32.0/150: 21% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(3), elemental_mastery, master_of_the_elements, magma_chamber(2), static_empowerment(5)
0:49.873 single_target H frost_shock Fluffy_Pillow 48506.4/50000: 97% mana
57.0/150: 38% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(3), icefury(4), magma_chamber(3), static_empowerment(5)
0:51.188 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
77.0/150: 51% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(3), icefury(3), flux_melting, magma_chamber(4), static_empowerment(5)
0:52.939 single_target B primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana
77.0/150: 51% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, icefury(3), flux_melting, static_empowerment(5)
0:54.180 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
77.0/150: 51% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, primordial_wave, lava_surge, icefury(3), flux_melting, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber, static_empowerment(5)
0:55.420 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
128.0/150: 85% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), elemental_mastery, icefury(3), master_of_the_elements, primordial_surge, magma_chamber(2), static_empowerment(5)
0:57.075 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
53.0/150: 35% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(3), primordial_surge_lava_burst_buff, primordial_surge, static_empowerment(5)
0:58.316 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
70.0/150: 47% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(3), master_of_the_elements, primordial_surge, magma_chamber, static_empowerment(5)
0:59.969 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
82.0/150: 55% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, lava_surge, icefury(3), master_of_the_elements, primordial_surge, magma_chamber(2), static_empowerment(5)
1:01.210 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
104.0/150: 69% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, icefury(3), master_of_the_elements, primordial_surge, magma_chamber(3), static_empowerment(5)
1:02.864 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
29.0/150: 19% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(3), primordial_surge_lava_burst_buff, primordial_surge, static_empowerment(5)
1:04.104 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
63.0/150: 42% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, icefury(3), master_of_the_elements, primordial_surge, magma_chamber, static_empowerment(5)
1:05.856 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
75.0/150: 50% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, lava_surge, icefury(3), master_of_the_elements, magma_chamber(2), sophic_devotion, static_empowerment(5)
1:07.172 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
97.0/150: 65% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, icefury(3), master_of_the_elements, magma_chamber(3), sophic_devotion, static_empowerment(5)
1:08.924 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
22.0/150: 15% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, icefury(3), sophic_devotion, static_empowerment(5)
1:10.677 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
34.0/150: 23% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation, elemental_mastery, icefury(3), master_of_the_elements, magma_chamber, sophic_devotion, static_empowerment(5)
1:12.330 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
51.0/150: 34% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, icefury(3), master_of_the_elements, magma_chamber(3), sophic_devotion, static_empowerment(5)
1:13.568 single_target I frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
64.0/150: 43% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(4), elemental_mastery, icefury(2), flux_melting, magma_chamber(3), sophic_devotion, static_empowerment(5)
1:14.809 single_target B primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana
72.0/150: 48% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(4), icefury, flux_melting, magma_chamber(4), sophic_devotion, static_empowerment(5)
1:16.050 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
72.0/150: 48% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(4), primordial_wave, lava_surge, flux_melting, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(5), sophic_devotion, static_empowerment(5)
1:17.292 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
101.0/150: 67% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), lava_surge, master_of_the_elements, primordial_surge, magma_chamber(6), sophic_devotion, static_empowerment(5)
1:18.533 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
118.0/150: 79% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), lava_surge, master_of_the_elements, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(7), sophic_devotion, static_empowerment(5)
1:19.774 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
135.0/150: 90% maelstrom		 seismic_accumulation(5), lava_surge, master_of_the_elements, primordial_surge, magma_chamber(8), sophic_devotion, static_empowerment(5)
1:21.090 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
150.0/150: 100% maelstrom		 seismic_accumulation(5), lava_surge, master_of_the_elements, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(9), static_empowerment(5)
1:22.406 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
150.0/150: 100% maelstrom		 seismic_accumulation(5), master_of_the_elements, primordial_surge, magma_chamber(9), static_empowerment(5)
1:24.156 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
75.0/150: 50% maelstrom		 elemental_blast_haste, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, static_empowerment(5)
1:25.397 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
92.0/150: 61% maelstrom		 elemental_blast_haste, seismic_accumulation(2), elemental_mastery, master_of_the_elements, primordial_surge, static_empowerment(5)
1:27.052 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
17.0/150: 11% maelstrom		 elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, static_empowerment(5)
1:28.292 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
34.0/150: 23% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, master_of_the_elements, static_empowerment(5)
1:29.947 single_target J icefury Fluffy_Pillow 50000.0/50000: 100% mana
46.0/150: 31% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, master_of_the_elements, magma_chamber(2), static_empowerment(5)
1:31.600 single_target F elemental_blast Fluffy_Pillow 48506.4/50000: 97% mana
76.0/150: 51% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, icefury(4), magma_chamber(3), static_empowerment(5)
1:33.252 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
13.0/150: 9% maelstrom		 elemental_blast_haste, elemental_blast_mastery, elemental_mastery, icefury(4), static_empowerment(5)
1:34.492 single_target C flame_shock Fluffy_Pillow 50000.0/50000: 100% mana
21.0/150: 14% maelstrom		 elemental_blast_haste, elemental_blast_mastery, elemental_mastery, icefury(3), flux_melting, magma_chamber, static_empowerment(5)
1:35.731 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
21.0/150: 14% maelstrom		 elemental_blast_mastery, elemental_mastery, icefury(3), flux_melting, magma_chamber(2), static_empowerment(5)
1:37.483 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
33.0/150: 22% maelstrom		 elemental_blast_mastery, seismic_accumulation, elemental_mastery, icefury(3), master_of_the_elements, magma_chamber(3), static_empowerment(5)
1:38.798 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
46.0/150: 31% maelstrom		 elemental_blast_mastery, seismic_accumulation(2), lava_surge, icefury(2), flux_melting, magma_chamber(4), static_empowerment(5)
1:40.114 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
58.0/150: 39% maelstrom		 elemental_blast_mastery, seismic_accumulation(3), icefury(2), master_of_the_elements, magma_chamber(5), static_empowerment(5)
1:41.432 single_target B primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana
66.0/150: 44% maelstrom		 elemental_blast_mastery, seismic_accumulation(3), icefury, flux_melting, magma_chamber(5), static_empowerment(5)
1:42.747 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
66.0/150: 44% maelstrom		 elemental_blast_mastery, seismic_accumulation(3), primordial_wave, lava_surge, icefury, flux_melting, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(6), static_empowerment(5)
1:44.061 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
100.0/150: 67% maelstrom		 seismic_accumulation(5), icefury, master_of_the_elements, primordial_surge, magma_chamber(7), static_empowerment(5)
1:45.811 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
25.0/150: 17% maelstrom		 elemental_blast_mastery, elemental_mastery, lava_surge, icefury, primordial_surge_lava_burst_buff, primordial_surge, static_empowerment(5)
1:47.127 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
37.0/150: 25% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation, elemental_mastery, icefury, master_of_the_elements, primordial_surge, magma_chamber, static_empowerment(5)
1:48.880 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
49.0/150: 33% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, lava_surge, icefury, master_of_the_elements, primordial_surge, magma_chamber(2), static_empowerment(5)
1:50.196 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
71.0/150: 47% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, icefury, master_of_the_elements, primordial_surge, magma_chamber(3), static_empowerment(5)
1:51.512 single_target E lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
79.0/150: 53% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), lava_surge, flux_melting, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(4), static_empowerment(5)
1:52.827 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
91.0/150: 61% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), lava_surge, master_of_the_elements, primordial_surge, magma_chamber(5), static_empowerment(5)
1:54.581 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
91.0/150: 61% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, static_empowerment(5)
1:55.896 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
108.0/150: 72% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, master_of_the_elements, magma_chamber, static_empowerment(5)
1:57.648 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
33.0/150: 22% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, static_empowerment(5)
1:59.402 single_target K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana
45.0/150: 30% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation, elemental_mastery, master_of_the_elements, magma_chamber, static_empowerment(5)
2:01.154 default 6 use_items Fluffy_Pillow 49506.4/50000: 99% mana
60.0/150: 40% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, magma_chamber(2), static_empowerment(5)
2:01.154 single_target C flame_shock Fluffy_Pillow 49506.4/50000: 99% mana
60.0/150: 40% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, magma_chamber(2), valarjars_path, static_empowerment(5)
2:02.469 single_target E lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
64.0/150: 43% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, magma_chamber(3), valarjars_path, static_empowerment(5)
2:04.335 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
76.0/150: 51% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), lava_surge, master_of_the_elements, magma_chamber(4), valarjars_path, static_empowerment(5)
2:05.651 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
98.0/150: 65% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), master_of_the_elements, magma_chamber(5), valarjars_path, burning_intensity, static_empowerment(5)
2:07.403 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
98.0/150: 65% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, valarjars_path, burning_intensity(3), static_empowerment(5)
2:09.155 single_target B primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana
98.0/150: 65% maelstrom		 elemental_blast_critical_strike, elemental_mastery, valarjars_path, burning_intensity(5), static_empowerment(5)
2:10.472 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
98.0/150: 65% maelstrom		 elemental_blast_critical_strike, elemental_mastery, primordial_wave, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, valarjars_path, burning_intensity(6), static_empowerment(5)
2:11.787 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
132.0/150: 88% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(4), elemental_mastery, master_of_the_elements, primordial_surge, magma_chamber, valarjars_path, burning_intensity(7), sophic_devotion, static_empowerment(5)
2:13.540 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
57.0/150: 38% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, valarjars_path, burning_intensity(9), sophic_devotion, static_empowerment(5)
2:14.855 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
74.0/150: 49% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, master_of_the_elements, primordial_surge, valarjars_path, burning_intensity(10), sophic_devotion, static_empowerment(5)
2:16.509 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
86.0/150: 57% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, lava_surge, master_of_the_elements, primordial_surge, magma_chamber(2), valarjars_path, burning_intensity(12), sophic_devotion, static_empowerment(5)
2:17.749 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
108.0/150: 72% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, master_of_the_elements, primordial_surge, magma_chamber(2), valarjars_path, burning_intensity(13), sophic_devotion, static_empowerment(5)
2:19.406 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
33.0/150: 22% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, valarjars_path, burning_intensity(15), sophic_devotion, static_empowerment(5)
2:20.646 single_target J icefury Fluffy_Pillow 50000.0/50000: 100% mana
45.0/150: 30% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation, elemental_mastery, master_of_the_elements, primordial_surge, valarjars_path, burning_intensity(16), sophic_devotion, static_empowerment(5)
2:22.300 single_target D lava_burst Fluffy_Pillow 48508.0/50000: 97% mana
70.0/150: 47% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation, elemental_mastery, lava_surge, icefury(4), primordial_surge_lava_burst_buff, magma_chamber(2), valarjars_path, burning_intensity(18), sophic_devotion, static_empowerment(5)
2:23.540 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
116.0/150: 77% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), elemental_mastery, icefury(4), master_of_the_elements, magma_chamber(2), valarjars_path, burning_intensity(19), sophic_devotion, static_empowerment(5)
2:25.194 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
41.0/150: 27% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, icefury(4), valarjars_path, sophic_devotion, static_empowerment(5)
2:26.846 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
53.0/150: 35% maelstrom		 ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation, elemental_mastery, icefury(4), master_of_the_elements, magma_chamber, valarjars_path, sophic_devotion, static_empowerment(5)
2:28.500 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
70.0/150: 47% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, icefury(4), master_of_the_elements, magma_chamber(2), valarjars_path, sophic_devotion, static_empowerment(5)
2:30.154 single_target A fire_elemental Fluffy_Pillow 50000.0/50000: 100% mana
87.0/150: 58% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, icefury(4), master_of_the_elements, magma_chamber(3), valarjars_path, sophic_devotion, static_empowerment(5)
2:31.470 single_target C flame_shock Fluffy_Pillow 49605.6/50000: 99% mana
92.0/150: 61% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), icefury(4), master_of_the_elements, magma_chamber(4), fire_elemental, sophic_devotion, static_empowerment(5)
2:32.785 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
92.0/150: 61% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), icefury(4), master_of_the_elements, magma_chamber(5), fire_elemental, sophic_devotion, static_empowerment(5)
2:34.538 single_target B primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana
17.0/150: 11% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, icefury(4), fire_elemental, sophic_devotion, static_empowerment(5)
2:35.778 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
17.0/150: 11% maelstrom		 elemental_blast_haste, elemental_blast_mastery, elemental_mastery, primordial_wave, lava_surge, icefury(4), primordial_surge_lava_burst_buff, primordial_surge, magma_chamber, fire_elemental, sophic_devotion, static_empowerment(5)
2:37.019 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
51.0/150: 34% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, icefury(4), master_of_the_elements, primordial_surge, magma_chamber(2), fire_elemental, sophic_devotion, static_empowerment(5)
2:38.672 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
63.0/150: 42% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, lava_surge, icefury(4), master_of_the_elements, primordial_surge, magma_chamber(4), fire_elemental, static_empowerment(5)
2:39.914 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
85.0/150: 57% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(5), icefury(4), master_of_the_elements, primordial_surge, magma_chamber(5), fire_elemental, static_empowerment(5)
2:41.565 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
85.0/150: 57% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(4), primordial_surge_lava_burst_buff, primordial_surge, fire_elemental, static_empowerment(5)
2:42.806 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
102.0/150: 68% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(4), master_of_the_elements, primordial_surge, magma_chamber, fire_elemental, static_empowerment(5)
2:44.459 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
27.0/150: 18% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(4), primordial_surge_lava_burst_buff, primordial_surge, fire_elemental, static_empowerment(5)
2:45.700 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
44.0/150: 29% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(4), master_of_the_elements, primordial_surge, magma_chamber, fire_elemental, static_empowerment(5)
2:47.453 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
56.0/150: 37% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, lava_surge, master_of_the_elements, magma_chamber(3), fire_elemental, static_empowerment(5)
2:48.769 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
78.0/150: 52% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, master_of_the_elements, magma_chamber(4), fire_elemental, static_empowerment(5)
2:50.522 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
78.0/150: 52% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, fire_elemental, static_empowerment(5)
2:52.276 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
3.0/150: 2% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, fire_elemental, static_empowerment(5)
2:54.151 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
15.0/150: 10% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation, elemental_mastery, lava_surge, master_of_the_elements, magma_chamber(2), fire_elemental, static_empowerment(5)
2:55.391 single_target J icefury Fluffy_Pillow 50000.0/50000: 100% mana
37.0/150: 25% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, master_of_the_elements, magma_chamber(3), fire_elemental, static_empowerment(5)
2:57.045 single_target H frost_shock Fluffy_Pillow 48508.0/50000: 97% mana
62.0/150: 41% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, icefury(4), magma_chamber(4), fire_elemental, static_empowerment(5)
2:58.284 single_target F elemental_blast Fluffy_Pillow 49990.4/50000: 100% mana
82.0/150: 55% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(4), icefury(3), flux_melting, magma_chamber(5), fire_elemental, static_empowerment(5)
2:59.938 single_target B primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana
7.0/150: 5% maelstrom		 elemental_blast_haste, elemental_blast_mastery, elemental_mastery, icefury(3), flux_melting, fire_elemental, static_empowerment(5)
3:01.178 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
7.0/150: 5% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, primordial_wave, lava_surge, icefury(3), flux_melting, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber, static_empowerment(5)
3:02.417 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
41.0/150: 27% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(4), elemental_mastery, icefury(3), master_of_the_elements, primordial_surge, magma_chamber(2), static_empowerment(5)
3:04.072 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
53.0/150: 35% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), elemental_mastery, lava_surge, icefury(3), master_of_the_elements, primordial_surge, magma_chamber(3), static_empowerment(5)
3:05.313 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
70.0/150: 47% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), icefury(3), master_of_the_elements, primordial_surge, magma_chamber(4), static_empowerment(5)
3:06.554 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
78.0/150: 52% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), lava_surge, icefury(2), flux_melting, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(5), static_empowerment(5)
3:07.794 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
90.0/150: 60% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), icefury(2), master_of_the_elements, primordial_surge, magma_chamber(6), static_empowerment(5)
3:09.446 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
15.0/150: 10% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, lava_surge, icefury(2), primordial_surge_lava_burst_buff, primordial_surge, static_empowerment(5)
3:10.686 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
32.0/150: 21% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(2), elemental_mastery, icefury(2), master_of_the_elements, primordial_surge, magma_chamber, static_empowerment(5)
3:12.439 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
44.0/150: 29% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(3), elemental_mastery, lava_surge, icefury(2), master_of_the_elements, magma_chamber(2), static_empowerment(5)
3:13.756 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
61.0/150: 41% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(5), elemental_mastery, icefury(2), master_of_the_elements, magma_chamber(3), static_empowerment(5)
3:15.072 single_target K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana
69.0/150: 46% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(5), icefury, flux_melting, magma_chamber(3), burning_intensity, static_empowerment(5)
3:16.825 single_target F elemental_blast Fluffy_Pillow 49508.0/50000: 99% mana
79.0/150: 53% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(5), icefury, flux_melting, magma_chamber(5), burning_intensity(3), static_empowerment(5)
3:18.580 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
8.0/150: 5% maelstrom		 elemental_blast_critical_strike, elemental_mastery, icefury, flux_melting, burning_intensity(5), static_empowerment(5)
3:20.332 single_target C flame_shock Fluffy_Pillow 50000.0/50000: 100% mana
20.0/150: 13% maelstrom		 elemental_blast_critical_strike, seismic_accumulation, elemental_mastery, icefury, master_of_the_elements, magma_chamber, burning_intensity(7), static_empowerment(5)
3:21.647 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
25.0/150: 17% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(2), elemental_mastery, lava_surge, icefury, master_of_the_elements, magma_chamber(2), burning_intensity(8), static_empowerment(5)
3:22.962 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
42.0/150: 28% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(4), elemental_mastery, lava_surge, master_of_the_elements, magma_chamber(3), burning_intensity(9), static_empowerment(5)
3:24.277 single_target K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana
59.0/150: 39% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(5), master_of_the_elements, magma_chamber(3), burning_intensity(10), static_empowerment(5)
3:26.030 single_target B primordial_wave Fluffy_Pillow 49508.0/50000: 99% mana
69.0/150: 46% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(5), magma_chamber(5), burning_intensity(12), static_empowerment(5)
3:27.347 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
73.0/150: 49% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(5), primordial_wave, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(6), burning_intensity(14), static_empowerment(5)
3:28.663 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
107.0/150: 71% maelstrom		 elemental_blast_critical_strike, seismic_accumulation(5), master_of_the_elements, primordial_surge, magma_chamber(6), burning_intensity(15), static_empowerment(5)
3:30.416 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
107.0/150: 71% maelstrom		 elemental_blast_critical_strike, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, burning_intensity(17), static_empowerment(5)
3:31.732 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
124.0/150: 83% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, master_of_the_elements, primordial_surge, burning_intensity(18), static_empowerment(5)
3:33.483 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
49.0/150: 33% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, burning_intensity(20), static_empowerment(5)
3:34.800 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
66.0/150: 44% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, master_of_the_elements, primordial_surge, static_empowerment(5)
3:36.554 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
78.0/150: 52% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, lava_surge, master_of_the_elements, primordial_surge, magma_chamber(2), static_empowerment(5)
3:37.870 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
100.0/150: 67% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, master_of_the_elements, primordial_surge, magma_chamber(2), static_empowerment(5)
3:39.622 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
25.0/150: 17% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, static_empowerment(5)
3:40.938 single_target J icefury Fluffy_Pillow 50000.0/50000: 100% mana
42.0/150: 28% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, master_of_the_elements, static_empowerment(5)
3:42.690 single_target E lava_burst Fluffy_Pillow 48506.4/50000: 97% mana
67.0/150: 45% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(4), magma_chamber(2), static_empowerment(5)
3:44.444 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
79.0/150: 53% maelstrom		 elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, icefury(4), master_of_the_elements, magma_chamber(3), static_empowerment(5)
3:46.196 single_target C flame_shock Fluffy_Pillow 50000.0/50000: 100% mana
9.0/150: 6% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(4), static_empowerment(5)
3:47.510 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
9.0/150: 6% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(4), magma_chamber, static_empowerment(5)
3:48.826 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
26.0/150: 17% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(4), master_of_the_elements, magma_chamber(2), static_empowerment(5)
3:50.140 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
34.0/150: 23% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(3), flux_melting, magma_chamber(3), static_empowerment(5)
3:51.892 single_target B primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana
46.0/150: 31% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(3), icefury(3), master_of_the_elements, magma_chamber(4), static_empowerment(5)
3:53.345 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
51.0/150: 34% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(4), primordial_wave, lava_surge, icefury(3), master_of_the_elements, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(5), static_empowerment(5)
3:54.662 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
85.0/150: 57% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, seismic_accumulation(5), icefury(3), master_of_the_elements, primordial_surge, magma_chamber(5), static_empowerment(5)
3:56.414 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
85.0/150: 57% maelstrom		 elemental_blast_mastery, elemental_mastery, lava_surge, icefury(3), primordial_surge_lava_burst_buff, primordial_surge, burning_intensity(2), static_empowerment(5)
3:57.730 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
102.0/150: 68% maelstrom		 elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(3), master_of_the_elements, primordial_surge, magma_chamber, burning_intensity(4), static_empowerment(5)
3:59.484 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
102.0/150: 68% maelstrom		 elemental_blast_critical_strike, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(3), primordial_surge_lava_burst_buff, primordial_surge, burning_intensity(5), static_empowerment(5)
4:00.801 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
119.0/150: 79% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(3), master_of_the_elements, primordial_surge, magma_chamber, burning_intensity(7), static_empowerment(5)
4:02.453 default 6 use_items Fluffy_Pillow 50000.0/50000: 100% mana
44.0/150: 29% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(3), primordial_surge_lava_burst_buff, primordial_surge, burning_intensity(8), static_empowerment(5)
4:02.453 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
44.0/150: 29% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(3), primordial_surge_lava_burst_buff, primordial_surge, valarjars_path, burning_intensity(8), static_empowerment(5)
4:03.694 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
61.0/150: 41% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(3), master_of_the_elements, primordial_surge, magma_chamber, valarjars_path, burning_intensity(10), static_empowerment(5)
4:05.348 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
73.0/150: 49% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, lava_surge, icefury(3), master_of_the_elements, magma_chamber(2), valarjars_path, burning_intensity(11), static_empowerment(5)
4:06.588 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
95.0/150: 63% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, icefury(3), master_of_the_elements, magma_chamber(3), valarjars_path, burning_intensity(12), static_empowerment(5)
4:08.241 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
95.0/150: 63% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, valarjars_path, burning_intensity(14), static_empowerment(5)
4:09.895 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
95.0/150: 63% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, valarjars_path, burning_intensity(16), static_empowerment(5)
4:11.548 single_target C flame_shock Fluffy_Pillow 50000.0/50000: 100% mana
95.0/150: 63% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, valarjars_path, burning_intensity(17), static_empowerment(5)
4:12.789 single_target E lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
95.0/150: 63% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, magma_chamber, valarjars_path, burning_intensity(19), static_empowerment(5)
4:14.443 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
107.0/150: 71% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation, elemental_mastery, master_of_the_elements, magma_chamber(2), valarjars_path, burning_intensity(20), static_empowerment(5)
4:16.097 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
112.0/150: 75% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, valarjars_path, static_empowerment(5)
4:17.748 single_target J icefury Fluffy_Pillow 50000.0/50000: 100% mana
37.0/150: 25% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, valarjars_path, static_empowerment(5)
4:19.400 single_target E lava_burst Fluffy_Pillow 48504.8/50000: 97% mana
62.0/150: 41% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, elemental_mastery, icefury(4), magma_chamber, valarjars_path, static_empowerment(5)
4:21.055 single_target B primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana
86.0/150: 57% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation, elemental_mastery, icefury(4), master_of_the_elements, magma_chamber(3), valarjars_path, burning_intensity(2), static_empowerment(5)
4:22.296 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
91.0/150: 61% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, primordial_wave, lava_surge, icefury(4), master_of_the_elements, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(4), valarjars_path, burning_intensity(3), static_empowerment(5)
4:23.537 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
125.0/150: 83% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(5), icefury(4), master_of_the_elements, primordial_surge, magma_chamber(4), valarjars_path, burning_intensity(5), static_empowerment(5)
4:25.189 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
50.0/150: 33% maelstrom		 elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(4), primordial_surge_lava_burst_buff, primordial_surge, valarjars_path, burning_intensity(6), sophic_devotion, static_empowerment(5)
4:26.429 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
67.0/150: 45% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(4), master_of_the_elements, primordial_surge, valarjars_path, burning_intensity(8), sophic_devotion, static_empowerment(5)
4:28.083 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
79.0/150: 53% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(3), elemental_mastery, lava_surge, icefury(4), master_of_the_elements, primordial_surge, magma_chamber(2), valarjars_path, burning_intensity(9), sophic_devotion, static_empowerment(5)
4:29.325 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
101.0/150: 67% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(5), elemental_mastery, icefury(4), master_of_the_elements, primordial_surge, magma_chamber(2), valarjars_path, burning_intensity(10), sophic_devotion, static_empowerment(5)
4:30.977 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
26.0/150: 17% maelstrom		 elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, icefury(4), primordial_surge_lava_burst_buff, primordial_surge, valarjars_path, burning_intensity(12), sophic_devotion, static_empowerment(5)
4:32.219 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
43.0/150: 29% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, icefury(4), master_of_the_elements, primordial_surge, valarjars_path, burning_intensity(13), sophic_devotion, static_empowerment(5)
4:33.460 single_target E lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
51.0/150: 34% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(2), elemental_mastery, lava_surge, icefury(3), flux_melting, primordial_surge_lava_burst_buff, magma_chamber, burning_intensity(15), sophic_devotion, static_empowerment(5)
4:34.700 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
68.0/150: 45% maelstrom		 elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, icefury(3), master_of_the_elements, magma_chamber(2), burning_intensity(16), sophic_devotion, static_empowerment(5)
4:36.355 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
80.0/150: 53% maelstrom		 elemental_blast_haste, seismic_accumulation(5), icefury(3), master_of_the_elements, magma_chamber(3), burning_intensity(17), sophic_devotion, static_empowerment(5)
4:38.008 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
5.0/150: 3% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, icefury(3), burning_intensity(19), sophic_devotion, static_empowerment(5)
4:39.248 single_target I frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
13.0/150: 9% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, icefury(2), flux_melting, magma_chamber, burning_intensity(20), sophic_devotion, static_empowerment(5)
4:40.489 single_target C flame_shock Fluffy_Pillow 50000.0/50000: 100% mana
21.0/150: 14% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, icefury, flux_melting, magma_chamber(2), static_empowerment(5)
4:41.728 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
21.0/150: 14% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, elemental_mastery, icefury, flux_melting, magma_chamber(3), static_empowerment(5)
4:43.381 single_target H frost_shock Fluffy_Pillow 50000.0/50000: 100% mana
33.0/150: 22% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation, icefury, master_of_the_elements, magma_chamber(4), static_empowerment(5)
4:44.622 single_target K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana
46.0/150: 31% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(2), flux_melting, magma_chamber(5), static_empowerment(5)
4:46.275 single_target K lightning_bolt Fluffy_Pillow 49506.4/50000: 99% mana
56.0/150: 37% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(3), flux_melting, magma_chamber(6), static_empowerment(5)
4:47.928 single_target B primordial_wave Fluffy_Pillow 49506.4/50000: 99% mana
70.0/150: 47% maelstrom		 elemental_blast_critical_strike, elemental_blast_haste, seismic_accumulation(5), flux_melting, magma_chamber(7), static_empowerment(5)
4:49.294 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
74.0/150: 49% maelstrom		 seismic_accumulation(5), primordial_wave, lava_surge, flux_melting, primordial_surge_lava_burst_buff, primordial_surge, magma_chamber(8), static_empowerment(5)
4:50.612 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
103.0/150: 69% maelstrom		 seismic_accumulation(5), master_of_the_elements, primordial_surge, magma_chamber(9), static_empowerment(5)
4:52.363 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
28.0/150: 19% maelstrom		 elemental_blast_haste, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, static_empowerment(5)
4:53.604 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
45.0/150: 30% maelstrom		 elemental_blast_haste, seismic_accumulation(2), elemental_mastery, master_of_the_elements, primordial_surge, magma_chamber, static_empowerment(5)
4:55.256 single_target D lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
57.0/150: 38% maelstrom		 elemental_blast_haste, seismic_accumulation(3), elemental_mastery, lava_surge, master_of_the_elements, primordial_surge, magma_chamber(2), static_empowerment(5)
4:56.496 single_target F elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana
79.0/150: 53% maelstrom		 elemental_blast_haste, seismic_accumulation(5), elemental_mastery, master_of_the_elements, primordial_surge, magma_chamber(3), static_empowerment(5)
4:58.151 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
4.0/150: 3% maelstrom		 elemental_blast_haste, elemental_blast_mastery, elemental_mastery, lava_surge, primordial_surge_lava_burst_buff, primordial_surge, burning_intensity(2), static_empowerment(5)
4:59.392 single_target G lava_burst Fluffy_Pillow 50000.0/50000: 100% mana
38.0/150: 25% maelstrom		 ascendance, elemental_blast_haste, elemental_blast_mastery, seismic_accumulation(4), elemental_mastery, master_of_the_elements, primordial_surge, magma_chamber, burning_intensity(3), static_empowerment(5)

Stats

Level Bonus (70) Race Bonus (tauren) Raid-Buffed Unbuffed Gear Amount
Strength 898 2 1242 1156 256
Agility 2089 -2 2173 2087 0
Stamina 3463 2 18226 17359 13551
Intellect 2089 -2 10381 9587 7044 (3612)
Spirit 0 0 0 0 0
Health 364520 347180 0
Mana 50000 50000 0
Maelstrom 150 150 0
Spell Power 10381 9587 0
Crit 14.31% 14.31% 1675
Haste 14.41% 14.41% 2450
Versatility 8.20% 5.20% 1065
Mana Regen 1600 1600 0
Attack Power 2282 2087 0
Mastery 73.11% 73.11% 5598
Armor 8575 8575 8575
Run Speed 7 0 250

Gear

Source Slot Average Item Level: 423.00
Local Head Faceguard of Infused Earth
ilevel: 424, stats: { 630 Armor, +1383 Sta, +547 Haste, +239 Mastery, +512 AgiInt }, gems: { +70 Haste, +33 Mastery }
Local Neck Ukhel Ancestry Beads
ilevel: 421, stats: { +750 Sta, +380 Haste, +830 Mastery }, gems: { +75 StrAgiInt, +66 Haste, +70 Haste, +33 Mastery, +70 Haste, +33 Mastery }
Local Shoulders Calderas of Infused Earth
ilevel: 424, stats: { 578 Armor, +1037 Sta, +181 Vers, +408 Mastery, +384 AgiInt }
Local Chest Robe of Infused Earth
ilevel: 424, stats: { 840 Armor, +1383 Sta, +272 Crit, +514 Mastery, +512 AgiInt }, enchant: { +150 StrAgiInt }
Local Waist Morningscale Waistguard
ilevel: 421, stats: { 464 Armor, +1000 Sta, +308 Haste, +262 Mastery, +374 AgiInt }, gems: { +70 Haste, +33 Mastery }
Local Legs Leggings of Infused Earth
ilevel: 424, stats: { 735 Armor, +1383 Sta, +539 Crit, +247 Mastery, +512 AgiInt }, enchant: { +177 Int, +105 Sta }
Local Feet Lightning-Charged Striders
ilevel: 421, stats: { 515 Armor, +1000 Sta, +203 Haste, +378 Mastery, +374 AgiInt }, enchant: { +250 RunSpeed }
Local Wrists Surging-Song Conductors
ilevel: 421, stats: { 412 Armor, +750 Sta, +141 Vers, +295 Mastery, +280 AgiInt }, gems: { +70 Haste, +33 Mastery }
Local Hands Gauntlets of Infused Earth
ilevel: 424, stats: { 473 Armor, +1037 Sta, +421 Crit, +168 Mastery, +384 AgiInt }
Local Finger1 Seal of Filial Duty
ilevel: 430, stats: { +841 Sta, +320 Haste, +967 Mastery }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Mastery }
item effects: { equip: Broodkeeper's Barrier }
Local Finger2 Signet of Shifting Magics
ilevel: 421, stats: { +280 Int, +750 Sta, +190 Vers, +273 Mastery }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Mastery }
Local Trinket1 Horn of Valor
ilevel: 421, stats: { +553 Vers }
item effects: { use: Valarjar's Path }
Local Trinket2 Infernal Writ
ilevel: 421, stats: { +473 Int }
item effects: { equip: Burning Intensity }
Local Back Cloak of Failing Will
ilevel: 421, stats: { 224 Armor, +750 Sta, +166 Crit, +249 Mastery, +280 StrAgiInt }
Local Main Hand Stormlash's Last Resort
ilevel: 424, weapon: { 196 - 328, 1.8 }, stats: { +256 Int, +1235 Int, +691 Sta, +277 Crit, +116 Mastery }, enchant: sophic_devotion_3
Local Off Hand Broodsworn Legionnaire's Pavise
ilevel: 424, stats: { 3704 Armor, +256 Str, +786 Int, +691 Sta, +136 Haste, +257 Mastery }

Talents

Talent Tables

RowShaman Talents [10]
1
2
3
4
5
6
7
8
9
10
RowElemental Talents [28]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="T29_Shaman_Elemental"
source=default
spec=elemental
level=70
race=tauren
role=spell
position=ranged_back
talents=BYQAAAAAAAAAAAAAAAAAAAAAAAAAAAAgUiikAQSJJFKhDIJJRAAAAAAAAIABAEUCQAB
class_talents=improved_lightning_bolt:2/natures_fury:2/frost_shock:1/totemic_surge:2/fire_and_ice:1/totemic_recall:1/call_of_the_elements:1
spec_talents=earth_shock:1/earthquake:1/elemental_fury:1/fire_elemental:1/storm_elemental:0/inundate:0/call_of_thunder:0/flow_of_power:1/lava_surge:1/unrelenting_calamity:0/icefury:1/swelling_maelstrom:1/echo_of_the_elements:1/call_of_fire:1/stormkeeper:0/flux_melting:1/electrified_shocks:0/aftershock:1/surge_of_power:0/flames_of_the_cauldron:1/flash_of_lightning:0/eye_of_the_storm:2/power_of_the_maelstrom:0/master_of_the_elements:2/improved_flametongue_weapon:1/elemental_blast:1/primordial_wave:1/deeply_rooted_elements:1/ascendance:0/primal_elementalist:0/liquid_magma_totem:0/echoes_of_great_sundering:0/elemental_equilibrium:0/rolling_magma:2/echo_chamber:2/oath_of_the_far_seer:0/magma_chamber:1/searing_flames:0/lightning_rod:0/primordial_surge:1/splintered_elements:0/mountains_will_fall:1/further_beyond:0/windspeakers_lava_resurgence:0/skybreakers_fiery_demise:0

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_static_empowerment_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Ensure weapon enchant is applied.
actions.precombat+=/flametongue_weapon,if=talent.improved_flametongue_weapon.enabled
actions.precombat+=/potion

# Executed every time the actor is available.
# Enable more movement.
actions=spiritwalkers_grace,moving=1,if=movement.distance>6
# Interrupt of casts.
actions+=/wind_shear
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/bag_of_tricks,if=!talent.ascendance.enabled|!buff.ascendance.up
actions+=/use_items
actions+=/auto_attack
actions+=/natures_swiftness
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_target

# Keep your cooldowns rolling.
actions.aoe=fire_elemental
# Keep your cooldowns rolling.
actions.aoe+=/storm_elemental
# Keep your cooldowns rolling.
actions.aoe+=/stormkeeper,if=!buff.stormkeeper.up
# Spread Flame Shock using Surge of Power. Don't waste buffs by resets (resets are gone, but I'll keep that logic here).
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,if=!buff.primordial_wave.up&buff.surge_of_power.up&!buff.splintered_elements.up
# Spread Flame Shock using Surge of Power. Don't waste buffs by resets (resets are gone, but I'll keep that logic here).
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,if=!buff.primordial_wave.up&talent.deeply_rooted_elements.enabled&!talent.surge_of_power.enabled&!buff.splintered_elements.up
# Spread Flame Shock using Surge of Power. Don't waste buffs by resets (resets are gone, but I'll keep that logic here).
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,if=!buff.primordial_wave.up&talent.master_of_the_elements.enabled&!talent.lightning_rod.enabled
# Spread Flame Shock using Surge of Power.
actions.aoe+=/flame_shock,target_if=refreshable,if=buff.surge_of_power.up&(!talent.lightning_rod.enabled|talent.skybreakers_fiery_demise.enabled)
# Spread Flame Shock against low target counts if Master of the Elements was selected.
actions.aoe+=/flame_shock,target_if=refreshable,if=talent.master_of_the_elements.enabled&!talent.lightning_rod.enabled
# Spread Flame Shock to gamble on Deeply Rooted Element procs.
actions.aoe+=/flame_shock,target_if=refreshable,if=talent.deeply_rooted_elements.enabled&!talent.surge_of_power.enabled
# JUST DO IT! https://i.kym-cdn.com/entries/icons/mobile/000/018/147/Shia_LaBeouf__Just_Do_It__Motivational_Speech_(Original_Video_by_LaBeouf__R%C3%B6nkk%C3%B6___Turner)_0-4_screenshot.jpg
actions.aoe+=/ascendance
# Keep your cooldowns rolling.
actions.aoe+=/liquid_magma_totem
# Cast Lava Burst to buff your immediately follow-up Earthquake with Master of the Elements.
actions.aoe+=/lava_burst,target_if=dot.flame_shock.remains,if=cooldown_react&buff.lava_surge.up&talent.master_of_the_elements.enabled&!buff.master_of_the_elements.up&(maelstrom>=60-5*talent.eye_of_the_storm.rank-2*talent.flow_of_power.enabled)&(!talent.echoes_of_great_sundering.enabled|buff.echoes_of_great_sundering.up)&(!buff.ascendance.up&active_enemies>3&talent.unrelenting_calamity.enabled|active_enemies>3&!talent.unrelenting_calamity.enabled|active_enemies=3)
# Use the talents you selected. Did you invest only 1 point in it? In this case this'll be a DPS decrease.
actions.aoe+=/earthquake,if=!talent.echoes_of_great_sundering.enabled&active_enemies>3&(spell_targets.chain_lightning>3|spell_targets.lava_beam>3)
# Use the talents you selected. Did you invest only 1 point in it? In this case this'll be a DPS decrease.
actions.aoe+=/earthquake,if=!talent.echoes_of_great_sundering.enabled&!talent.elemental_blast.enabled&active_enemies=3&(spell_targets.chain_lightning=3|spell_targets.lava_beam=3)
# Use the talents you selected. Did you invest only 1 point in it? In this case this'll be a DPS decrease.
actions.aoe+=/earthquake,if=buff.echoes_of_great_sundering.up
# Use the talents you selected. Did you invest only 1 point in it? In this case this'll be a DPS decrease. Spread Lightning Rod to as many targets as possible.
actions.aoe+=/elemental_blast,target_if=min:debuff.lightning_rod.remains,if=talent.echoes_of_great_sundering.enabled
# Use the talents you selected. Did you invest only 1 point in it? In this case this'll be a DPS decrease.
actions.aoe+=/elemental_blast,if=talent.echoes_of_great_sundering.enabled
# Elemental Blast is stronger than Earthquake against 3 targets.
actions.aoe+=/elemental_blast,if=enemies=3&!talent.echoes_of_great_sundering.enabled
# Use the talents you selected. Did you invest only 1 point in it? In this case this'll be a DPS decrease. Spread Lightning Rod to as many targets as possible.
actions.aoe+=/earth_shock,target_if=min:debuff.lightning_rod.remains,if=talent.echoes_of_great_sundering.enabled
# Use the talents you selected. Did you invest only 1 point in it? In this case this'll be a DPS decrease.
actions.aoe+=/earth_shock,if=talent.echoes_of_great_sundering.enabled
# Stormkeeper is strong and should be used.
actions.aoe+=/lava_beam,if=buff.stormkeeper.up
# Stormkeeper is strong and should be used.
actions.aoe+=/chain_lightning,if=buff.stormkeeper.up
# Power of the Maelstrom is strong and should be used.
actions.aoe+=/lava_beam,if=buff.power_of_the_maelstrom.up
# Power of the Maelstrom is strong and should be used.
actions.aoe+=/chain_lightning,if=buff.power_of_the_maelstrom.up
# Against 6 targets or more Surge of Power should be used with Lava Beam rather than Lava Burst.
actions.aoe+=/lava_beam,if=active_enemies>=6&buff.surge_of_power.up
# Against 6 targets or more Surge of Power should be used with Chain Lightning rather than Lava Burst.
actions.aoe+=/chain_lightning,if=active_enemies>=6&buff.surge_of_power.up
# Proc Deeply Rooted Elements against 3 targets.
actions.aoe+=/lava_burst,target_if=dot.flame_shock.remains,if=buff.lava_surge.up&talent.deeply_rooted_elements.enabled&buff.windspeakers_lava_resurgence.up
# Consume Master of the Elements with Lava Beam.
actions.aoe+=/lava_beam,if=buff.master_of_the_elements.up
# Proc Master of the Elements against 3 targets.
actions.aoe+=/lava_burst,target_if=dot.flame_shock.remains,if=enemies=3&talent.master_of_the_elements.enabled
# Gamble away for Deeply Rooted Elements procs whenever Lava Surge makes Lava Burst more efficient.
actions.aoe+=/lava_burst,target_if=dot.flame_shock.remains,if=buff.lava_surge.up&talent.deeply_rooted_elements.enabled
# Use Icefury if you can get the full benefit from Electrified Shocks. If more targets are present ignore it.
actions.aoe+=/icefury,if=talent.electrified_shocks.enabled&active_enemies<5
# Spread out your Frost Shock casts to empower as many Chain Lightnings as possible.
actions.aoe+=/frost_shock,if=buff.icefury.up&talent.electrified_shocks.enabled&!debuff.electrified_shocks.up&active_enemies<5
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning
actions.aoe+=/flame_shock,moving=1,target_if=refreshable
actions.aoe+=/frost_shock,moving=1

# Keep your cooldowns rolling.
actions.single_target=fire_elemental
# Keep your cooldowns rolling.
actions.single_target+=/storm_elemental
# Reset LMT CD as early as possible.
actions.single_target+=/totemic_recall,if=cooldown.liquid_magma_totem.remains>45
# Keep your cooldowns rolling.
actions.single_target+=/liquid_magma_totem
# Use Primordial Wave as much as possible without wasting buffs.
actions.single_target+=/primordial_wave,target_if=min:dot.flame_shock.remains,if=!buff.primordial_wave.up&!buff.splintered_elements.up
actions.single_target+=/flame_shock,target_if=min:dot.flame_shock.remains,if=active_enemies=1&refreshable&!buff.surge_of_power.up
# Spread Flame Shock to multiple targets only if talents were selected that benefit from it.
actions.single_target+=/flame_shock,target_if=min:dot.flame_shock.remains,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&refreshable&!buff.surge_of_power.up&(talent.deeply_rooted_elements.enabled|talent.ascendance.enabled|talent.primordial_wave.enabled|talent.searing_flames.enabled|talent.magma_chamber.enabled),cycle_targets=1
actions.single_target+=/stormkeeper,if=!buff.ascendance.up&!buff.stormkeeper.up
actions.single_target+=/ascendance,if=!buff.stormkeeper.up
# Stormkeeper is strong and should be used.
actions.single_target+=/lightning_bolt,if=buff.stormkeeper.up&buff.surge_of_power.up
# Stormkeeper is strong and should be used.
actions.single_target+=/lava_beam,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&buff.stormkeeper.up&!talent.surge_of_power.enabled
# Stormkeeper is strong and should be used.
actions.single_target+=/chain_lightning,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&buff.stormkeeper.up&!talent.surge_of_power.enabled
# Buff stormkeeper with MotE when not using Surge.
actions.single_target+=/lava_burst,if=buff.stormkeeper.up&!buff.master_of_the_elements.up&!talent.surge_of_power.enabled&talent.master_of_the_elements.enabled
# Stormkeeper is strong and should be used.
actions.single_target+=/lightning_bolt,if=buff.stormkeeper.up&!talent.surge_of_power.enabled&buff.master_of_the_elements.up
# Stormkeeper is strong and should be used.
actions.single_target+=/lightning_bolt,if=buff.stormkeeper.up&!talent.surge_of_power.enabled&!talent.master_of_the_elements.enabled
# Surge of Power is strong and should be used.
actions.single_target+=/lightning_bolt,if=buff.surge_of_power.up
actions.single_target+=/icefury,if=talent.electrified_shocks.enabled
actions.single_target+=/frost_shock,if=buff.icefury.up&talent.electrified_shocks.enabled&(!debuff.electrified_shocks.up|buff.icefury.remains<=gcd)
actions.single_target+=/frost_shock,if=buff.icefury.up&talent.electrified_shocks.enabled&maelstrom>=50&debuff.electrified_shocks.remains<2*gcd&buff.stormkeeper.up
actions.single_target+=/lava_beam,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&buff.power_of_the_maelstrom.up
# Windspeaker's Lava Resurgence is strong. Don't sit on it.
actions.single_target+=/lava_burst,if=buff.windspeakers_lava_resurgence.up
# Lava Surge is neat. Utilize it.
actions.single_target+=/lava_burst,if=cooldown_react&buff.lava_surge.up
# Buff your next Maelstrom Spender with MotE if it won't cap your maelstrom.
actions.single_target+=/lava_burst,if=talent.master_of_the_elements.enabled&!buff.master_of_the_elements.up&maelstrom>=50&!talent.swelling_maelstrom.enabled&maelstrom<=80
# Buff your next Maelstrom Spender with MotE if it won't cap your maelstrom.
actions.single_target+=/lava_burst,if=talent.master_of_the_elements.enabled&!buff.master_of_the_elements.up&maelstrom>=50&talent.swelling_maelstrom.enabled&maelstrom<=130
# Use the talents you selected. Did you invest only 1 point in it? In this case this'll be a DPS decrease. Additionally Elemental Blast is stronger than EoGS. In this case don't use Earthquake on single target.
actions.single_target+=/earthquake,if=buff.echoes_of_great_sundering.up&(!talent.elemental_blast.enabled&active_enemies<2|active_enemies>1)
# Use Earthquake against two enemies unless you have to alternate because of Echoes of Great Sundering.
actions.single_target+=/earthquake,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)&!talent.echoes_of_great_sundering.enabled&!talent.elemental_blast.enabled
actions.single_target+=/elemental_blast
actions.single_target+=/earth_shock
# Utilize present buffs.
actions.single_target+=/lava_burst,target_if=dot.flame_shock.remains>2,if=buff.flux_melting.up&active_enemies>1
# Single target Lava Burst is stronk.
actions.single_target+=/lava_burst,target_if=dot.flame_shock.remains>2,if=enemies=1&talent.deeply_rooted_elements.enabled
# Spread out your Icefury usage if you can get more use out of accompanied buffs.
actions.single_target+=/frost_shock,if=buff.icefury.up&talent.flux_melting.enabled&!buff.flux_melting.up
# Spread out your Icefury usage if you can get more use out of accompanied buffs.
actions.single_target+=/frost_shock,if=buff.icefury.up&(talent.electrified_shocks.enabled&!debuff.electrified_shocks.up|buff.icefury.remains<6)
# Utilize the Power of the Maelstrom buff if your Lightning Bolt is empowered by Unrelenting Calamity.
actions.single_target+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&talent.unrelenting_calamity.enabled
actions.single_target+=/icefury
# Spam Lightning Bolt if Storm Elemental is active. But honor all previous priorities.
actions.single_target+=/lightning_bolt,if=pet.storm_elemental.active&debuff.lightning_rod.up&(debuff.electrified_shocks.up|buff.power_of_the_maelstrom.up)
# If you have MotE up and aren't at risk of capping LvB, spend MotE on FrS/LB.
actions.single_target+=/frost_shock,if=buff.icefury.up&buff.master_of_the_elements.up&!buff.lava_surge.up&!talent.electrified_shocks.enabled&!talent.flux_melting.enabled&cooldown.lava_burst.charges_fractional<1.0&talent.echoes_of_the_elements.enabled
# If you have MotE up and aren't at risk of capping LvB, spend MotE on FrS/LB.
actions.single_target+=/lightning_bolt,if=buff.master_of_the_elements.up&!buff.lava_surge.up&(cooldown.lava_burst.charges_fractional<1.0&talent.echoes_of_the_elements.enabled)
actions.single_target+=/lava_burst,target_if=dot.flame_shock.remains>2
# Use your Icefury buffs if you didn't improve the talent.
actions.single_target+=/frost_shock,if=buff.icefury.up&!talent.electrified_shocks.enabled&!talent.flux_melting.enabled
# Casting Chain Lightning at two targets is mor efficient than Lightning Bolt.
actions.single_target+=/chain_lightning,if=active_enemies>1&(spell_targets.chain_lightning>1|spell_targets.lava_beam>1)
# Filler spell. Always available. Always the bottom line.
actions.single_target+=/lightning_bolt
actions.single_target+=/flame_shock,moving=1,target_if=refreshable
actions.single_target+=/flame_shock,moving=1,if=movement.distance>6
# Frost Shock is our movement filler.
actions.single_target+=/frost_shock,moving=1

head=faceguard_of_infused_earth,id=200399,ilevel=424,gem_id=192948
neck=ukhel_ancestry_beads,id=193676,ilevel=421,gem_id=192985/192948/192948
shoulders=calderas_of_infused_earth,id=200401,ilevel=424
back=cloak_of_failing_will,id=144115,ilevel=421
chest=robe_of_infused_earth,id=200396,ilevel=424,enchant=waking_stats_3
wrists=surgingsong_conductors,id=195516,ilevel=421,gem_id=192948
hands=gauntlets_of_infused_earth,id=200398,ilevel=424
waist=morningscale_waistguard,id=109843,ilevel=421,gem_id=192948
legs=leggings_of_infused_earth,id=200400,ilevel=424,enchant=frozen_spellthread_3
feet=lightningcharged_striders,id=193685,ilevel=421,enchant_id=6607
finger1=seal_of_filial_duty,id=195526,ilevel=430,gem_id=192948,enchant_id=6562
finger2=signet_of_shifting_magics,id=109780,ilevel=421,gem_id=192948,enchant_id=6562
trinket1=horn_of_valor,id=133642,ilevel=421
trinket2=infernal_writ,id=137485,ilevel=421
main_hand=stormlashs_last_resort,id=195529,ilevel=424,enchant=sophic_devotion_3
off_hand=broodsworn_legionnaires_pavise,id=195520,ilevel=424

# Gear Summary
# gear_ilvl=422.88
# gear_strength=256
# gear_stamina=13551
# gear_intellect=7044
# gear_crit_rating=1675
# gear_haste_rating=2450
# gear_mastery_rating=5598
# gear_versatility_rating=1065
# gear_speed_rating=250
# gear_armor=8575
# set_bonus=tier29_2pc=1
# set_bonus=tier29_4pc=1

T29_Shaman_Enhancement : 88899 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
88899.3 88899.3 65.4 / 0.074% 11438.5 / 12.9% 111.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
761.0 759.0 Mana 0.31% 55.6 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T29_Shaman_Enhancement 88899
Broodkeeper's Blaze 1542 1.7% 15.6 18.52sec 29684 0 Periodic 42.0 9140 18374 10999 20.1% 0.0% 28.0%

Stats Details: Broodkeepers Blaze

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.58 0.00 42.05 42.05 3.79 0.0000 2.0000 462459.45 462459.45 0.00% 5499.45 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.87% 33.58 11 66 9140.08 9073 9339 9139.92 9073 9339 306941 306941 0.00%
crit 20.13% 8.46 0 22 18373.72 18145 18678 18358.64 0 18678 155519 155519 0.00%

Action Details: Broodkeepers Blaze

  • id:394453
  • school:flamestrike
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:7252.16
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394453
  • name:Broodkeeper's Blaze
  • school:flamestrike
  • tooltip:Burning for 6 sec.
  • description:
Elemental Blast 15401 17.3% 23.2 12.79sec 199341 178990 Direct 23.2 160760 322343 199413 23.9% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 23.18 23.18 0.00 0.00 0.00 1.1137 0.0000 4621528.10 4621528.10 0.00% 178990.24 178990.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.08% 17.63 8 28 160759.54 85396 281732 160702.97 135771 200442 2834645 2834645 0.00%
crit 23.92% 5.54 0 14 322342.84 170791 565066 321232.74 0 475997 1786883 1786883 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [N]:23.18
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 8728 9.8% 85.9 3.47sec 30457 374417 Direct 85.9 10420 20951 12552 20.2% 0.0%
Periodic 206.8 6177 12422 7443 20.3% 0.0% 98.9%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 85.94 85.94 206.75 206.75 84.94 0.0814 1.4345 2617548.78 2617548.78 0.00% 8622.21 374416.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.75% 68.54 33 104 10419.52 4443 19531 10416.85 9309 11786 714167 714167 0.00%
crit 20.25% 17.40 4 35 20950.57 8886 39300 20944.39 18178 27059 364584 364584 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 79.73% 164.84 115 214 6176.67 2643 10823 6175.56 5621 6830 1018139 1018139 0.00%
crit 20.27% 41.92 19 76 12421.72 5286 21516 12417.60 11018 14678 520660 520660 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [V]:6.29
Flametongue Weapon 0 (1702) 0.0% (1.9%) 1.0 0.00sec 510384 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 1702 1.9% 719.8 0.69sec 709 0 Direct 719.8 589 1183 709 20.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 719.75 719.75 0.00 0.00 0.00 0.0000 0.0000 510383.94 510383.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.74% 573.96 411 766 588.74 541 749 588.63 563 620 337915 337915 0.00%
crit 20.26% 145.80 87 213 1182.92 1082 1498 1182.77 1132 1253 172469 172469 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Frost Shock 10384 11.7% 44.7 6.65sec 69699 66170 Direct 44.7 57861 116195 69699 20.3% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.68 44.68 0.00 0.00 0.00 1.0534 0.0000 3114222.44 3114222.44 0.00% 66169.95 66169.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.71% 35.61 21 53 57861.47 14355 167598 57931.92 46179 70415 2060629 2060629 0.00%
crit 20.29% 9.07 1 21 116195.27 28710 307370 116432.96 53408 208626 1053593 1053593 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [M]:42.67
  • if_expr:buff.hailstorm.up
    single
    [T]:2.01
Ice Strike 3577 4.0% 26.3 11.45sec 40823 37673 Direct 26.3 33874 68080 40824 20.3% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.27 26.27 0.00 0.00 0.00 1.0836 0.0000 1072625.07 1072625.07 0.00% 37672.98 37672.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.68% 20.94 10 30 33874.11 28132 61791 33872.60 30380 38526 709220 709220 0.00%
crit 20.32% 5.34 0 15 68079.66 56265 118807 67755.41 0 101642 363405 363405 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:26.28
  • if_expr:talent.hailstorm.enabled
Lava Lash 17924 20.2% 72.8 4.05sec 73814 68079 Direct 72.8 (72.8) 61209 123193 73814 20.3% (20.3%) 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 72.80 72.80 0.00 0.00 0.00 1.0842 0.0000 5373764.89 5373764.89 0.00% 68079.22 68079.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.66% 58.00 23 93 61209.13 33183 180091 61257.25 54469 70294 3549922 3549922 0.00%
crit 20.34% 14.80 2 33 123192.64 67693 319536 123334.98 97423 163108 1823843 1823843 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=true}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [I]:57.60
  • if_expr:buff.hot_hand.up|buff.ashen_catalyst.stack=8
    single
    [Q]:15.20
Lightning Bolt 7819 8.8% 21.6 13.93sec 108504 94660 Direct 21.6 87103 174922 108503 24.4% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 21.60 21.60 0.00 0.00 0.00 1.1463 0.0000 2343959.50 2343959.50 0.00% 94659.54 94659.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 75.63% 16.34 7 26 87102.89 54009 178183 87169.23 72667 108115 1423090 1423090 0.00%
crit 24.37% 5.26 0 14 174922.47 108018 335513 174620.22 0 265415 920869 920869 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [K]:6.97
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
    single
    [O]:3.90
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [R]:10.73
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 2748 3.1% 208.7 1.67sec 3950 2415 Direct 208.7 3793 7624 3950 20.3% 16.4%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 208.69 208.69 0.00 0.00 0.00 1.6355 0.0000 824248.81 1177528.33 30.00% 2414.86 2414.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.37% 132.26 87 183 3792.98 3545 4726 3792.24 3636 3981 501643 716651 30.00%
crit 20.28% 42.31 18 74 7624.28 7090 9451 7622.55 7260 8100 322606 460878 30.00%
miss 16.35% 34.13 13 60 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Manic Grieftorch 3784 4.2% 26.8 9.33sec 41811 0 Direct 26.8 34788 69938 41812 20.0% 0.0%

Stats Details: Manic Grieftorch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.82 26.82 0.00 0.00 0.00 0.0000 0.0000 1121514.83 1121514.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.02% 21.46 10 27 34788.12 34529 35543 34787.20 34529 35543 746719 746719 0.00%
crit 19.98% 5.36 0 14 69937.86 69059 71087 69724.32 0 71087 374796 374796 0.00%

Action Details: Manic Grieftorch

  • id:382135
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27599.74
  • base_dd_max:27599.74
  • base_dd_mult:1.00

Spelldata

  • id:382135
  • name:Manic Grieftorch
  • school:fire
  • tooltip:
  • description:Channel for 2 seconds, unleashing a furious volley of flame around your target, dealing [A Lot] fire damage. Whenever an allied player dies, this cooldown is reduced by 90 seconds.
offhand 1365 1.5% 207.4 1.67sec 1974 1204 Direct 207.4 1897 3814 1974 20.3% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 207.37 207.37 0.00 0.00 0.00 1.6399 0.0000 409295.91 584723.35 30.00% 1203.58 1203.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 63.31% 131.29 81 186 1897.31 1773 2363 1896.94 1819 1994 249095 355860 30.00%
crit 20.26% 42.01 19 74 3813.69 3545 4726 3812.91 3603 4049 160201 228864 30.00%
miss 16.43% 34.08 13 65 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Primordial Wave 234 (4627) 0.3% (5.2%) 7.0 45.71sec 198020 176222 Direct 7.0 (14.0) 8310 16689 10013 20.3% (22.1%) 0.0%

Stats Details: Primordial Wave

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.01 7.00 0.00 0.00 0.00 1.1237 0.0000 70130.38 70130.38 0.00% 176222.27 176222.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.68% 5.58 1 8 8309.99 7672 11249 8307.65 7672 10126 46376 46376 0.00%
crit 20.32% 1.42 0 6 16688.87 15343 22499 13240.53 0 20848 23755 23755 0.00%

Action Details: Primordial Wave

  • id:375982
  • school:shadow
  • range:40.0
  • travel_speed:40.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:375982
  • name:Primordial Wave
  • school:shadow
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]

Action Priority List

    single
    [J]:7.01
  • if_expr:buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
    Lightning Bolt (_pw) 4393 4.9% 7.0 45.85sec 188850 0 Direct 7.0 152090 306161 188851 23.9% 0.0%

Stats Details: Lightning Bolt Pw

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.97 6.97 0.00 0.00 0.00 0.0000 0.0000 1317091.33 1317091.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.14% 5.31 0 8 152090.05 126021 243667 151993.67 0 199607 807651 807651 0.00%
crit 23.86% 1.66 0 7 306161.34 252041 487335 258756.93 0 457418 509441 509441 0.00%

Action Details: Lightning Bolt Pw

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
Stormstrike 0 (2925) 0.0% (3.3%) 49.4 5.94sec 17758 16299

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.40 0.00 0.00 0.00 0.00 1.0896 0.0000 0.00 0.00 0.00% 16298.62 16298.62

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [P]:49.40
    Stormstrike (_mh) 1950 2.2% 49.4 5.94sec 11839 0 Direct 49.4 9823 19744 11839 20.3% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.40 49.40 0.00 0.00 0.00 0.0000 0.0000 584883.23 835568.78 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.68% 39.36 18 63 9822.83 9185 12244 9820.97 9332 10397 386651 552373 30.00%
crit 20.32% 10.04 0 22 19744.13 18370 24488 19733.06 0 22532 198232 283196 29.99%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 975 1.1% 49.4 5.94sec 5919 0 Direct 49.4 4911 9873 5919 20.3% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.40 49.40 0.00 0.00 0.00 0.0000 0.0000 292406.26 417733.88 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.69% 39.37 18 64 4911.31 4592 6122 4910.46 4694 5234 193362 276239 30.00%
crit 20.31% 10.03 2 22 9873.03 9185 12244 9869.85 9185 10999 99044 141495 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Sundering 1252 1.4% 5.1 58.66sec 73021 67874 Direct 5.1 60507 122041 73024 20.3% 0.0%

Stats Details: Sundering

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.14 5.14 0.00 0.00 0.00 1.0759 0.0000 375613.15 375613.15 0.00% 67873.72 67873.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.66% 4.10 0 8 60507.44 50013 109186 60428.98 0 91600 247942 247942 0.00%
crit 20.34% 1.05 0 6 122041.18 100026 218373 82818.30 0 218373 127671 127671 0.00%

Action Details: Sundering

  • id:197214
  • school:flamestrike
  • range:0.0
  • travel_speed:0.0000
  • radius:11.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:40.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:mana
  • base_cost:3000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.

Action Priority List

    single
    [S]:5.14
  • if_expr:raid_event.adds.in>=40
Windfury Weapon 0 (1240) 0.0% (1.4%) 1.0 0.00sec 371828 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 1240 1.4% 168.9 3.66sec 2202 0 Direct 168.9 1827 3674 2202 20.3% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 168.87 168.87 0.00 0.00 0.00 0.0000 0.0000 371828.23 531196.73 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.72% 134.62 76 208 1827.40 1708 2277 1827.12 1748 1930 246004 351443 30.00%
crit 20.28% 34.25 10 61 3673.80 3416 4554 3673.13 3478 3935 125824 179754 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=false}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=false}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
pet - greater_earth_elemental 698 / 143
melee 698 0.2% 41.6 1.85sec 1022 708 Direct 41.6 851 1701 1022 20.1% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.63 41.63 0.00 0.00 0.00 1.4426 0.0000 42547.59 60783.82 30.00% 708.48 708.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.87% 33.25 0 61 850.77 799 1065 849.94 0 965 28289 40413 30.00%
crit 20.13% 8.38 0 24 1701.37 1597 2129 1699.47 0 2001 14259 20371 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - frost_wolf 3785 / 1245
melee 3785 1.4% 108.0 2.88sec 3453 3286 Direct 108.0 2870 5738 3453 20.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 108.05 108.05 0.00 0.00 0.00 1.0509 0.0000 373102.14 533016.64 30.00% 3285.88 3285.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.66% 86.07 8 199 2869.72 2669 3557 2868.61 2669 3238 247001 352868 30.00%
crit 20.34% 21.98 0 54 5737.93 5337 7115 5735.95 0 6593 126101 180149 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - fiery_wolf 3797 / 1249
melee 3797 1.4% 108.3 2.88sec 3455 3287 Direct 108.3 2870 5738 3455 20.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 108.31 108.31 0.00 0.00 0.00 1.0511 0.0000 374204.70 534591.78 30.00% 3287.02 3287.02
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.61% 86.22 9 190 2870.03 2669 3557 2868.46 2669 3251 247461 353525 30.00%
crit 20.39% 22.09 0 57 5738.21 5337 7115 5735.47 0 6538 126744 181067 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - lightning_wolf 3773 / 1244
melee 3773 1.4% 108.3 2.89sec 3440 3270 Direct 108.3 2858 5714 3440 20.4% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 108.34 108.34 0.00 0.00 0.00 1.0521 0.0000 372737.67 532495.96 30.00% 3270.12 3270.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.60% 86.24 9 202 2857.62 2669 3557 2857.40 2669 3168 246446 352075 30.00%
crit 20.40% 22.10 0 61 5713.83 5337 7115 5712.11 0 6455 126292 180421 29.99%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
T29_Shaman_Enhancement
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.37sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 311.02sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.07 0.00 0.00 0.00 0.00 0.9710 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [U]:1.07
Feral Spirit 12.1 25.63sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.10 0.00 0.00 0.00 0.00 1.1166 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:12.10
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Shaman_Enhancement
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Manic Grieftorch (_channel) 3.0 120.53sec

Stats Details: Manic Grieftorch Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 26.86 0.00 0.00 1.4158 0.1576 0.00 0.00 0.00% 0.00 0.00

Action Details: Manic Grieftorch Channel

  • id:377463
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:true
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:377463
  • name:Manic Grieftorch
  • school:fire
  • tooltip:
  • description:Channel for {$d=2 seconds}, unleashing a furious volley of flame around your target, dealing {$=}{{$394954s1=7014}*({$d=2 seconds}/$t)*(1+{$@=}versadmg)} Fire damage to your target with a chance to strike nearby enemies for additional damage. Whenever an allied player dies, this cooldown is reduced by {$s2=90} seconds.

Action Details: Manic Grieftorch Missile

  • id:382136
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382136
  • name:Manic Grieftorch
  • school:fire
  • tooltip:
  • description:Channel for 2 seconds, unleashing a furious volley of flame around your target, dealing [A Lot] fire damage. Whenever an allied player dies, this cooldown is reduced by 90 seconds.
Elemental Potion of Ultimate Power 1.5 302.76sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.46 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.46
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ashen Catalyst 72.2 134.5 4.1sec 1.4sec 3.4sec 81.21% 98.14% 0.1 (0.1) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_ashen_catalyst
  • max_stacks:8
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.12
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.7s
  • trigger_min/max:0.9s / 1.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.0s

Stack Uptimes

  • ashen_catalyst_1:31.47%
  • ashen_catalyst_2:15.95%
  • ashen_catalyst_3:11.32%
  • ashen_catalyst_4:9.29%
  • ashen_catalyst_5:6.23%
  • ashen_catalyst_6:3.87%
  • ashen_catalyst_7:2.37%
  • ashen_catalyst_8:0.72%

Spelldata

  • id:390371
  • name:Ashen Catalyst
  • tooltip:Damage of your next Lava Lash increased by {$s1=12}%.
  • description:{$@spelldesc390370=Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.}
  • max_stacks:8
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spelldata

  • id:390370
  • name:Ashen Catalyst
  • tooltip:
  • description:Each time Flame Shock deals periodic damage, increase the damage of your next Lava Lash by {$390371s1=12}% and reduce the cooldown of Lava Lash by {$=}{{$m1=5}/10}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Berserking 2.0 0.0 180.4sec 180.4sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.2s
  • trigger_min/max:180.0s / 181.2s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Crackling Surge 6.7 0.0 42.9sec 42.9sec 14.7sec 32.94% 100.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_crackling_surge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.4s / 283.4s
  • trigger_min/max:12.4s / 283.4s
  • trigger_pct:84.75%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crackling_surge_1:26.34%
  • crackling_surge_2:6.59%
  • crackling_surge_3:0.00%
  • crackling_surge_4:0.00%

Spelldata

  • id:224127
  • name:Crackling Surge
  • tooltip:Increases nature damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 6.6 1.1 42.3sec 35.4sec 10.8sec 23.83% 0.00% 1.1 (1.1) 6.4

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 275.6s
  • trigger_min/max:1.5s / 275.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 34.5s

Stack Uptimes

  • elemental_blast_critical_strike_1:23.83%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 6.6 1.2 42.3sec 35.2sec 10.8sec 23.90% 0.00% 1.2 (1.2) 6.4

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 262.2s
  • trigger_min/max:1.5s / 262.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.8s

Stack Uptimes

  • elemental_blast_haste_1:23.90%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 6.6 1.1 42.5sec 35.6sec 10.8sec 23.70% 0.00% 1.1 (1.1) 6.3

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 304.0s
  • trigger_min/max:1.5s / 304.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 34.2s

Stack Uptimes

  • elemental_blast_mastery_1:23.70%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 124.3sec 99.3sec 58.0sec 25.08% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_air_1:25.08%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 122.8sec 99.6sec 57.9sec 24.98% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 316.5s

Stack Uptimes

  • elemental_chaos_earth_1:24.98%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 123.9sec 98.9sec 57.9sec 24.71% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 338.0s

Stack Uptimes

  • elemental_chaos_fire_1:24.71%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 124.4sec 99.0sec 58.1sec 25.23% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 300.0s

Stack Uptimes

  • elemental_chaos_frost_1:25.23%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Air 7.6 3.5 37.8sec 25.0sec 14.4sec 36.45% 0.00% 3.5 (3.5) 7.2

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_elemental_lariat__empowered_air
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 124.7s
  • trigger_min/max:0.0s / 108.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.4s

Stack Uptimes

  • elemental_lariat__empowered_air_1:36.45%

Spelldata

  • id:375342
  • name:Elemental Lariat - Empowered Air
  • tooltip:Haste increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 302.8sec 302.8sec 27.4sec 13.08% 0.00% 0.0 (0.0) 1.1

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.0s
  • trigger_min/max:300.0s / 328.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.08%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 12.1 0.1 25.7sec 25.6sec 14.7sec 59.21% 0.00% 47.4 (47.4) 11.5

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 52.9s
  • trigger_min/max:12.3s / 42.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • feral_spirit_1:59.21%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=true}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=true}[Elemental ][]Feral Spirit summoned grants you {$?s262624=true}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=true}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 47.4 301.5 6.3sec 0.9sec 5.3sec 83.57% 88.80% 301.5 (664.3) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 61.7s
  • trigger_min/max:0.0s / 13.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 58.7s

Stack Uptimes

  • flurry_1:22.01%
  • flurry_2:34.48%
  • flurry_3:27.08%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of the Storm 39.4 5.4 7.6sec 6.7sec 4.4sec 57.97% 0.00% 5.3 (28.8) 38.8

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_fury_of_the_storm
  • max_stacks:10
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 28.9s
  • trigger_min/max:0.8s / 26.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.3s

Stack Uptimes

  • fury_of_the_storm_5:6.52%
  • fury_of_the_storm_6:9.94%
  • fury_of_the_storm_7:7.79%
  • fury_of_the_storm_8:5.69%
  • fury_of_the_storm_9:4.12%
  • fury_of_the_storm_10:23.91%

Spelldata

  • id:396006
  • name:Fury of the Storm
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc393693=Consuming Maelstrom Weapon stacks increases your Haste by {$396006s1=1}% per stack for {$396006d=4 seconds}.}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 43.0 1.8 7.0sec 6.7sec 2.3sec 32.32% 95.55% 1.8 (13.1) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 26.7s
  • trigger_min/max:0.8s / 26.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s

Stack Uptimes

  • hailstorm_5:5.72%
  • hailstorm_6:6.77%
  • hailstorm_7:4.65%
  • hailstorm_8:3.09%
  • hailstorm_9:2.12%
  • hailstorm_10:9.97%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Hand 11.1 6.3 26.3sec 16.4sec 10.0sec 37.10% 91.02% 6.3 (6.3) 10.8

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_hot_hand
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:5.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:8.0s / 194.9s
  • trigger_min/max:0.0s / 187.4s
  • trigger_pct:5.00%
  • duration_min/max:0.0s / 54.4s

Stack Uptimes

  • hot_hand_1:37.10%

Spelldata

  • id:215785
  • name:Hot Hand
  • tooltip:Lava Lash damage increased by {$s1=0}% and cooldown reduced by {$=}{100*(1-(100/(100+{$m2=0})))}%.
  • description:{$@spelldesc201900=Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=61})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:201900
  • name:Hot Hand
  • tooltip:
  • description:Melee auto-attacks with Flametongue Weapon active have a {$h=5}% chance to reduce the cooldown of Lava Lash by {$=}{100*(1-(100/(100+{$m2=300})))}% and increase the damage of Lava Lash by {$s3=50}% for {$215785d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Ice Strike 26.2 0.1 11.5sec 11.4sec 3.5sec 30.74% 57.63% 0.1 (0.1) 0.2

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.8s / 26.6s
  • trigger_min/max:6.8s / 25.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.0s

Stack Uptimes

  • ice_strike_1:30.74%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Edge 6.7 0.0 43.0sec 43.0sec 14.7sec 32.90% 100.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_icy_edge
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 277.9s
  • trigger_min/max:12.3s / 277.9s
  • trigger_pct:84.99%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • icy_edge_1:26.40%
  • icy_edge_2:6.50%
  • icy_edge_3:0.00%
  • icy_edge_4:0.00%

Spelldata

  • id:224126
  • name:Icy Edge
  • tooltip:Increases frost damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Inspired by Fire and Earth 7.6 3.5 37.8sec 25.0sec 14.3sec 36.23% 0.00% 3.5 (3.5) 7.2

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_inspired_by_fire_and_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:277.19

Trigger Details

  • interval_min/max:12.0s / 120.7s
  • trigger_min/max:0.0s / 102.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.2s

Stack Uptimes

  • inspired_by_fire_and_earth_1:36.23%

Spelldata

  • id:394461
  • name:Inspired by Fire and Earth
  • tooltip:Haste and Versatility increased by {$=}w1.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Maelstrom of Elements 41.2 8.2 7.1sec 5.9sec 1.5sec 20.13% 19.84% 8.2 (8.2) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_maelstrom_of_elements
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 47.2s
  • trigger_min/max:0.8s / 47.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.5s

Stack Uptimes

  • maelstrom_of_elements_1:20.13%

Spelldata

  • id:394677
  • name:Maelstrom of Elements
  • tooltip:Fire, Frost, and Nature ability damage increased by {$=}w1% and generates {$=}w2 additional stack of Maelstrom Weapon.
  • description:{$@spelldesc393691=Stormstrike increases the damage of your next direct Fire, Frost, or Nature spell by {$394677s1=10}% and causes it to generate {$394677s2=1} additional stack of Maelstrom Weapon.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Maelstrom Weapon 45.6 286.2 6.6sec 2.0sec 5.6sec 85.02% 100.00% 24.1 (46.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.4s / 25.8s
  • trigger_min/max:0.0s / 14.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.1s

Stack Uptimes

  • maelstrom_weapon_1:11.65%
  • maelstrom_weapon_2:12.34%
  • maelstrom_weapon_3:12.14%
  • maelstrom_weapon_4:11.88%
  • maelstrom_weapon_5:9.58%
  • maelstrom_weapon_6:7.25%
  • maelstrom_weapon_7:5.38%
  • maelstrom_weapon_8:3.92%
  • maelstrom_weapon_9:2.81%
  • maelstrom_weapon_10:8.06%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Weapon 6.7 0.0 43.0sec 43.0sec 14.7sec 32.87% 100.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_molten_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.3s / 268.9s
  • trigger_min/max:12.3s / 268.9s
  • trigger_pct:84.69%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • molten_weapon_1:26.24%
  • molten_weapon_2:6.63%
  • molten_weapon_3:0.00%
  • molten_weapon_4:0.00%

Spelldata

  • id:224125
  • name:Molten Weapon
  • tooltip:Increases fire damage dealt from your abilities by {$s1=20}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Primordial Wave 7.0 0.0 45.7sec 45.7sec 1.8sec 4.28% 32.55% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_primordial_wave
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 51.3s
  • trigger_min/max:45.0s / 51.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.1s

Stack Uptimes

  • primordial_wave_1:4.28%

Spelldata

  • id:327164
  • name:Primordial Wave
  • tooltip:Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide].
  • description:{$@spelldesc326059=Blast your target with a Primordial Wave, dealing {$327162s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$327163s1=0} and apply Riptide to them][heal an ally for {$327163s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:375982
  • name:Primordial Wave
  • tooltip:
  • description:Blast your target with a Primordial Wave, dealing {$375984s1=0} Shadow damage and apply Flame Shock to an enemy, or {$?a137039=false}[heal an ally for {$375985s1=0} and apply Riptide to them][heal an ally for {$375985s1=0}]. Your next {$?a137040=false}[Lava Burst]?a137041[Lightning Bolt][Healing Wave] will also hit all targets affected by your {$?a137040=false}|a137041[Flame Shock][Riptide] for {$?a137039=false}[{$s2=60}%]?a137040[{$s3=80}%][{$s4=150}%] of normal {$?a137039=false}[healing][damage].{$?s384405=true}[ Primordial Wave generates {$s5=0} stacks of Maelstrom Weapon.][]
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion 4.3 1.1 61.3sec 45.9sec 16.5sec 23.62% 0.00% 1.1 (1.1) 4.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:932.20

Trigger Details

  • interval_min/max:15.0s / 253.1s
  • trigger_min/max:0.0s / 238.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.4s

Stack Uptimes

  • sophic_devotion_1:23.62%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 60.8sec 45.5sec 16.5sec 23.71% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:932.20

Trigger Details

  • interval_min/max:15.0s / 216.9s
  • trigger_min/max:0.1s / 208.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.2s

Stack Uptimes

  • sophic_devotion_oh_1:23.71%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Splintered Elements 7.0 0.0 45.9sec 45.9sec 11.8sec 27.48% 0.00% 0.0 (0.0) 6.7

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_splintered_elements
  • max_stacks:6
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:38.2s / 54.7s
  • trigger_min/max:38.2s / 54.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • splintered_elements_1:27.48%

Spelldata

  • id:354648
  • name:Splintered Elements
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc354647=Each additional {$?a137039=false}[Healing Wave]?a137040[Lava Burst][Lightning Bolt] generated by Primordial Wave increases your Haste by {$s1=10}% for {$354648d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 33.7 14.7 8.7sec 6.1sec 3.5sec 39.78% 66.45% 14.7 (14.7) 0.4

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 78.9s
  • trigger_min/max:0.0s / 78.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 42.8s

Stack Uptimes

  • stormbringer_1:39.78%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Incarnate's Mark of Frost

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_incarnates_mark_of_frost
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:567.88

Spelldata

  • id:382079
  • name:Incarnate's Mark of Frost
  • tooltip:Critical Strike increased by {$=}w1. Dealing harmful spells and abilities has a chance to grant you an additional {$377452=}w2 Versatility or Haste if any nearby allies are Marked by Earth or Fire.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
windfury_totem_extra_attack_mh 28.9 8.0 58.0 10.1s 1.0s 116.7s
windfury_totem_extra_attack_oh 28.0 10.0 55.0 10.4s 1.0s 114.9s
delayed_aa_channel 4.3 1.0 5.0 70.8s 0.0s 242.5s
Maelstrom Weapon: Feral Spirit 70.9 52.0 90.0 4.2s 0.0s 27.8s
Maelstrom Weapon: Swirling Maelstrom 68.9 48.0 91.0 4.3s 0.8s 21.2s
Maelstrom Weapon: Primordial Wave 70.1 60.0 80.0 45.7s 45.0s 51.3s
Flametongue: Windfury Attack 168.9 96.0 258.0 3.7s 0.0s 44.6s
Stormbringer: Windfury Attack 22.0 6.0 46.0 14.1s 0.0s 167.5s
Maelstrom Weapon: Windfury Attack 33.7 8.0 61.0 9.8s 0.0s 111.0s
Flametongue: main_hand 174.6 123.0 236.0 2.1s 1.0s 16.1s
Hot Hand: main_hand 8.8 1.0 23.0 30.8s 1.0s 285.3s
Maelstrom Weapon: main_hand 34.9 14.0 60.0 8.7s 1.0s 91.2s
Windfury: main_hand 57.7 27.0 92.0 5.4s 1.0s 75.7s
Flametongue: offhand 173.3 123.0 233.0 2.1s 1.0s 17.7s
Hot Hand: offhand 8.6 0.0 21.0 31.1s 1.0s 273.0s
Maelstrom Weapon: offhand 34.7 13.0 69.0 8.7s 1.0s 114.0s
Flametongue: Sundering 5.1 1.0 8.0 58.7s 40.0s 258.2s
Stormbringer: Sundering 0.7 0.0 5.0 109.7s 40.0s 342.4s
Maelstrom Weapon: Sundering 1.0 0.0 6.0 109.2s 40.0s 331.8s
Windfury: Sundering 1.7 0.0 6.0 100.1s 40.0s 346.2s
Flametongue: Lava Lash 72.8 31.0 114.0 4.0s 0.8s 15.1s
Stormbringer: Lava Lash 9.4 0.0 25.0 28.4s 0.8s 282.5s
Maelstrom Weapon: Lava Lash 14.6 2.0 33.0 19.1s 0.8s 216.4s
Flametongue: Ice Strike 26.3 20.0 32.0 11.4s 6.8s 25.1s
Stormbringer: Ice Strike 3.4 0.0 12.0 61.9s 6.8s 336.4s
Maelstrom Weapon: Ice Strike 5.3 0.0 16.0 47.4s 6.8s 304.0s
Windfury: Ice Strike 8.7 1.0 20.0 32.1s 6.8s 313.3s
Flametongue: Stormstrike 49.4 27.0 77.0 5.9s 0.8s 47.2s
Stormbringer: Stormstrike 6.4 0.0 23.0 38.2s 0.8s 304.3s
Maelstrom Weapon: Stormstrike 9.8 0.0 22.0 27.5s 0.8s 269.2s
Windfury: Stormstrike 16.3 3.0 35.0 17.3s 0.8s 171.9s
Flametongue: Stormstrike Off-Hand 49.4 27.0 77.0 5.9s 0.8s 47.2s
Stormbringer: Stormstrike Off-Hand 6.4 0.0 17.0 38.3s 0.8s 285.1s
Maelstrom Weapon: Stormstrike Off-Hand 9.8 1.0 23.0 27.5s 0.8s 256.5s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 22.38% 13.71% 29.98% 0.5s 0.0s 5.0s
Hot Hand 37.10% 7.33% 68.40% 10.0s 0.0s 54.4s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.8450.0013.2778.6962.89615.459
Sundering19.0180.001218.23177.6270.000218.231
Primordial Wave0.8470.0016.2744.2330.11413.177
Lava Lash0.9310.00111.88765.89127.078106.685
Flame Shock31.0130.001277.187162.2850.000316.076
Ice Strike0.7080.00113.59917.0484.14937.520
Frost Shock2.4590.00124.064102.72951.978153.325
Elemental Blast4.0870.00125.01123.6320.00086.239
Stormstrike2.2880.00129.667109.70850.412180.867
Earth Elemental11.1590.00241.9190.7350.00041.919

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
T29_Shaman_Enhancement
mana_regenMana697.16227711.87100.00%326.63251710.4252.50%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 759.04 761.01 251710.1 49410.8 46940.4 50000.0
Usage Type Count Total Avg RPE APR
T29_Shaman_Enhancement
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 23.1831877.971375.001375.00144.98
Flame ShockMana 6.294715.27750.0054.86555.12
Frost ShockMana 44.6822340.35500.00500.00139.40
Ice StrikeMana 26.2743353.361650.001650.0024.74
Lava LashMana 72.8029120.70400.00400.00184.53
Lightning BoltMana 21.6010801.36500.00500.00217.01
Primordial WaveMana 7.0110508.201500.001500.00132.01
StormstrikeMana 49.4049402.611000.001000.0117.76
SunderingMana 5.1415431.143000.002999.9024.34

Statistics & Data Analysis

Fight Length
T29_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
T29_Shaman_Enhancement Damage Per Second
Count 7499
Mean 88899.26
Minimum 78270.78
Maximum 99827.45
Spread ( max - min ) 21556.67
Range [ ( max - min ) / 2 * 100% ] 12.12%
Standard Deviation 2888.1930
5th Percentile 84264.93
95th Percentile 93749.14
( 95th Percentile - 5th Percentile ) 9484.21
Mean Distribution
Standard Deviation 33.3522
95.00% Confidence Interval ( 88833.89 - 88964.63 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4055
0.1 Scale Factor Error with Delta=300 71210
0.05 Scale Factor Error with Delta=300 284837
0.01 Scale Factor Error with Delta=300 7120920
Priority Target DPS
T29_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 88899.26
Minimum 78270.78
Maximum 99827.45
Spread ( max - min ) 21556.67
Range [ ( max - min ) / 2 * 100% ] 12.12%
Standard Deviation 2888.1930
5th Percentile 84264.93
95th Percentile 93749.14
( 95th Percentile - 5th Percentile ) 9484.21
Mean Distribution
Standard Deviation 33.3522
95.00% Confidence Interval ( 88833.89 - 88964.63 )
Normalized 95.00% Confidence Interval ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4055
0.1 Scale Factor Error with Delta=300 71210
0.05 Scale Factor Error with Delta=300 284837
0.01 Scale Factor Error with Delta=300 7120920
DPS(e)
T29_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 88899.26
Minimum 78270.78
Maximum 99827.45
Spread ( max - min ) 21556.67
Range [ ( max - min ) / 2 * 100% ] 12.12%
Damage
T29_Shaman_Enhancement Damage
Count 7499
Mean 25483504.30
Minimum 18696284.08
Maximum 32842851.65
Spread ( max - min ) 14146567.56
Range [ ( max - min ) / 2 * 100% ] 27.76%
DTPS
T29_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
T29_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
T29_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
T29_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
T29_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
T29_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
T29_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
T29_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.46 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.99 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 12.10 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
0.00 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
G 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
H 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
0.00 windstrike
I 57.60 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
0.00 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
0.00 ice_strike,if=buff.doom_winds_talent.up
0.00 sundering,if=buff.doom_winds_talent.up
J 7.01 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
0.00 flame_shock,if=!ticking
K 6.97 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
L 26.28 ice_strike,if=talent.hailstorm.enabled
M 42.67 frost_shock,if=buff.hailstorm.up
0.00 lava_lash,if=dot.flame_shock.refreshable
0.00 stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
N 23.18 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
O 3.90 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
P 49.40 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
Q 15.20 lava_lash
0.00 bag_of_tricks
R 10.73 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
S 5.14 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
T 2.01 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
U 1.07 earth_elemental
V 6.29 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

0123478ACDEFBJKLMNPPMNQSMLPQOMIPIFILINIMPRUMQLPNMVQPIRIILIMIPIRJFKLMPNPIMNPPLMPQOMSPVTLQPFNMNPQMLPOMQVPIJFIKILMNPQMNPPMILIOIMIIDIPILFNIIMIPINILJKMPQPRIMILIPIFINIMILINMPPNMPQLPRIMIEPIFIJKLMPNPMQSNMLPQRMVFIPILINIMIPITILPPOMQVPIJFIIKIDILMNPIMIRIMILPNMPFNMPPILOMPINIMIJKIIILFIMINPMPQLNMP

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask T29_Shaman_Enhancement 50000.0/50000: 100% mana
Pre precombat 1 food T29_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 2 augmentation T29_Shaman_Enhancement 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_fire
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, elemental_chaos_fire
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, maelstrom_weapon, elemental_chaos_fire
0:01.598 default E berserking Fluffy_Pillow 41806.8/50000: 84% mana bloodlust, maelstrom_weapon(2), elemental_chaos_fire
0:01.598 default F feral_spirit Fluffy_Pillow 41806.8/50000: 84% mana bloodlust, berserking, maelstrom_weapon(2), elemental_chaos_fire
0:02.477 default B potion Fluffy_Pillow 43213.2/50000: 86% mana bloodlust, berserking, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(3), elemental_chaos_fire
0:02.477 single J primordial_wave Fluffy_Pillow 43213.2/50000: 86% mana bloodlust, berserking, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(3), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:03.356 single K lightning_bolt Fluffy_Pillow 43119.6/50000: 86% mana bloodlust, berserking, flurry, primordial_wave, feral_spirit, icy_edge, crackling_surge, maelstrom_weapon(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:04.232 single L ice_strike Fluffy_Pillow 44021.2/50000: 88% mana bloodlust, berserking, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, fury_of_the_storm(10), hailstorm(10), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:04.986 single M frost_shock Fluffy_Pillow 43577.6/50000: 87% mana bloodlust, berserking, flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), fury_of_the_storm(10), maelstrom_weapon(2), hailstorm(10), ice_strike, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:05.741 single N elemental_blast Fluffy_Pillow 44285.6/50000: 89% mana bloodlust, berserking, flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), fury_of_the_storm(10), maelstrom_weapon(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:06.498 single P stormstrike Fluffy_Pillow 44121.8/50000: 88% mana bloodlust, berserking, flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), fury_of_the_storm(10), maelstrom_weapon, hailstorm(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:07.253 single P stormstrike Fluffy_Pillow 44329.8/50000: 89% mana bloodlust, berserking, flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(3), hailstorm(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:08.008 single M frost_shock Fluffy_Pillow 44537.8/50000: 89% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon(6), hailstorm(5), elemental_chaos_fire, elemental_potion_of_ultimate_power
0:08.761 single N elemental_blast Fluffy_Pillow 45242.6/50000: 90% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), fury_of_the_storm(10), maelstrom_weapon(8), inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:09.515 single Q lava_lash Fluffy_Pillow 45074.0/50000: 90% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), fury_of_the_storm(10), hailstorm(8), inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:10.270 single S sundering Fluffy_Pillow 45882.0/50000: 92% mana bloodlust, berserking, flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, fury_of_the_storm(10), hailstorm(8), inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:11.024 single M frost_shock Fluffy_Pillow 44088.4/50000: 88% mana bloodlust, berserking, flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(2), hailstorm(8), inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:11.779 single L ice_strike Fluffy_Pillow 44796.4/50000: 90% mana bloodlust, berserking, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), fury_of_the_storm(10), stormbringer, maelstrom_weapon(3), inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:12.533 single P stormstrike Fluffy_Pillow 44352.8/50000: 89% mana bloodlust, berserking, flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), fury_of_the_storm(10), stormbringer, maelstrom_weapon(5), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:13.288 single Q lava_lash Fluffy_Pillow 44560.8/50000: 89% mana bloodlust, berserking, flurry(3), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_of_elements, maelstrom_weapon(7), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.074 single O lightning_bolt Fluffy_Pillow 45418.4/50000: 91% mana bloodlust, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(10), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:14.941 single M frost_shock Fluffy_Pillow 46305.6/50000: 93% mana bloodlust, flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), fury_of_the_storm(10), hailstorm(10), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:15.729 single I lava_lash Fluffy_Pillow 47066.4/50000: 94% mana bloodlust, flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), fury_of_the_storm(10), hot_hand, maelstrom_weapon, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:16.597 single P stormstrike Fluffy_Pillow 48055.2/50000: 96% mana bloodlust, flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, fury_of_the_storm(10), hot_hand, maelstrom_weapon, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:17.464 single I lava_lash Fluffy_Pillow 48442.4/50000: 97% mana bloodlust, flurry(2), elemental_blast_mastery, ashen_catalyst, fury_of_the_storm(10), maelstrom_of_elements, hot_hand, stormbringer, maelstrom_weapon(2), inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:18.333 default F feral_spirit Fluffy_Pillow 49432.8/50000: 99% mana bloodlust, flurry(3), elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(4), inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:19.287 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:20.241 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:21.195 single I lava_lash Fluffy_Pillow 49876.4/50000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:22.147 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(9), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:23.101 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), fury_of_the_storm(9), hot_hand, stormbringer, hailstorm(9), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:23.977 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, fury_of_the_storm(9), stormbringer, hailstorm(9), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:24.854 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, fury_of_the_storm(9), stormbringer, maelstrom_weapon(4), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:25.732 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), fury_of_the_storm(9), maelstrom_of_elements, maelstrom_weapon(5), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:26.607 single U earth_elemental Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), fury_of_the_storm(10), maelstrom_weapon, hailstorm(6), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:27.475 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), fury_of_the_storm(10), maelstrom_weapon(2), hailstorm(6), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:28.343 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), fury_of_the_storm(10), maelstrom_weapon(3), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:29.211 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, fury_of_the_storm(10), maelstrom_weapon(3), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:30.079 single P stormstrike Fluffy_Pillow 49738.8/50000: 99% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(4), ice_strike, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:31.030 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), maelstrom_of_elements, maelstrom_weapon(5), ice_strike, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:31.984 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), fury_of_the_storm(6), hailstorm(6), ice_strike, sophic_devotion, elemental_chaos_fire, elemental_potion_of_ultimate_power
0:32.897 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), fury_of_the_storm(6), maelstrom_weapon, sophic_devotion, elemental_chaos_fire
0:33.810 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst(5), fury_of_the_storm(6), maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
0:34.722 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst, fury_of_the_storm(6), maelstrom_weapon(2), sophic_devotion, elemental_chaos_fire
0:35.636 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, ashen_catalyst, maelstrom_of_elements, hot_hand, maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
0:36.603 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst, hot_hand, maelstrom_weapon(5), sophic_devotion, elemental_chaos_fire
0:37.569 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, ashen_catalyst(2), fury_of_the_storm(5), hot_hand, hailstorm(5), sophic_devotion, elemental_chaos_fire
0:38.488 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst, fury_of_the_storm(5), hot_hand, maelstrom_weapon, hailstorm(5), sophic_devotion, elemental_chaos_fire
0:39.410 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, ashen_catalyst, fury_of_the_storm(5), hot_hand, maelstrom_weapon, hailstorm(5), sophic_devotion, elemental_chaos_fire
0:40.329 single I lava_lash Fluffy_Pillow 49820.4/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, fury_of_the_storm(5), hot_hand, maelstrom_weapon(2), hailstorm(5), ice_strike, elemental_chaos_fire
0:41.526 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(5), ice_strike, elemental_chaos_fire
0:42.781 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), hot_hand, maelstrom_weapon(3), elemental_chaos_fire
0:44.036 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(3), elemental_chaos_fire
0:45.292 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_of_elements, hot_hand, maelstrom_weapon(4), elemental_chaos_fire
0:46.547 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_weapon(5), inspired_by_fire_and_earth, elemental_chaos_fire
0:47.787 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), fury_of_the_storm(5), hailstorm(5), elemental_lariat__empowered_air, inspired_by_fire_and_earth, elemental_chaos_fire
0:48.934 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, ashen_catalyst(3), fury_of_the_storm(5), maelstrom_weapon(10), hailstorm(5), elemental_lariat__empowered_air, inspired_by_fire_and_earth, elemental_chaos_fire
0:50.082 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), fury_of_the_storm(5), maelstrom_weapon(10), hailstorm(5), elemental_lariat__empowered_air, inspired_by_fire_and_earth, elemental_chaos_fire
0:51.230 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), fury_of_the_storm(10), hailstorm(10), elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
0:52.225 single M frost_shock Fluffy_Pillow 49942.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), fury_of_the_storm(10), maelstrom_weapon(3), hailstorm(10), ice_strike, elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
0:53.222 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), fury_of_the_storm(10), maelstrom_weapon(4), elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
0:54.219 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(6), maelstrom_of_elements, stormbringer, maelstrom_weapon(5), elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
0:55.316 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(7), fury_of_the_storm(6), stormbringer, maelstrom_weapon(3), hailstorm(6), elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
0:56.347 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(8), fury_of_the_storm(6), maelstrom_of_elements, maelstrom_weapon(4), hailstorm(6), elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
0:57.381 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, fury_of_the_storm(6), stormbringer, maelstrom_weapon(5), hailstorm(6), elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
0:58.416 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(8), elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
0:59.512 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), fury_of_the_storm(8), stormbringer, maelstrom_weapon, hailstorm(8), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:00.556 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), fury_of_the_storm(8), maelstrom_of_elements, stormbringer, maelstrom_weapon, hailstorm(8), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:01.598 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), fury_of_the_storm(8), maelstrom_of_elements, maelstrom_weapon(2), hailstorm(8), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:02.643 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), maelstrom_weapon(5), hailstorm(8), ice_strike, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:03.882 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(5), stormbringer, maelstrom_weapon(7), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:05.120 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(6), maelstrom_of_elements, maelstrom_weapon(9), sophic_devotion_oh, elemental_chaos_fire
1:06.375 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst, maelstrom_weapon(10), elemental_chaos_fire
1:07.629 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(2), fury_of_the_storm(10), hailstorm(10), elemental_chaos_fire
1:08.770 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), fury_of_the_storm(10), maelstrom_weapon, elemental_lariat__empowered_air, elemental_chaos_fire
1:09.881 single P stormstrike Fluffy_Pillow 48777.6/50000: 98% mana flurry, ashen_catalyst(3), fury_of_the_storm(10), maelstrom_weapon, elemental_lariat__empowered_air, elemental_chaos_fire
1:10.990 single V flame_shock Fluffy_Pillow 49552.0/50000: 99% mana ashen_catalyst(4), maelstrom_of_elements, maelstrom_weapon, elemental_lariat__empowered_air, elemental_chaos_fire
1:12.212 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), maelstrom_of_elements, maelstrom_weapon, elemental_lariat__empowered_air, elemental_chaos_fire
1:13.458 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(5), maelstrom_weapon(2), elemental_lariat__empowered_air, elemental_chaos_fire
1:14.678 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(6), maelstrom_weapon(3), ice_strike, elemental_lariat__empowered_air, elemental_chaos_fire
1:15.898 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, stormbringer, maelstrom_weapon(6), ice_strike, elemental_lariat__empowered_air, elemental_chaos_fire
1:17.117 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst(2), maelstrom_of_elements, maelstrom_weapon(7), ice_strike, elemental_lariat__empowered_air, elemental_chaos_fire
1:18.335 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_of_elements, maelstrom_weapon(8), ice_strike, elemental_lariat__empowered_air, elemental_chaos_fire
1:19.556 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), fury_of_the_storm(9), maelstrom_weapon(2), hailstorm(9), ice_strike, elemental_lariat__empowered_air, elemental_chaos_fire
1:20.676 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(4), fury_of_the_storm(9), maelstrom_weapon(5), elemental_chaos_fire
1:21.828 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(5), fury_of_the_storm(10), maelstrom_weapon, hailstorm(5), elemental_chaos_fire
1:22.936 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(5), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon, hailstorm(5), elemental_chaos_fire
1:24.048 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst, fury_of_the_storm(10), stormbringer, maelstrom_weapon(3), hailstorm(5), elemental_chaos_fire
1:25.156 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), elemental_chaos_fire
1:26.375 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_fire
1:27.592 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, crackling_surge(2), ashen_catalyst(3), maelstrom_of_elements, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
1:28.809 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(4), fury_of_the_storm(10), hailstorm(10), ice_strike, elemental_chaos_fire
1:29.917 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, crackling_surge(2), ashen_catalyst(5), fury_of_the_storm(10), maelstrom_weapon(2), elemental_chaos_fire
1:31.024 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, crackling_surge(2), ashen_catalyst, fury_of_the_storm(10), maelstrom_weapon(3), elemental_chaos_fire
1:32.165 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(5), elemental_chaos_fire
1:33.421 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_of_elements, hot_hand, maelstrom_weapon(6), elemental_chaos_fire
1:34.677 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_chaos_fire
1:35.932 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, primordial_wave, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), elemental_chaos_fire
1:37.189 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(3), hot_hand, maelstrom_weapon(10), elemental_chaos_fire
1:38.444 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge(2), hot_hand, stormbringer, maelstrom_weapon(10), elemental_chaos_fire
1:39.699 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, fury_of_the_storm(10), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), elemental_chaos_fire
1:40.737 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, fury_of_the_storm(10), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(10), inspired_by_fire_and_earth, elemental_chaos_fire
1:41.759 single M frost_shock Fluffy_Pillow 49985.2/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(3), hailstorm(10), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire
1:42.783 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(5), inspired_by_fire_and_earth, elemental_chaos_fire
1:43.910 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), fury_of_the_storm(5), stormbringer, hailstorm(5), inspired_by_fire_and_earth, elemental_chaos_fire
1:44.950 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(4), fury_of_the_storm(5), maelstrom_of_elements, maelstrom_weapon(2), hailstorm(5), inspired_by_fire_and_earth, elemental_chaos_fire
1:45.991 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, fury_of_the_storm(5), maelstrom_weapon(6), hailstorm(5), inspired_by_fire_and_earth, elemental_chaos_fire
1:47.032 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(7), inspired_by_fire_and_earth, elemental_chaos_fire
1:48.125 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(2), fury_of_the_storm(7), stormbringer, maelstrom_weapon, hailstorm(7), inspired_by_fire_and_earth, elemental_chaos_fire
1:49.150 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(3), fury_of_the_storm(7), maelstrom_of_elements, stormbringer, maelstrom_weapon(2), hailstorm(7), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:50.172 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge(2), ashen_catalyst(4), fury_of_the_storm(7), maelstrom_of_elements, maelstrom_weapon(3), hailstorm(7), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:51.195 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst(5), hot_hand, maelstrom_weapon(7), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:52.397 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, hot_hand, maelstrom_weapon(8), sophic_devotion_oh, elemental_chaos_fire
1:53.616 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion_oh, elemental_chaos_fire
1:54.835 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_fire
1:56.021 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), fury_of_the_storm(10), hot_hand, stormbringer, hailstorm(10), ice_strike, elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_fire
1:57.099 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), fury_of_the_storm(10), hot_hand, stormbringer, hailstorm(10), ice_strike, elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_fire
1:58.208 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, fury_of_the_storm(10), hot_hand, stormbringer, maelstrom_weapon, elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_fire
1:59.319 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_fire
2:00.538 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_earth
2:02.498 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_earth
2:03.718 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(2), elemental_lariat__empowered_air, elemental_chaos_earth
2:04.940 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, maelstrom_of_elements, hot_hand, maelstrom_weapon(3), elemental_lariat__empowered_air, elemental_chaos_earth
2:06.161 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, hot_hand, maelstrom_weapon(4), sophic_devotion_oh, elemental_chaos_earth
2:07.417 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_weapon(6), ice_strike, sophic_devotion_oh, elemental_chaos_earth
2:08.672 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge(2), ashen_catalyst(3), maelstrom_weapon(7), ice_strike, sophic_devotion_oh, elemental_chaos_earth
2:09.927 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(3), fury_of_the_storm(7), hot_hand, hailstorm(7), ice_strike, elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_earth
2:11.069 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, fury_of_the_storm(7), hot_hand, maelstrom_weapon, hailstorm(7), ice_strike, elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_earth
2:12.209 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, fury_of_the_storm(7), hot_hand, stormbringer, maelstrom_weapon, hailstorm(7), ice_strike, elemental_lariat__empowered_air, sophic_devotion_oh, elemental_chaos_earth
2:13.350 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(2), elemental_lariat__empowered_air, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:14.571 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge(2), hot_hand, stormbringer, maelstrom_weapon(4), elemental_lariat__empowered_air, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:15.793 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, maelstrom_of_elements, hot_hand, maelstrom_weapon(5), elemental_lariat__empowered_air, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:17.016 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_lariat__empowered_air, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:18.235 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), fury_of_the_storm(7), hot_hand, hailstorm(7), elemental_lariat__empowered_air, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:19.344 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), fury_of_the_storm(7), hailstorm(7), elemental_lariat__empowered_air, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:20.452 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst, fury_of_the_storm(7), stormbringer, maelstrom_weapon(2), hailstorm(7), ice_strike, elemental_lariat__empowered_air, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:21.558 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, primordial_wave, feral_spirit, icy_edge(2), ashen_catalyst(2), stormbringer, maelstrom_weapon(10), hailstorm(7), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:22.775 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, splintered_elements, ashen_catalyst(3), fury_of_the_storm(10), stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:23.783 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(3), fury_of_the_storm(10), stormbringer, maelstrom_weapon(3), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:24.791 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, ashen_catalyst(4), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon(5), inspired_by_fire_and_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:25.786 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, ashen_catalyst, stormbringer, maelstrom_weapon(6), inspired_by_fire_and_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
2:26.881 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst(2), maelstrom_of_elements, maelstrom_weapon(6), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:27.975 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(2), fury_of_the_storm(7), hot_hand, hailstorm(7), inspired_by_fire_and_earth, elemental_chaos_earth
2:29.029 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst, fury_of_the_storm(7), hot_hand, stormbringer, hailstorm(7), inspired_by_fire_and_earth, elemental_chaos_earth
2:30.082 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst(2), fury_of_the_storm(7), hot_hand, stormbringer, maelstrom_weapon, inspired_by_fire_and_earth, elemental_chaos_earth
2:31.135 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon, inspired_by_fire_and_earth, elemental_chaos_earth
2:32.262 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), ice_strike, inspired_by_fire_and_earth, elemental_chaos_earth
2:33.388 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), ice_strike, inspired_by_fire_and_earth, elemental_chaos_earth
2:34.514 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(2), maelstrom_of_elements, hot_hand, maelstrom_weapon(4), ice_strike, inspired_by_fire_and_earth, elemental_chaos_earth
2:35.753 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, inspired_by_fire_and_earth, elemental_chaos_earth
2:36.989 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), ice_strike, inspired_by_fire_and_earth, elemental_chaos_earth
2:38.227 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), ice_strike, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:39.465 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), fury_of_the_storm(7), hot_hand, stormbringer, maelstrom_weapon, hailstorm(7), ice_strike, sophic_devotion, elemental_chaos_earth
2:40.638 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, fury_of_the_storm(7), hot_hand, stormbringer, maelstrom_weapon, hailstorm(7), ice_strike, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:41.796 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, fury_of_the_storm(7), hot_hand, stormbringer, maelstrom_weapon(3), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:42.954 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:44.203 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(5), ice_strike, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:45.441 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, icy_edge(2), ashen_catalyst, stormbringer, maelstrom_weapon(7), ice_strike, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:46.678 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst, fury_of_the_storm(7), hailstorm(7), ice_strike, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:47.801 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(2), fury_of_the_storm(7), maelstrom_weapon(3), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:48.926 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(3), fury_of_the_storm(7), maelstrom_of_elements, stormbringer, maelstrom_weapon(3), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:50.049 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge(2), ashen_catalyst(4), maelstrom_of_elements, stormbringer, maelstrom_weapon(5), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:51.430 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(5), fury_of_the_storm(6), stormbringer, maelstrom_weapon, hailstorm(6), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:52.566 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(5), fury_of_the_storm(6), stormbringer, maelstrom_weapon(2), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth
2:53.701 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, ashen_catalyst(6), fury_of_the_storm(6), maelstrom_of_elements, maelstrom_weapon(2), inspired_by_fire_and_earth, elemental_chaos_earth
2:54.835 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(4), inspired_by_fire_and_earth, elemental_chaos_earth
2:56.039 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst(2), stormbringer, maelstrom_weapon(5), ice_strike, elemental_chaos_earth
2:57.295 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst(2), maelstrom_of_elements, maelstrom_weapon(6), ice_strike, elemental_chaos_earth
2:58.551 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(3), fury_of_the_storm(7), hot_hand, maelstrom_weapon, hailstorm(7), ice_strike, sophic_devotion, elemental_chaos_earth
2:59.723 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, ashen_catalyst, fury_of_the_storm(7), hot_hand, maelstrom_weapon(2), hailstorm(7), ice_strike, sophic_devotion, elemental_chaos_earth
3:00.895 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), fury_of_the_storm(7), hot_hand, maelstrom_weapon(3), sophic_devotion, elemental_chaos_fire
3:02.069 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana hot_hand, maelstrom_weapon(4), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:02.069 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, hot_hand, maelstrom_weapon(4), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:03.197 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), ashen_catalyst, maelstrom_of_elements, hot_hand, maelstrom_weapon(7), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:04.323 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), ashen_catalyst, hot_hand, maelstrom_weapon(9), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:05.450 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, feral_spirit, crackling_surge(2), ashen_catalyst(2), hot_hand, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:06.578 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, feral_spirit, crackling_surge(2), maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:07.704 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), primordial_wave, feral_spirit, crackling_surge(2), ashen_catalyst, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:08.830 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), fury_of_the_storm(10), hailstorm(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:09.762 single M frost_shock Fluffy_Pillow 49841.2/50000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), fury_of_the_storm(10), stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:10.669 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), fury_of_the_storm(10), stormbringer, maelstrom_weapon(4), elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:11.576 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(4), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(5), elemental_lariat__empowered_air, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
3:12.483 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(5), fury_of_the_storm(10), stormbringer, hailstorm(6), elemental_lariat__empowered_air, inspired_by_fire_and_earth, elemental_chaos_fire
3:13.390 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(6), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon(2), hailstorm(6), elemental_lariat__empowered_air, elemental_chaos_fire
3:14.310 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(6), fury_of_the_storm(10), maelstrom_weapon(4), elemental_lariat__empowered_air, elemental_chaos_fire
3:15.318 single S sundering Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst, fury_of_the_storm(10), maelstrom_weapon(4), elemental_lariat__empowered_air, elemental_chaos_fire
3:16.326 single N elemental_blast Fluffy_Pillow 48612.8/50000: 97% mana flurry(2), elemental_blast_critical_strike, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(2), maelstrom_weapon(5), elemental_lariat__empowered_air, elemental_chaos_fire
3:17.436 single M frost_shock Fluffy_Pillow 49013.8/50000: 98% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), fury_of_the_storm(5), hailstorm(5), elemental_lariat__empowered_air, elemental_chaos_fire
3:18.522 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, feral_spirit, crackling_surge(2), ashen_catalyst(3), fury_of_the_storm(5), maelstrom_weapon, elemental_lariat__empowered_air, elemental_chaos_fire
3:19.580 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, splintered_elements, ashen_catalyst(4), fury_of_the_storm(5), maelstrom_weapon(5), ice_strike, elemental_lariat__empowered_air, elemental_chaos_fire
3:20.638 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_mastery, ashen_catalyst(5), maelstrom_of_elements, maelstrom_weapon(7), ice_strike, elemental_lariat__empowered_air, elemental_chaos_fire
3:21.858 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, maelstrom_weapon(9), ice_strike, elemental_chaos_fire
3:23.114 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, ashen_catalyst, fury_of_the_storm(9), hailstorm(9), ice_strike, elemental_chaos_fire
3:24.268 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), fury_of_the_storm(9), maelstrom_weapon, elemental_chaos_fire
3:25.422 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(3), fury_of_the_storm(9), maelstrom_weapon(2), elemental_chaos_fire
3:26.576 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), hot_hand, maelstrom_weapon(3), elemental_chaos_fire
3:27.832 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, crackling_surge, hot_hand, maelstrom_weapon(3), elemental_chaos_fire
3:29.086 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_of_elements, hot_hand, maelstrom_weapon(6), inspired_by_fire_and_earth, elemental_chaos_fire
3:30.324 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(8), inspired_by_fire_and_earth, elemental_chaos_fire
3:31.595 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire
3:32.834 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, crackling_surge, hot_hand, stormbringer, maelstrom_weapon(10), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire
3:34.071 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, fury_of_the_storm(10), hot_hand, stormbringer, hailstorm(10), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire
3:35.196 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, fury_of_the_storm(10), stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire
3:36.323 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), fury_of_the_storm(10), hot_hand, stormbringer, maelstrom_weapon(2), inspired_by_fire_and_earth, elemental_chaos_fire
3:37.450 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), inspired_by_fire_and_earth, elemental_chaos_fire
3:38.688 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_of_elements, hot_hand, maelstrom_weapon(3), inspired_by_fire_and_earth, elemental_chaos_fire
3:39.925 single T frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(4), inspired_by_fire_and_earth, elemental_chaos_fire
3:41.210 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, ashen_catalyst(2), hot_hand, maelstrom_weapon(6), elemental_chaos_fire
3:42.465 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(7), elemental_chaos_fire
3:43.721 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst, stormbringer, maelstrom_weapon(8), ice_strike, elemental_chaos_fire
3:44.977 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(9), ice_strike, elemental_chaos_fire
3:46.232 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(3), maelstrom_of_elements, maelstrom_weapon(10), ice_strike, elemental_chaos_fire
3:47.487 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(4), fury_of_the_storm(10), hailstorm(10), ice_strike, elemental_chaos_fire
3:48.630 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), ashen_catalyst(4), fury_of_the_storm(10), maelstrom_weapon, elemental_chaos_fire
3:49.771 single V flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, ashen_catalyst, fury_of_the_storm(10), maelstrom_weapon, elemental_chaos_fire
3:50.913 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(2), maelstrom_weapon, elemental_chaos_fire
3:52.167 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst(3), maelstrom_of_elements, hot_hand, maelstrom_weapon(2), elemental_chaos_fire
3:53.424 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), hot_hand, maelstrom_weapon(4), elemental_chaos_fire
3:54.680 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), primordial_wave, ashen_catalyst, hot_hand, maelstrom_weapon(10), elemental_chaos_fire
3:55.935 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), hot_hand, maelstrom_weapon(10), elemental_chaos_fire
3:57.192 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana primordial_wave, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, maelstrom_weapon(10), elemental_chaos_fire
3:58.448 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), primordial_wave, feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(10), elemental_chaos_fire
3:59.705 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, fury_of_the_storm(10), hot_hand, stormbringer, maelstrom_weapon, hailstorm(10), elemental_chaos_fire
4:00.745 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, fury_of_the_storm(10), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), elemental_chaos_earth
4:02.378 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), fury_of_the_storm(10), hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), elemental_chaos_earth
4:03.417 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(3), hailstorm(10), elemental_chaos_earth
4:04.559 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(6), hailstorm(10), ice_strike, elemental_chaos_earth
4:05.700 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), stormbringer, maelstrom_weapon(7), elemental_chaos_earth
4:06.843 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), fury_of_the_storm(7), stormbringer, maelstrom_weapon, hailstorm(7), elemental_chaos_earth
4:07.879 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), fury_of_the_storm(7), maelstrom_of_elements, hot_hand, maelstrom_weapon(3), hailstorm(7), elemental_chaos_earth
4:08.916 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, fury_of_the_storm(7), hot_hand, maelstrom_weapon(4), hailstorm(7), elemental_chaos_earth
4:09.953 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, splintered_elements, ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_lariat__empowered_air, elemental_chaos_earth
4:11.030 single R lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst, hot_hand, maelstrom_weapon(7), elemental_lariat__empowered_air, elemental_chaos_earth
4:12.215 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, ashen_catalyst(2), fury_of_the_storm(7), hot_hand, hailstorm(7), elemental_lariat__empowered_air, elemental_chaos_earth
4:13.322 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, ashen_catalyst, fury_of_the_storm(7), hot_hand, maelstrom_weapon(2), hailstorm(7), elemental_lariat__empowered_air, elemental_chaos_earth
4:14.430 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, ashen_catalyst(2), fury_of_the_storm(7), hot_hand, maelstrom_weapon(3), elemental_lariat__empowered_air, elemental_chaos_earth
4:15.536 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, maelstrom_weapon(4), elemental_lariat__empowered_air, elemental_chaos_earth
4:16.723 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana ashen_catalyst, maelstrom_weapon(5), ice_strike, elemental_lariat__empowered_air, elemental_chaos_earth
4:17.945 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), ashen_catalyst(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(7), ice_strike, elemental_lariat__empowered_air, elemental_chaos_earth
4:19.165 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, ashen_catalyst(3), fury_of_the_storm(8), stormbringer, maelstrom_weapon(2), hailstorm(8), ice_strike, elemental_lariat__empowered_air, elemental_chaos_earth
4:20.295 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, ashen_catalyst(3), fury_of_the_storm(8), stormbringer, maelstrom_weapon(3), elemental_lariat__empowered_air, elemental_chaos_earth
4:21.425 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, ashen_catalyst(4), fury_of_the_storm(8), maelstrom_of_elements, stormbringer, maelstrom_weapon(3), elemental_lariat__empowered_air, elemental_chaos_earth
4:22.555 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(5), maelstrom_of_elements, stormbringer, maelstrom_weapon(5), elemental_lariat__empowered_air, elemental_chaos_earth
4:23.774 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), fury_of_the_storm(6), stormbringer, hailstorm(6), elemental_lariat__empowered_air, elemental_chaos_earth
4:24.923 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(6), fury_of_the_storm(6), stormbringer, maelstrom_weapon(2), elemental_lariat__empowered_air, elemental_chaos_earth
4:26.074 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(7), fury_of_the_storm(6), maelstrom_of_elements, stormbringer, maelstrom_weapon(4), elemental_lariat__empowered_air, elemental_chaos_earth
4:27.227 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(8), maelstrom_of_elements, stormbringer, maelstrom_weapon(5), elemental_lariat__empowered_air, elemental_chaos_earth
4:28.448 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, stormbringer, maelstrom_weapon(7), elemental_lariat__empowered_air, elemental_chaos_earth
4:29.668 single O lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, stormbringer, maelstrom_weapon(10), ice_strike, elemental_lariat__empowered_air, elemental_chaos_earth
4:30.890 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, elemental_lariat__empowered_air, elemental_chaos_earth
4:32.002 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst(3), fury_of_the_storm(10), stormbringer, maelstrom_weapon(2), elemental_lariat__empowered_air, sophic_devotion, elemental_chaos_earth
4:33.111 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, icy_edge, molten_weapon, ashen_catalyst(4), fury_of_the_storm(10), maelstrom_of_elements, hot_hand, stormbringer, maelstrom_weapon(3), elemental_lariat__empowered_air, sophic_devotion, elemental_chaos_earth
4:34.222 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, icy_edge, molten_weapon, hot_hand, stormbringer, maelstrom_weapon(5), elemental_lariat__empowered_air, sophic_devotion, elemental_chaos_earth
4:35.444 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, feral_spirit, icy_edge, molten_weapon, ashen_catalyst, fury_of_the_storm(5), hot_hand, stormbringer, hailstorm(5), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:36.641 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst, fury_of_the_storm(5), hot_hand, stormbringer, maelstrom_weapon(2), hailstorm(5), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:37.837 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, ashen_catalyst(2), fury_of_the_storm(5), hot_hand, stormbringer, maelstrom_weapon(3), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:39.033 single J primordial_wave Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, hot_hand, stormbringer, maelstrom_weapon(4), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:40.288 single K lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, primordial_wave, ashen_catalyst, stormbringer, maelstrom_weapon(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:41.546 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, splintered_elements, ashen_catalyst(2), fury_of_the_storm(10), hot_hand, stormbringer, hailstorm(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:42.583 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, ashen_catalyst, fury_of_the_storm(10), hot_hand, stormbringer, hailstorm(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:43.622 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, splintered_elements, fury_of_the_storm(10), hot_hand, stormbringer, hailstorm(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:44.661 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst, hot_hand, hailstorm(10), sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:45.803 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, ashen_catalyst(2), hot_hand, maelstrom_weapon, hailstorm(10), ice_strike, sophic_devotion, sophic_devotion_oh, elemental_chaos_earth
4:46.943 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, sophic_devotion_oh, elemental_chaos_earth
4:48.085 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(2), hailstorm(10), ice_strike, sophic_devotion_oh, elemental_chaos_earth
4:49.228 single I lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, maelstrom_weapon(5), sophic_devotion_oh, elemental_chaos_earth
4:50.366 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, hot_hand, stormbringer, maelstrom_weapon(6), inspired_by_fire_and_earth, elemental_chaos_earth
4:51.493 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, splintered_elements, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), fury_of_the_storm(6), stormbringer, hailstorm(6), inspired_by_fire_and_earth, elemental_chaos_earth
4:52.524 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), fury_of_the_storm(6), maelstrom_of_elements, stormbringer, maelstrom_weapon(2), hailstorm(6), inspired_by_fire_and_earth, elemental_chaos_earth
4:53.658 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), fury_of_the_storm(6), stormbringer, maelstrom_weapon(4), inspired_by_fire_and_earth, elemental_chaos_earth
4:54.791 single Q lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(4), maelstrom_of_elements, maelstrom_weapon(4), inspired_by_fire_and_earth, elemental_chaos_earth
4:55.992 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst, maelstrom_weapon(6), inspired_by_fire_and_earth, elemental_chaos_earth
4:57.194 single N elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), stormbringer, maelstrom_weapon(8), ice_strike, inspired_by_fire_and_earth, elemental_chaos_earth
4:58.397 single M frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(2), fury_of_the_storm(8), stormbringer, maelstrom_weapon, hailstorm(8), ice_strike, inspired_by_fire_and_earth, elemental_chaos_earth
4:59.510 single P stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, icy_edge, crackling_surge, ashen_catalyst(3), fury_of_the_storm(8), stormbringer, maelstrom_weapon(2), inspired_by_fire_and_earth, elemental_chaos_earth

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 8087 7918 5450 (4550)
Stamina 3463 0 17602 16764 13301
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 352040 335280 0
Mana 50000 50000 0
Spell Power 10377 9712 0
Crit 15.50% 15.50% 990
Haste 23.71% 19.87% 3378
Versatility 8.32% 5.32% 1090
Mana Regen 1600 1600 0
Attack Power 8491 7918 0
Mastery 76.98% 76.98% 5498
Armor 4851 4851 4851
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 422.00
Local Head Faceguard of Infused Earth
ilevel: 424, stats: { 630 Armor, +1383 Sta, +547 Haste, +239 Mastery, +512 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Elemental Lariat
ilevel: 418, stats: { +722 Sta, +592 Mastery, +592 Haste }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
item effects: { equip: Elemental Lariat }
Local Shoulders Calderas of Infused Earth
ilevel: 424, stats: { 578 Armor, +1037 Sta, +181 Vers, +408 Mastery, +384 AgiInt }
Local Chest Robe of Infused Earth
ilevel: 421, stats: { 824 Armor, +1333 Sta, +268 Crit, +506 Mastery, +498 AgiInt }, enchant: { +150 StrAgiInt }
Local Waist Morningscale Waistguard
ilevel: 421, stats: { 464 Armor, +1000 Sta, +308 Haste, +262 Mastery, +374 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Legs Tassets of the Tarasek Legion
ilevel: 424, stats: { 735 Armor, +1383 Sta, +530 Haste, +256 Mastery, +512 AgiInt }, enchant: { +141 BonusArmor, +177 StrAgi }
Local Feet Lightning-Charged Striders
ilevel: 421, stats: { 515 Armor, +1000 Sta, +203 Haste, +378 Mastery, +374 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 421, stats: { 412 Armor, +750 Sta, +162 Haste, +274 Mastery, +280 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Gauntlets of Infused Earth
ilevel: 424, stats: { 473 Armor, +1037 Sta, +421 Crit, +168 Mastery, +384 AgiInt }
Local Finger1 Seal of Filial Duty
ilevel: 431, stats: { +852 Sta, +322 Haste, +974 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Mastery }
item effects: { equip: Broodkeeper's Barrier }
Local Finger2 Seal of Diurna's Chosen
ilevel: 421, stats: { +750 Sta, +301 Crit, +909 Vers }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Mastery }
item effects: { equip: Broodkeeper's Blaze }
Local Trinket1 Manic Grieftorch
ilevel: 424, stats: { +487 StrAgi }
item effects: { use: Manic Grieftorch, equip: Manic Grieftorch }
Local Trinket2 Whispering Incarnate Icon
ilevel: 421, stats: { +473 StrAgiInt }
item effects: { equip: Whispering Incarnate Icon }
Local Back Vibrant Wildercloth Shawl
ilevel: 418, stats: { 220 Armor, +722 Sta, +215 Mastery, +215 Haste, +272 StrAgiInt }, enchant: sophic_devotion_3
Local Main Hand Fist of the Grand Summoner
ilevel: 421, weapon: { 607 - 866, 2.6 }, stats: { +249 Agi, +666 Sta, +134 Haste, +253 Mastery }, enchant: sophic_devotion_3
Local Off Hand Fist of the Grand Summoner
ilevel: 421, weapon: { 607 - 866, 2.6 }, stats: { +249 Agi, +666 Sta, +134 Haste, +253 Mastery }, enchant: sophic_devotion_3

Talents

Talent Tables

RowShaman Talents [31]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="T29_Shaman_Enhancement"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpEJgkEikkQJhAAAAAAAAAAAAAQLCRIRLFBIlkkUAUSkEA

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=faceguard_of_infused_earth,id=200399,bonus_id=4800/4786/1498/6935,gem_id=192988
neck=elemental_lariat,id=193001,bonus_id=6652/7936/7979/1540/8767/6935/6935,gem_id=192961/192961/192961,crafted_stats=49/36
shoulders=calderas_of_infused_earth,id=200401,bonus_id=4800/4786/1498
back=vibrant_wildercloth_shawl,id=193511,bonus_id=6652/7936/7979/1540/8767,enchant_id=6643,crafted_stats=49/36
chest=robe_of_infused_earth,id=200396,bonus_id=4800/4786/1498,enchant=waking_stats_3
wrists=shikaar_ranger_bracers,id=193693,bonus_id=6808/4786/1643,gem_id=192961
hands=gauntlets_of_infused_earth,id=200398,bonus_id=4800/4786/1501
waist=morningscale_waistguard,id=109843,bonus_id=4238/4786/6808/3306,gem_id=192961
legs=tassets_of_the_tarasek_legion,id=195522,bonus_id=4800/4786/1498,enchant_id=6496
feet=lightningcharged_striders,id=193685,bonus_id=6808/4786/1643
finger1=seal_of_filial_duty,id=195526,bonus_id=4800/4786/1498,gem_id=192961,enchant_id=6562
finger2=seal_of_diurnas_chosen,id=195480,bonus_id=4800/4786/1498,gem_id=192961,enchant_id=6562
trinket1=manic_grieftorch,id=194308,bonus_id=4800/4786/1498
trinket2=whispering_incarnate_icon,id=194301,bonus_id=4800/4786/1498
main_hand=fist_of_the_grand_summoner,id=195512,bonus_id=4800/4786/1498,enchant=sophic_devotion_3
off_hand=fist_of_the_grand_summoner,id=195512,bonus_id=4800/4786/1498,enchant=sophic_devotion_3

# Gear Summary
# gear_ilvl=422.19
# gear_agility=5450
# gear_stamina=13301
# gear_crit_rating=990
# gear_haste_rating=3378
# gear_mastery_rating=5498
# gear_versatility_rating=1090
# gear_armor=4851
# set_bonus=tier29_2pc=1
# set_bonus=tier29_4pc=1

T29_Shaman_Enhancement_Phys : 87680 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
87679.8 87679.8 139.8 / 0.159% 24280.5 / 27.7% 101.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
810.6 808.4 Mana 0.66% 56.7 100.0% 100%
TalentBcQAAAAAAAAAAAAAAAAAAAAAAIJJpAJRSSiAJJSAAAAAAAAAAAAAAtIEhEtUEgUSSSBQJRSgC
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T29_Shaman_Enhancement_Phys 87680
Ascendance (_dre) 0 (1627) 0.0% (1.9%) 7.9 32.18sec 62075 0

Stats Details: Ascendance Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.86 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Ascendance Dre

  • id:114051
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:114051
  • name:Ascendance
  • school:nature
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
    Ascendance (_damage_dre) 1627 1.9% 7.9 32.18sec 62075 0 Direct 7.9 49330 99027 62076 25.6% 0.0%

Stats Details: Ascendance Damage Dre

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.86 7.86 0.00 0.00 0.00 0.0000 0.0000 487854.79 487854.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 74.36% 5.84 0 20 49330.00 44851 65146 49096.79 0 60548 288279 288279 0.00%
crit 25.64% 2.02 0 9 99026.91 89702 128579 84219.20 0 124016 199575 199575 0.00%

Action Details: Ascendance Damage Dre

  • id:344548
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.02
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:344548
  • name:Ascendance
  • school:nature
  • tooltip:
  • description:{$@spelldesc114051=Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]}
Broodkeeper's Blaze 1628 1.9% 15.9 18.05sec 30689 0 Periodic 42.8 9211 18517 11395 23.5% 0.0% 28.6%

Stats Details: Broodkeepers Blaze

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.91 0.00 42.84 42.84 3.92 0.0000 2.0000 488157.72 488157.72 0.00% 5697.65 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 76.53% 32.78 11 67 9210.68 9143 9410 9210.93 9143 9410 301953 301953 0.00%
crit 23.47% 10.06 0 26 18516.75 18287 18820 18508.43 0 18820 186204 186204 0.00%

Action Details: Broodkeepers Blaze

  • id:394453
  • school:flamestrike
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:7252.16
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394453
  • name:Broodkeeper's Blaze
  • school:flamestrike
  • tooltip:Burning for 6 sec.
  • description:
Doom Winds 115 0.1% 3.7 90.37sec 9294 9171 Direct 3.7 9294 0 9294 0.0% 0.0%

Stats Details: Doom Winds

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.72 3.72 0.00 0.00 0.00 1.0137 0.0000 34583.77 49406.64 30.00% 9170.98 9170.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 3.72 3 4 9294.46 6317 17009 9284.83 6981 13301 34584 49407 30.00%

Action Details: Doom Winds

  • id:384352
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00

Spelldata

  • id:384352
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.

Action Priority List

    default
    [G]:3.72
  • if_expr:raid_event.adds.in>=90|active_enemies>1
Elemental Blast 11955 13.7% 24.3 12.10sec 147701 132666 Direct 24.3 116256 233005 147760 27.0% 0.0%

Stats Details: Elemental Blast

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.28 24.27 0.00 0.00 0.00 1.1133 0.0000 3586083.74 3586083.74 0.00% 132665.60 132665.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 73.02% 17.72 7 30 116255.91 76167 189998 116263.88 96002 135113 2060163 2060163 0.00%
crit 26.98% 6.55 0 18 233005.22 152333 374999 232846.37 0 325919 1525921 1525921 0.00%

Action Details: Elemental Blast

  • id:117014
  • school:elemental
  • range:40.0
  • travel_speed:40.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:false
  • charges:2
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.94

Spelldata

  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]

Action Priority List

    single
    [R]:24.28
  • if_expr:(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
Flame Shock 2737 3.1% 29.7 9.96sec 27678 76216 Direct 29.7 4370 8773 5401 23.4% 0.0%
Periodic 205.8 2596 5215 3210 23.4% 0.0% 96.6%

Stats Details: Flame Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 29.66 29.66 205.83 205.83 27.71 0.3632 1.4076 820849.27 820849.27 0.00% 2731.60 76216.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.57% 22.71 9 40 4369.58 3963 5777 4369.73 4104 4696 99221 99221 0.00%
crit 23.43% 6.95 0 18 8772.58 7926 11555 8769.59 0 10333 60967 60967 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 76.57% 157.61 110 204 2596.05 2 3437 2596.15 2453 2746 409165 409165 0.00%
crit 23.43% 48.23 24 82 5215.00 4 6874 5215.75 4825 5653 251496 251496 0.00%

Action Details: Flame Shock

  • id:188389
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.195000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.116000
  • base_td:0.00
  • base_td_mult:0.99
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering {$=}w2 Fire damage every {$t2=2} sec.
  • description:Sears the target with fire, causing {$s1=0} Fire damage and then an additional {$=}o2 Fire damage over {$d=18 seconds}. Flame Shock can be applied to a maximum of {$=}I targets.

Action Priority List

    single
    [M]:1.95
  • if_expr:!ticking
    single
    [Y]:8.19
Flametongue Weapon 0 (2573) 0.0% (2.9%) 1.0 0.00sec 771271 0

Stats Details: Flametongue Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flametongue Weapon

  • id:318038
  • school:fire
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:318038
  • name:Flametongue Weapon
  • school:fire
  • tooltip:Each of your weapon attacks causes up to {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage.
  • description:Imbue your {$?s33757=true}[off-hand ][]weapon with the element of Fire for {$319778d=3600 seconds}, causing each of your attacks to deal {$=}{$max(({$=}<coeff>*{$=}AP),1)} additional Fire damage{$?s382027=false}[ and increasing the damage of your Fire spells by {$382028s1=5}%][].
    Flametongue Attack 2573 2.9% 1159.1 0.64sec 665 0 Direct 1159.1 539 1082 665 23.3% 0.0%

Stats Details: Flametongue Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1159.10 1159.10 0.00 0.00 0.00 0.0000 0.0000 771271.24 771271.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.68% 888.84 571 1209 538.70 490 711 538.69 511 570 478822 478822 0.00%
crit 23.32% 270.26 167 390 1082.11 980 1422 1082.20 1029 1139 292450 292450 0.00%

Action Details: Flametongue Attack

  • id:10444
  • school:fire
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.019800
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
  • base_dd_mult:1.19

Spelldata

  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:$@spelldesc193796
Frost Shock 9553 10.9% 47.6 6.11sec 60171 57481 Direct 47.6 48646 97651 60172 23.5% 0.0%

Stats Details: Frost Shock

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 47.62 47.62 0.00 0.00 0.00 1.0468 0.0000 2865383.52 2865383.52 0.00% 57481.26 57481.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.48% 36.42 18 54 48646.35 12804 99167 48715.36 39209 58284 1771788 1771788 0.00%
crit 23.52% 11.20 1 26 97651.35 25607 197817 97793.77 44569 141879 1093595 1093595 0.00%

Action Details: Frost Shock

  • id:196840
  • school:frost
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:6.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.630000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.99

Spelldata

  • id:196840
  • name:Frost Shock
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Chills the target with frost, causing {$s1=0} Frost damage and reducing the target's movement speed by {$s2=50}% for {$d=6 seconds}.

Action Priority List

    single
    [O]:45.07
  • if_expr:buff.hailstorm.up
    single
    [W]:2.55
Ice Strike 3172 3.6% 26.5 11.33sec 35960 33885 Direct 26.5 29124 58496 35960 23.3% 0.0%

Stats Details: Ice Strike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.45 26.45 0.00 0.00 0.00 1.0613 0.0000 951183.20 951183.20 0.00% 33884.91 33884.91
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.73% 20.30 8 30 29124.47 25500 40743 29123.36 26804 31478 591090 591090 0.00%
crit 23.27% 6.16 0 15 58496.49 51001 81487 58435.49 0 71486 360093 360093 0.00%

Action Details: Ice Strike

  • id:342240
  • school:frost
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:15.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1650.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:342240
  • name:Ice Strike
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].

Action Priority List

    single
    [L]:2.52
  • if_expr:buff.doom_winds_talent.up
    single
    [N]:23.93
  • if_expr:talent.hailstorm.enabled
Lava Lash 2522 2.9% 19.5 14.77sec 38746 35921 Direct 19.5 31367 63032 38745 23.3% 0.0%

Stats Details: Lava Lash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 19.52 19.52 0.00 0.00 0.00 1.0787 0.0000 756248.74 756248.74 0.00% 35921.19 35921.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.70% 14.97 6 25 31367.45 26855 42908 31358.39 28706 34553 469596 469596 0.00%
crit 23.30% 4.55 0 13 63032.40 53711 85817 62618.65 0 79154 286653 286653 0.00%

Action Details: Lava Lash

  • id:60103
  • school:fire
  • range:5.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:12.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:400.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage. Damage is increased by {$s2=100}% if your offhand weapon is imbued with Flametongue Weapon. {$?s334033=true}[Lava Lash will spread Flame Shock from your target to {$s3=0} nearby targets.][]{$?s334046=false}[ Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.][]

Action Priority List

    single
    [P]:4.78
  • if_expr:dot.flame_shock.refreshable
    single
    [U]:14.74
Lightning Bolt 4409 5.0% 14.7 18.80sec 90035 80637 Direct 14.7 70576 141494 90035 27.4% 0.0%

Stats Details: Lightning Bolt

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.69 14.69 0.00 0.00 0.00 1.1166 0.0000 1322203.91 1322203.91 0.00% 80636.94 80636.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.56% 10.66 0 22 70576.29 48172 120165 70652.67 0 93481 752047 752047 0.00%
crit 27.44% 4.03 0 13 141494.26 96344 240330 138966.28 0 226723 570157 570157 0.00%

Action Details: Lightning Bolt

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]

Action Priority List

    single
    [S]:3.74
  • if_expr:buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
    single
    [V]:10.94
  • if_expr:buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
main_hand 2488 2.8% 180.3 1.93sec 4139 2668 Direct 180.3 3854 7748 4139 23.5% 16.3%

Stats Details: Main Hand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 180.27 180.27 0.00 0.00 0.00 1.5514 0.0000 746073.05 1065845.82 30.00% 2667.58 2667.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.18% 108.48 55 161 3853.93 3628 4818 3854.16 3685 4108 418093 597291 30.00%
crit 23.48% 42.33 15 78 7748.13 7256 9637 7748.15 7301 8200 327980 468554 30.00%
miss 16.34% 29.46 10 57 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Main Hand

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Manic Grieftorch 3918 4.4% 26.8 9.33sec 43286 0 Direct 26.8 35058 70481 43287 23.2% 0.0%

Stats Details: Manic Grieftorch

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.83 26.83 0.00 0.00 0.00 0.0000 0.0000 1161221.19 1161221.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.77% 20.60 7 27 35057.99 34798 35812 35057.14 34798 35812 722020 722020 0.00%
crit 23.23% 6.23 0 16 70480.82 69597 71625 70429.76 0 71625 439201 439201 0.00%

Action Details: Manic Grieftorch

  • id:382135
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27599.74
  • base_dd_max:27599.74
  • base_dd_mult:1.00

Spelldata

  • id:382135
  • name:Manic Grieftorch
  • school:fire
  • tooltip:
  • description:Channel for 2 seconds, unleashing a furious volley of flame around your target, dealing [A Lot] fire damage. Whenever an allied player dies, this cooldown is reduced by 90 seconds.
offhand 1260 1.4% 182.7 1.89sec 2068 1331 Direct 182.7 1928 3876 2068 23.4% 16.4%

Stats Details: Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 182.70 182.70 0.00 0.00 0.00 1.5537 0.0000 377794.94 539720.81 30.00% 1330.95 1330.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.16% 109.91 55 164 1927.72 1814 2409 1927.87 1846 2032 211871 302680 30.00%
crit 23.43% 42.81 11 77 3875.62 3628 4818 3875.68 3703 4151 165924 237040 30.00%
miss 16.41% 29.98 12 54 0.00 0 0 0.00 0 0 0 0 0.00%

Action Details: Offhand

  • id:1
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Stormstrike 0 (8158) 0.0% (9.3%) 81.6 3.64sec 29974 28148

Stats Details: Stormstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 81.62 0.00 0.00 0.00 0.00 1.0649 0.0000 0.00 0.00 0.00% 28147.76 28147.76

Action Details: Stormstrike

  • id:17364
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]

Action Priority List

    single
    [K]:13.69
  • if_expr:buff.doom_winds_talent.up
    single
    [Q]:38.64
  • if_expr:talent.stormflurry.enabled&buff.stormbringer.up
    single
    [T]:29.29
    Stormstrike (_mh) 5438 6.2% 108.8 3.64sec 14984 0 Direct 108.8 12114 24379 14984 23.4% 0.0%

Stats Details: Stormstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 108.84 108.84 0.00 0.00 0.00 0.0000 0.0000 1630761.39 2329718.52 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.60% 83.37 38 131 12114.27 3763 27310 12148.01 10261 14132 1009994 1442886 30.00%
crit 23.40% 25.46 6 49 24378.57 7526 54135 24440.36 15208 32261 620767 886833 30.00%

Action Details: Stormstrike Mh

  • id:32175
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
    Stormstrike Off-Hand 2720 3.1% 108.8 3.64sec 7494 0 Direct 108.8 6055 12202 7494 23.4% 0.0%

Stats Details: Stormstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 108.84 108.84 0.00 0.00 0.00 0.0000 0.0000 815644.59 1165236.26 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.59% 83.36 41 142 6055.34 1881 13655 6071.70 5088 7008 504749 721088 30.00%
crit 23.41% 25.48 6 53 12201.59 3763 27310 12236.19 9010 16385 310896 444148 30.00%

Action Details: Stormstrike Offhand

  • id:32176
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of {$=}{$32175sw1+$32176sw1} Physical damage.{$?s210853=false}[ Stormstrike has a {$s4=0}% chance to generate {$210853m2=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
Windfury Weapon 0 (12758) 0.0% (14.5%) 1.0 0.00sec 3821538 0

Stats Details: Windfury Weapon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Weapon

  • id:33757
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:33757
  • name:Windfury Weapon
  • school:nature
  • tooltip:
  • description:Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]
    Windfury Attack 12758 14.5% 434.9 2.30sec 8786 0 Direct 434.9 7113 14295 8786 23.3% 0.0%

Stats Details: Windfury Attack

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 434.94 434.94 0.00 0.00 0.00 0.0000 0.0000 3821538.26 5459479.56 30.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.70% 333.58 185 488 7112.55 2449 16758 7100.76 6020 8209 2372633 3389563 30.00%
crit 23.30% 101.36 45 162 14294.97 4898 33517 14271.01 11887 16921 1448905 2069917 30.00%

Action Details: Windfury Attack

  • id:25504
  • school:physical
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Imbue your main-hand weapon with the element of Wind for {$319773d=3600 seconds}. Each main-hand attack has a {$319773h=25}% chance to trigger {$?s390288=true}[three][two] extra attacks, dealing $25504sw1 Physical damage each.{$?s262647=true}[ Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.][]}
Windlash 839 1.0% 35.9 7.77sec 7007 5432 Direct 35.9 5503 11063 7007 27.1% 0.0%

Stats Details: Windlash

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 35.90 35.90 0.00 0.00 0.00 1.2901 0.0000 251537.30 251537.30 0.00% 5431.72 5431.72
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.94% 26.18 0 76 5502.62 5183 6883 5496.98 0 6459 144064 144064 0.00%
crit 27.06% 9.71 0 32 11062.84 10366 13767 10987.83 0 13101 107473 107473 0.00%

Action Details: Windlash

  • id:114089
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windlash Off-Hand 455 0.5% 38.9 7.19sec 3507 2673 Direct 38.9 2752 5531 3507 27.2% 0.0%

Stats Details: Windlash Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.89 38.89 0.00 0.00 0.00 1.3123 0.0000 136403.96 136403.96 0.00% 2672.70 2672.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.82% 28.32 0 83 2751.69 2591 3442 2748.14 0 3243 77927 77927 0.00%
crit 27.18% 10.57 0 34 5531.39 5183 6883 5505.43 0 6551 58477 58477 0.00%

Action Details: Windlash Offhand

  • id:114093
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.60
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00

Spelldata

  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Windstrike 0 (12334) 0.0% (14.1%) 30.9 7.52sec 119686 116838

Stats Details: Windstrike

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.88 0.00 0.00 0.00 0.00 1.0244 0.0000 0.00 0.00 0.00% 116838.26 116838.26

Action Details: Windstrike

  • id:115356
  • school:physical
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:7.500
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.

Action Priority List

    single
    [J]:30.88
    Windstrike (_mh) 3297 3.8% 41.1 7.52sec 24023 0 Direct 41.1 19499 39133 24035 23.1% 0.0%

Stats Details: Windstrike Mh

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.12 41.10 0.00 0.00 0.00 0.0000 0.0000 987748.04 987748.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.90% 31.60 0 104 19499.40 5376 43921 19366.68 0 25716 616280 616280 0.00%
crit 23.10% 9.49 0 40 39133.20 10751 78030 38666.64 0 59937 371469 371469 0.00%

Action Details: Windstrike Mh

  • id:115357
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
    Windstrike Off-Hand 1648 1.9% 41.1 7.52sec 12004 0 Direct 41.1 9749 19575 12010 23.0% 0.0%

Stats Details: Windstrike Offhand

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.12 41.10 0.00 0.00 0.00 0.0000 0.0000 493586.42 493586.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.98% 31.64 0 102 9748.51 2688 21961 9683.98 0 12862 308424 308424 0.00%
crit 23.02% 9.46 0 35 19574.52 5376 39015 19340.18 0 32270 185162 185162 0.00%

Action Details: Windstrike Offhand

  • id:115360
  • school:physical
  • range:100.0
  • travel_speed:30.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of {$=}{$115357sw1+$115360sw1} Physical damage, bypassing armor.}
    Lightning Bolt (_ti) 7389 8.4% 30.8 7.55sec 71966 0 Direct 30.8 56461 113389 71965 27.2% 0.0%

Stats Details: Lightning Bolt Ti

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 30.77 30.77 0.00 0.00 0.00 0.0000 0.0000 2214259.58 2214259.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.77% 22.39 0 69 56460.98 29438 77249 56542.82 0 71287 1264104 1264104 0.00%
crit 27.23% 8.38 0 30 113389.40 58877 154498 112637.06 0 142574 950156 950156 0.00%

Action Details: Lightning Bolt Ti

  • id:188196
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:true
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.04
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.10

Spelldata

  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=0} Nature damage.{$?a343725=false}[ |cFFFFFFFFGenerates {$343725s1=8} Maelstrom.|r][]
pet - greater_earth_elemental 753 / 157
melee 753 0.2% 44.4 2.07sec 1049 764 Direct 44.4 849 1697 1049 23.6% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 44.40 44.40 0.00 0.00 0.00 1.3730 0.0000 46572.72 66534.15 30.00% 763.95 763.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.42% 33.93 15 65 848.88 805 1073 848.41 805 960 28805 41151 30.00%
crit 23.58% 10.47 1 30 1697.34 1610 2145 1696.71 1610 1943 17768 25383 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
pet - spirit_wolf 6891 / 5019
melee 6891 5.7% 420.5 1.41sec 3576 3436 Direct 420.5 2900 5797 3576 23.3% 0.0%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 420.53 420.53 0.00 0.00 0.00 1.0406 0.0000 1503803.47 2148345.45 30.00% 3436.46 3436.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 76.66% 322.37 204 472 2899.82 2733 3629 2899.83 2789 3048 934816 1335486 30.00%
crit 23.34% 98.16 54 161 5796.56 5466 7259 5797.24 5570 6203 568987 812860 30.00%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
T29_Shaman_Enhancement_Phys
Draconic Augmentation 1.0 0.00sec

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Berserking 2.0 180.34sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    default
    [E]:2.00
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Bloodlust 1.0 0.00sec

Stats Details: Bloodlust

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Bloodlust

  • id:2825
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:10750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:2825
  • name:Bloodlust
  • school:nature
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.

Action Priority List

    default
    [A]:1.00
Earth Elemental 1.1 309.65sec

Stats Details: Earth Elemental

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.13 0.00 0.00 0.00 0.00 0.9115 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Earth Elemental

  • id:198103
  • school:nature
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:198103
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}. While this elemental is active, your maximum health is increased by {$381755s1=15}%.

Action Priority List

    single
    [X]:1.13
Feral Spirit 15.5 19.85sec

Stats Details: Feral Spirit

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 15.49 0.00 0.00 0.00 0.00 1.0542 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Feral Spirit

  • id:51533
  • school:nature
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:attack_haste
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.

Action Priority List

    default
    [F]:15.49
Phial of Elemental Chaos 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:371339
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T29_Shaman_Enhancement_Phys
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Manic Grieftorch (_channel) 3.0 120.56sec

Stats Details: Manic Grieftorch Channel

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 26.87 0.00 0.00 1.3854 0.1543 0.00 0.00 0.00% 0.00 0.00

Action Details: Manic Grieftorch Channel

  • id:377463
  • school:fire
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:true
  • tick_on_application:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:377463
  • name:Manic Grieftorch
  • school:fire
  • tooltip:
  • description:Channel for {$d=2 seconds}, unleashing a furious volley of flame around your target, dealing {$=}{{$394954s1=7014}*({$d=2 seconds}/$t)*(1+{$@=}versadmg)} Fire damage to your target with a chance to strike nearby enemies for additional damage. Whenever an allied player dies, this cooldown is reduced by {$s2=90} seconds.

Action Details: Manic Grieftorch Missile

  • id:382136
  • school:fire
  • range:40.0
  • travel_speed:25.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:382136
  • name:Manic Grieftorch
  • school:fire
  • tooltip:
  • description:Channel for 2 seconds, unleashing a furious volley of flame around your target, dealing [A Lot] fire damage. Whenever an allied player dies, this cooldown is reduced by 90 seconds.
Elemental Potion of Ultimate Power 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [B]:1.00
  • if_expr:(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
Windfury Totem 1.0 0.00sec

Stats Details: Windfury Totem

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Windfury Totem

  • id:8512
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:750.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:8512
  • name:Windfury Totem
  • school:nature
  • tooltip:
  • description:Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Ascendance 5.7 0.0 46.2sec 46.2sec 8.2sec 15.55% 87.70% 0.0 (0.0) 5.6

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_ascendance
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 333.5s
  • trigger_min/max:6.0s / 333.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 90.0s

Stack Uptimes

  • ascendance_1:15.55%

Spelldata

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a {$114089=}r yard range. Stormstrike is empowered and has a {$114089=}r yard range.{$?s384411=true}[ Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$384437t1=1} sec.][]
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, immediately dealing {$344548s1=0} Nature damage to any enemy within {$344548=}A1 yds, reducing the cooldown and cost of Stormstrike by {$s4=60}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$114089=}r yd range.{$?s384411=true}[ While Ascendance is active, generate {$s1=0} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.3sec 180.3sec 12.0sec 8.11% 0.00% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:180.0s / 181.1s
  • trigger_min/max:180.0s / 181.1s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Doom Winds (_talent) 3.7 0.0 90.4sec 90.4sec 7.9sec 9.85% 11.21% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_doom_winds_talent
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:90.0s / 92.3s
  • trigger_min/max:90.0s / 92.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • doom_winds_talent_1:9.85%

Spelldata

  • id:384352
  • name:Doom Winds
  • tooltip:Chance to activate Windfury Weapon increased to {$=}{{$319773h=25}}.1%. Damage dealt by Windfury Weapon increased by {$s2=10}%.
  • description:Strike your target for {$s3=0} Physical damage, increase your chance to activate Windfury Weapon by {$s1=200}%, and increases damage dealt by Windfury Weapon by {$s2=10}% for {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:0.00%
Draconic Augmentation 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • draconic_augmentation_1:100.00%

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Earthen Weapon 15.5 0.0 23.3sec 19.8sec 17.8sec 72.79% 100.00% 0.0 (0.0) 11.6

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_earthen_weapon
  • max_stacks:10
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.4s / 122.1s
  • trigger_min/max:6.2s / 38.9s
  • trigger_pct:50.00%
  • duration_min/max:0.0s / 113.8s

Stack Uptimes

  • earthen_weapon_2:69.92%
  • earthen_weapon_4:2.86%
  • earthen_weapon_6:0.00%

Spelldata

  • id:392375
  • name:Earthen Weapon
  • tooltip:Increases physical damage dealt from your abilities by {$s1=15}%.
  • description:{$@spelldesc262624=Your Feral Spirits are now imbued with Fire, Frost, or Lightning, increasing your damage dealt with that element by {$224127s1=20}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 7.2 0.9 38.3sec 33.6sec 10.6sec 25.44% 0.00% 0.9 (0.9) 6.9

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 314.0s
  • trigger_min/max:1.6s / 310.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.8s

Stack Uptimes

  • elemental_blast_critical_strike_1:25.44%

Spelldata

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 7.1 0.9 38.6sec 33.7sec 10.7sec 25.39% 0.00% 0.9 (0.9) 6.9

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 242.9s
  • trigger_min/max:1.3s / 235.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 37.3s

Stack Uptimes

  • elemental_blast_haste_1:25.39%

Spelldata

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 7.2 0.9 38.2sec 33.4sec 10.6sec 25.68% 0.00% 0.9 (0.9) 7.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:3.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 248.8s
  • trigger_min/max:1.6s / 248.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 35.3s

Stack Uptimes

  • elemental_blast_mastery_1:25.68%

Spelldata

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$=}{{$s1=3}*{$168534=}bc1}%.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike or Haste by {$118522s1=3}% or Mastery by {$=}{{$173184s1=3}*{$168534=}bc1}% for {$118522d=10 seconds}.{$?s137041=true}[ If Lava Burst is known, Elemental Blast replaces Lava Burst and gains {$394152s2=1} additional {$=}Lcharge:charges;.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Air 1.3 0.1 125.2sec 100.9sec 57.9sec 25.05% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_air
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.6s

Stack Uptimes

  • elemental_chaos_air_1:25.05%

Spelldata

  • id:371350
  • name:Elemental Chaos: Air
  • tooltip:Haste increased by {$=}w1. Movement speed increased by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Earth 1.3 0.1 124.1sec 100.7sec 58.0sec 24.80% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_earth
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 300.0s

Stack Uptimes

  • elemental_chaos_earth_1:24.80%

Spelldata

  • id:371351
  • name:Elemental Chaos: Earth
  • tooltip:Mastery increased by {$=}w1. Damage taken reduced by {$=}M2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Fire 1.3 0.1 124.6sec 99.9sec 57.8sec 25.09% 0.00% 0.1 (0.1) 1.1

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_fire
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 314.3s

Stack Uptimes

  • elemental_chaos_fire_1:25.09%

Spelldata

  • id:371348
  • name:Elemental Chaos: Fire
  • tooltip:Critical strike increased by {$=}w1. Damage dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Chaos: Frost 1.3 0.1 123.2sec 99.0sec 57.8sec 25.06% 0.00% 0.1 (0.1) 1.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_chaos_frost
  • max_stacks:1
  • base duration:60.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:versatility_rating
  • amount:652.00

Trigger Details

  • interval_min/max:60.0s / 300.0s
  • trigger_min/max:60.0s / 240.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 311.7s

Stack Uptimes

  • elemental_chaos_frost_1:25.06%

Spelldata

  • id:371353
  • name:Elemental Chaos: Frost
  • tooltip:Versatility increased by {$=}w1. Healing dealt by critical strikes increased by {$=}w2%.
  • description:
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Lariat - Empowered Earth 7.6 3.5 37.8sec 25.0sec 14.4sec 36.40% 0.00% 3.5 (3.5) 7.2

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_lariat__empowered_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:580.43

Trigger Details

  • interval_min/max:12.0s / 124.4s
  • trigger_min/max:0.0s / 118.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.8s

Stack Uptimes

  • elemental_lariat__empowered_earth_1:36.40%

Spelldata

  • id:375345
  • name:Elemental Lariat - Empowered Earth
  • tooltip:Mastery increased by {$=}w1.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.0 0.0 0.0sec 0.0sec 29.4sec 9.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:agility
  • amount:886.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.1s / 30.0s

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:9.94%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie) 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:75.79

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • fated_fortune_cookie_1:100.00%

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:{$=}pri increased by {$=}w1.
  • description:Increases {$=}pri by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Feral Spirit 12.3 3.2 25.2sec 19.8sec 17.7sec 72.80% 0.00% 62.3 (62.3) 11.6

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_feral_spirit
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Trigger Details

  • interval_min/max:15.0s / 122.1s
  • trigger_min/max:6.2s / 38.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 113.8s

Stack Uptimes

  • feral_spirit_1:72.80%

Spelldata

  • id:333957
  • name:Feral Spirit
  • tooltip:Generating {$s1=1} stack of Maelstrom Weapon every {$t1=3} sec.
  • description:{$@spelldesc51533=Summons two {$?s262624=false}[Elemental ][]Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects, and each {$?s262624=false}[Elemental ][]Feral Spirit summoned grants you {$?s262624=false}[{$224125s1=20}%][{$392375s1=15}%] increased {$?s262624=false}[Fire, Frost, or Nature][Physical] damage dealt by your abilities. Feral Spirit generates one stack of Maelstrom Weapon immediately, and one stack every {$333957t1=3} sec for {$333957d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flurry 36.6 566.4 8.2sec 0.5sec 7.4sec 90.29% 92.66% 566.4 (1388.1) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_flurry
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 90.9s
  • trigger_min/max:0.0s / 14.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 89.5s

Stack Uptimes

  • flurry_1:18.15%
  • flurry_2:37.36%
  • flurry_3:34.78%

Spelldata

  • id:382889
  • name:Flurry
  • tooltip:Attack speed increased by {$=}w1%.
  • description:{$@spelldesc382888=Increases your attack speed by {$382889s1=15}% for your next {$382889=}n melee swings after dealing a critical strike with a spell or ability.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Forceful Winds 17.5 127.5 17.5sec 2.1sec 14.6sec 85.50% 100.00% 63.2 (63.2) 16.7

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_forceful_winds
  • max_stacks:5
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.0s / 45.6s
  • trigger_min/max:0.0s / 36.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • forceful_winds_1:14.28%
  • forceful_winds_2:13.56%
  • forceful_winds_3:12.24%
  • forceful_winds_4:10.59%
  • forceful_winds_5:34.83%

Spelldata

  • id:262652
  • name:Forceful Winds
  • tooltip:Windfury attack damage increased by {$s1=40}%.
  • description:{$@spelldesc262647=Windfury causes each successive Windfury attack within {$262652d=15 seconds} to increase the damage of Windfury by {$262652s1=40}%, stacking up to {$262652u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Fury of the Storm 36.7 33.1 8.1sec 4.2sec 5.5sec 67.79% 0.00% 29.3 (151.4) 36.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_fury_of_the_storm
  • max_stacks:10
  • base duration:4.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:4.0s / 101.4s
  • trigger_min/max:0.8s / 28.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 95.0s

Stack Uptimes

  • fury_of_the_storm_2:0.00%
  • fury_of_the_storm_3:0.00%
  • fury_of_the_storm_4:0.01%
  • fury_of_the_storm_5:6.44%
  • fury_of_the_storm_6:6.96%
  • fury_of_the_storm_7:5.63%
  • fury_of_the_storm_8:4.76%
  • fury_of_the_storm_9:3.86%
  • fury_of_the_storm_10:40.13%

Spelldata

  • id:396006
  • name:Fury of the Storm
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc393693=Consuming Maelstrom Weapon stacks increases your Haste by {$396006s1=1}% per stack for {$396006d=4 seconds}.}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Hailstorm 45.5 24.3 6.5sec 4.2sec 2.6sec 39.18% 94.68% 18.2 (86.5) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_hailstorm
  • max_stacks:10
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 57.1s
  • trigger_min/max:0.8s / 28.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 53.8s

Stack Uptimes

  • hailstorm_2:0.01%
  • hailstorm_3:0.02%
  • hailstorm_4:0.06%
  • hailstorm_5:6.73%
  • hailstorm_6:4.37%
  • hailstorm_7:3.22%
  • hailstorm_8:2.54%
  • hailstorm_9:2.07%
  • hailstorm_10:20.17%

Spelldata

  • id:334196
  • name:Hailstorm
  • tooltip:Your next Frost Shock will deal {$s1=15}% additional damage, and hit up to {$=}{{$334195s1=5}/{$s2=1}} additional {$=}Ltarget:targets;.
  • description:{$@spelldesc334195=Each stack of Maelstrom Weapon consumed increases the damage of your next Frost Shock by {$334196s1=15}%, and causes your next Frost Shock to hit {$334196m2=1} additional target per Maelstrom Weapon stack consumed, up to {$s1=5}.{$?s384359=true}[ Consuming at least {$384359s2=2} {$=}Lstack:stacks; of Hailstorm generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon.][]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Ice Strike 26.1 0.3 11.5sec 11.3sec 3.3sec 29.00% 53.95% 0.3 (0.3) 0.2

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_ice_strike
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:7.5s / 46.3s
  • trigger_min/max:7.5s / 46.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.5s

Stack Uptimes

  • ice_strike_1:29.00%

Spelldata

  • id:384357
  • name:Ice Strike
  • tooltip:Damage of your next Frost Shock increased by {$s1=100}%.
  • description:{$@spelldesc342240=Strike your target with an icy blade, dealing {$s1=0} Frost damage and snaring them by {$s2=50}% for {$d=6 seconds}. Ice Strike increases the damage of your next Frost Shock by {$384357s1=100}%{$?s384359=true}[ and generates {$384359s1=1} {$=}Lstack:stacks; of Maelstrom Weapon][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Inspired by Fire and Earth 7.5 3.6 38.0sec 24.9sec 14.4sec 36.15% 0.00% 3.6 (3.6) 7.2

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_inspired_by_fire_and_earth
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:277.19

Trigger Details

  • interval_min/max:12.0s / 125.9s
  • trigger_min/max:0.0s / 106.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.9s

Stack Uptimes

  • inspired_by_fire_and_earth_1:36.15%

Spelldata

  • id:394461
  • name:Inspired by Fire and Earth
  • tooltip:Haste and Versatility increased by {$=}w1.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Legacy of the Frost Witch 27.3 18.5 10.9sec 6.4sec 7.2sec 65.47% 0.00% 18.5 (18.5) 26.6

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_legacy_of_the_frost_witch
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 92.7s
  • trigger_min/max:0.8s / 33.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 89.0s

Stack Uptimes

  • legacy_of_the_frost_witch_1:65.47%

Spelldata

  • id:384451
  • name:Legacy of the Frost Witch
  • tooltip:Damage dealt by your physical abilities increased by {$=}w1%.
  • description:{$@spelldesc335899=Consuming {$s1=5} stacks of Maelstrom Weapon will reset the cooldown of Stormstrike and cause your next Stormstrike to deal {$335901s1=30}% increased damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Maelstrom of Elements 80.2 69.7 3.7sec 2.0sec 1.8sec 33.22% 30.72% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_of_elements
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 18.8s
  • trigger_min/max:0.0s / 13.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.4s

Stack Uptimes

  • maelstrom_of_elements_1:33.22%

Spelldata

  • id:394677
  • name:Maelstrom of Elements
  • tooltip:Fire, Frost, and Nature ability damage increased by {$=}w1% and generates {$=}w2 additional stack of Maelstrom Weapon.
  • description:{$@spelldesc393691=Stormstrike increases the damage of your next direct Fire, Frost, or Nature spell by {$394677s1=10}% and causes it to generate {$394677s2=1} additional stack of Maelstrom Weapon.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Maelstrom Weapon 44.1 464.1 6.8sec 1.5sec 6.0sec 87.75% 100.00% 79.1 (83.4) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 66.5s
  • trigger_min/max:0.0s / 13.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 65.9s

Stack Uptimes

  • maelstrom_weapon_1:9.22%
  • maelstrom_weapon_2:10.04%
  • maelstrom_weapon_3:10.25%
  • maelstrom_weapon_4:10.66%
  • maelstrom_weapon_5:9.79%
  • maelstrom_weapon_6:7.62%
  • maelstrom_weapon_7:6.48%
  • maelstrom_weapon_8:5.35%
  • maelstrom_weapon_9:4.27%
  • maelstrom_weapon_10:14.07%

Spelldata

  • id:344179
  • name:Maelstrom Weapon
  • tooltip:Your next damage or healing spell has its cast time reduced by {$=}{$max({$187881s1=20}, -100)*-1}%{$?s383303=true}[ and damage or healing increased by][]{$?s383303=true}&!s384149[ {$=}{$min({$187881=}w2, 5*$s~2)}%]?s383303&s384149[ {$187881=}w2%][].
  • description:{$@spelldesc187880=When you deal damage with a melee weapon, you have a chance to gain Maelstrom Weapon, stacking up to {$344179u=5} times. Each stack of Maelstrom Weapon reduces the cast time of your next damage or healing spell by {$187881s1=20}%{$?s383303=true}[ and increase the damage or healing of your next spell by {$187881s2=0}%][]. A maximum of {$s2=5} stacks of Maelstrom Weapon can be consumed at a time.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Phial of Elemental Chaos 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_phial_of_elemental_chaos
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:60.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • phial_of_elemental_chaos_1:100.00%

Spelldata

  • id:371339
  • name:Phial of Elemental Chaos
  • tooltip:Periodically gaining an elemental boon. Each boon increases a secondary stat by {$=}w1 and grants a bonus effect.
  • description:Infuse yourself with the power of the elements, granting you a random elemental boon that changes every {$=}M2 sec. Each boon increases a secondary stat by {$s1=275} and grants a bonus effect. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Sophic Devotion 4.3 1.2 60.9sec 45.6sec 16.5sec 23.57% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:932.20

Trigger Details

  • interval_min/max:15.0s / 221.8s
  • trigger_min/max:0.0s / 216.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 71.4s

Stack Uptimes

  • sophic_devotion_1:23.57%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sophic Devotion (_oh) 4.3 1.2 60.6sec 45.2sec 16.5sec 23.62% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_sophic_devotion_oh
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:932.20

Trigger Details

  • interval_min/max:15.0s / 226.2s
  • trigger_min/max:0.0s / 226.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.2s

Stack Uptimes

  • sophic_devotion_oh_1:23.62%

Spelldata

  • id:390224
  • name:Sophic Devotion
  • tooltip:{$=}pri increased by {$=}w1.
  • description:{$@spelldesc389550=Permanently enchants a weapon to sometimes harness Order, increasing your primary stat by {$=}ec1s1 for {$390224d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Static Accumulation 5.9 2.0 44.8sec 31.9sec 7.4sec 14.50% 100.00% 39.3 (39.3) 5.7

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_static_accumulation
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:6.0s / 333.5s
  • trigger_min/max:0.8s / 333.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.3s

Stack Uptimes

  • static_accumulation_1:14.50%

Spelldata

  • id:384437
  • name:Static Accumulation
  • tooltip:Generating {$384411s1=1} {$=}lstack:stacks; of Maelstrom Weapon every {$t1=1} sec.
  • description:{$@spelldesc384411=While Ascendance is active, generate {$s1=1} Maelstrom Weapon {$=}lstack:stacks; every {$384437t1=1} sec.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 64.0 23.5 4.6sec 3.4sec 1.3sec 27.16% 56.62% 23.5 (23.5) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 69.4s
  • trigger_min/max:0.0s / 69.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 7.6s

Stack Uptimes

  • stormbringer_1:27.16%

Spelldata

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike cooldown has been reset{$?=}{$?a319930=false}[ and will deal {$319930=}w1% additional damage as Nature][].
  • description:{$@spelldesc201845=Your special attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike{$?a319930=false}[ and cause your next Stormstrike to deal {$319930s1=25}% additional damage as Nature damage][].}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Windfury Totem 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • windfury_totem_1:100.00%

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they main-hand auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%
Witch Doctor's Ancestry 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_ancestry
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_ancestry_1:100.00%

Spelldata

  • id:384447
  • name:Witch Doctor's Ancestry
  • tooltip:
  • description:Increases the chance to gain a stack of Maelstrom Weapon by {$s1=2}%, and whenever you gain a stack of Maelstrom Weapon, the cooldown of Feral Spirits is reduced by {$=}{{$m2=2000}/1000}.1 sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
witch_doctors_wolf_bones 1.0 0.0 0.0sec 0.0sec 300.0sec 100.00% 100.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_witch_doctors_wolf_bones
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:240.0s / 360.0s

Stack Uptimes

  • witch_doctors_wolf_bones_1:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Incarnate's Mark of Frost

Buff Details

  • buff initial source:T29_Shaman_Enhancement_Phys
  • cooldown name:buff_incarnates_mark_of_frost
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:567.88

Spelldata

  • id:382079
  • name:Incarnate's Mark of Frost
  • tooltip:Critical Strike increased by {$=}w1. Dealing harmful spells and abilities has a chance to grant you an additional {$377452=}w2 Versatility or Haste if any nearby allies are Marked by Earth or Fire.
  • description:Swear your oath to the Primalists to become Marked by Frost, increasing your Critical Strike by [medium amount]. Fighting alongside allies who are Marked by Earth or Fire has a chance to grant you half of their Mark's stats for {$s1=0} seconds.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Windfury-ForcefulWinds: 1 52.2 36.0 69.0 17.6s 15.0s 54.3s
Windfury-ForcefulWinds: 2 51.9 33.0 69.0 17.8s 1.0s 61.5s
Windfury-ForcefulWinds: 3 50.4 30.0 69.0 18.3s 0.3s 78.2s
Windfury-ForcefulWinds: 4 47.5 24.0 69.0 19.4s 1.2s 88.8s
Windfury-ForcefulWinds: 5 233.0 99.0 384.0 4.3s 0.0s 91.7s
windfury_totem_extra_attack_mh 30.8 10.0 57.0 9.5s 1.1s 119.0s
windfury_totem_extra_attack_oh 31.4 12.0 60.0 9.3s 0.1s 152.1s
delayed_aa_channel 4.4 1.0 7.0 69.7s 0.0s 242.5s
Windfury: Unruly Winds 145.0 83.0 208.0 2.3s 0.0s 36.2s
Maelstrom Weapon: Feral Spirit 83.1 58.0 113.0 3.6s 0.0s 23.9s
Maelstrom Weapon: Swirling Maelstrom 71.5 50.0 95.0 4.1s 0.8s 43.1s
Maelstrom Weapon: Static Accumulation 83.4 0.0 216.0 5.5s 1.0s 328.5s
Stormflurry 37.5 8.0 75.0 10.4s 0.8s 145.6s
Flametongue: Windfury Attack 434.9 249.0 624.0 2.3s 0.0s 36.2s
Stormbringer: Windfury Attack 48.7 16.0 87.0 7.0s 0.0s 111.8s
Maelstrom Weapon: Windfury Attack 87.1 45.0 140.0 4.4s 0.0s 79.3s
Flametongue: main_hand 150.8 75.0 218.0 2.4s 1.1s 95.3s
Maelstrom Weapon: main_hand 30.2 8.0 58.0 10.0s 1.1s 131.1s
Windfury: main_hand 58.2 26.0 97.0 5.6s 1.1s 96.9s
Flametongue: Windlash 35.9 0.0 103.0 7.7s 1.1s 329.8s
Maelstrom Weapon: Windlash 7.2 0.0 29.0 30.0s 1.1s 326.8s
Windfury: Windlash 14.1 0.0 50.0 17.3s 1.1s 333.1s
Flametongue: offhand 152.7 76.0 217.0 2.3s 1.1s 91.4s
Maelstrom Weapon: offhand 30.5 10.0 63.0 9.9s 1.1s 114.1s
Flametongue: Windlash Off-Hand 38.9 0.0 105.0 7.1s 0.1s 328.7s
Maelstrom Weapon: Windlash Off-Hand 7.8 0.0 28.0 28.2s 0.1s 332.8s
Flametongue: Windstrike 41.1 0.0 125.0 7.4s 0.8s 329.0s
Stormbringer: Windstrike 4.6 0.0 21.0 40.0s 0.8s 343.1s
Maelstrom Weapon: Windstrike 8.2 0.0 29.0 27.3s 0.8s 330.2s
Windfury: Windstrike 16.1 0.0 61.0 16.1s 0.8s 327.9s
Flametongue: Windstrike Off-Hand 41.1 0.0 125.0 7.4s 0.8s 329.0s
Stormbringer: Windstrike Off-Hand 4.6 0.0 20.0 39.6s 0.8s 326.9s
Maelstrom Weapon: Windstrike Off-Hand 8.2 0.0 33.0 27.3s 0.8s 319.7s
Flametongue: Lava Lash 19.5 9.0 30.0 14.8s 6.0s 106.8s
Stormbringer: Lava Lash 2.2 0.0 9.0 73.0s 6.1s 319.1s
Maelstrom Weapon: Lava Lash 3.9 0.0 12.0 56.5s 6.1s 321.4s
Flametongue: Ice Strike 26.5 19.0 34.0 11.3s 7.5s 46.3s
Stormbringer: Ice Strike 3.0 0.0 11.0 66.2s 7.6s 328.8s
Maelstrom Weapon: Ice Strike 5.3 0.0 15.0 47.2s 7.5s 307.3s
Windfury: Ice Strike 10.0 2.0 20.0 29.6s 7.5s 250.9s
Flametongue: Stormstrike 108.8 53.0 172.0 3.6s 0.8s 93.9s
Stormbringer: Stormstrike 12.3 1.0 30.0 23.1s 0.8s 263.7s
Maelstrom Weapon: Stormstrike 21.7 6.0 44.0 14.2s 0.8s 169.2s
Windfury: Stormstrike 46.5 17.0 83.0 7.5s 0.8s 113.9s
Flametongue: Stormstrike Off-Hand 108.8 53.0 172.0 3.6s 0.8s 93.9s
Stormbringer: Stormstrike Off-Hand 12.1 1.0 32.0 23.4s 0.8s 286.8s
Maelstrom Weapon: Stormstrike Off-Hand 21.9 5.0 44.0 14.1s 0.8s 165.2s
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 28.02% 14.29% 48.02% 0.8s 0.0s 32.4s

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.7250.0013.1309.8973.74317.230
Doom Winds0.4770.0012.2961.0070.0004.281
Windstrike0.8730.0014.35826.7370.00082.475
Lava Lash6.3050.00197.858114.74049.646213.166
Flame Shock25.0980.001240.499227.37147.065324.267
Ice Strike0.8140.00135.52319.8033.33368.670
Frost Shock1.9910.00151.63487.49245.380143.254
Elemental Blast6.5820.00195.64411.2330.00097.389
Stormstrike1.4780.0019.543118.40259.742175.716
Earth Elemental9.9850.01943.4831.1890.00043.483

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
T29_Shaman_Enhancement_Phys
mana_regenMana753.32242506.95100.00%321.92236955.6949.42%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 50000.0 808.37 810.60 236953.4 49331.1 43850.8 50000.0
Usage Type Count Total Avg RPE APR
T29_Shaman_Enhancement_Phys
BloodlustMana 1.0010750.0010750.0010750.000.00
Elemental BlastMana 24.2833383.851375.001374.99107.42
Flame ShockMana 10.147603.49750.00256.38107.96
Frost ShockMana 47.6223809.96500.00499.99120.34
Ice StrikeMana 26.4543643.721650.001649.9821.79
Lava LashMana 19.527807.28400.00400.0096.86
Lightning BoltMana 14.687342.42500.00499.98180.08
StormstrikeMana 108.84108835.091000.001333.4722.48

Statistics & Data Analysis

Fight Length
T29_Shaman_Enhancement_Phys Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
T29_Shaman_Enhancement_Phys Damage Per Second
Count 7499
Mean 87679.81
Minimum 69689.64
Maximum 117326.71
Spread ( max - min ) 47637.07
Range [ ( max - min ) / 2 * 100% ] 27.17%
Standard Deviation 6178.2448
5th Percentile 78297.75
95th Percentile 98468.22
( 95th Percentile - 5th Percentile ) 20170.47
Mean Distribution
Standard Deviation 71.3450
95.00% Confidence Interval ( 87539.98 - 87819.64 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 191
0.1% Error 19074
0.1 Scale Factor Error with Delta=300 325848
0.05 Scale Factor Error with Delta=300 1303389
0.01 Scale Factor Error with Delta=300 32584713
Priority Target DPS
T29_Shaman_Enhancement_Phys Priority Target Damage Per Second
Count 7499
Mean 87679.81
Minimum 69689.64
Maximum 117326.71
Spread ( max - min ) 47637.07
Range [ ( max - min ) / 2 * 100% ] 27.17%
Standard Deviation 6178.2448
5th Percentile 78297.75
95th Percentile 98468.22
( 95th Percentile - 5th Percentile ) 20170.47
Mean Distribution
Standard Deviation 71.3450
95.00% Confidence Interval ( 87539.98 - 87819.64 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 191
0.1% Error 19074
0.1 Scale Factor Error with Delta=300 325848
0.05 Scale Factor Error with Delta=300 1303389
0.01 Scale Factor Error with Delta=300 32584713
DPS(e)
T29_Shaman_Enhancement_Phys Damage Per Second (Effective)
Count 7499
Mean 87679.81
Minimum 69689.64
Maximum 117326.71
Spread ( max - min ) 47637.07
Range [ ( max - min ) / 2 * 100% ] 27.17%
Damage
T29_Shaman_Enhancement_Phys Damage
Count 7499
Mean 24720388.63
Minimum 16116318.73
Maximum 35087218.04
Spread ( max - min ) 18970899.31
Range [ ( max - min ) / 2 * 100% ] 38.37%
DTPS
T29_Shaman_Enhancement_Phys Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
T29_Shaman_Enhancement_Phys Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
T29_Shaman_Enhancement_Phys Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
T29_Shaman_Enhancement_Phys Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
T29_Shaman_Enhancement_Phys Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
T29_Shaman_Enhancement_Phys Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
T29_Shaman_Enhancement_PhysTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
T29_Shaman_Enhancement_Phys Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 windfury_weapon
4 0.00 flametongue_weapon
5 0.00 lightning_shield
6 0.00 windfury_totem
7 0.00 variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
8 0.00 variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
9 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
Default action list Executed every time the actor is available.
# count action,conditions
A 1.00 bloodlust,line_cd=600
B 1.00 potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
C 1.00 auto_attack
0.00 use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
0.00 use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
0.00 use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
D 2.99 use_items,slots=trinket1,if=!variable.trinket1_is_weird
0.00 use_items,slots=trinket2,if=!variable.trinket2_is_weird
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
E 2.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
0.00 fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
F 15.49 feral_spirit
0.00 ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
G 3.72 doom_winds,if=raid_event.adds.in>=90|active_enemies>1
H 0.00 call_action_list,name=single,if=active_enemies=1
If_only_one_enemy,_priority_follows_the_'single'_action_list.
I 0.00 call_action_list,name=aoe,if=active_enemies>1
On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions.single
# count action,conditions
J 30.88 windstrike
0.00 lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
0.00 windfury_totem,if=!buff.windfury_totem.up
K 13.69 stormstrike,if=buff.doom_winds_talent.up
0.00 crash_lightning,if=buff.doom_winds_talent.up
L 2.52 ice_strike,if=buff.doom_winds_talent.up
0.00 sundering,if=buff.doom_winds_talent.up
0.00 primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
M 1.95 flame_shock,if=!ticking
0.00 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
N 23.93 ice_strike,if=talent.hailstorm.enabled
O 45.07 frost_shock,if=buff.hailstorm.up
P 4.78 lava_lash,if=dot.flame_shock.refreshable
Q 38.64 stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
R 24.28 elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
0.00 lava_burst,if=buff.maelstrom_weapon.stack>=5
S 3.74 lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
T 29.29 stormstrike
0.00 windfury_totem,if=buff.windfury_totem.remains<10
0.00 ice_strike
U 14.74 lava_lash
0.00 bag_of_tricks
V 10.94 lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
0.00 sundering,if=raid_event.adds.in>=40
0.00 fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
W 2.55 frost_shock
0.00 crash_lightning
0.00 fire_nova,if=active_dot.flame_shock
X 1.13 earth_elemental
Y 8.19 flame_shock
0.00 windfury_totem,if=buff.windfury_totem.remains<30

Sample Sequence

01234678ACDEFGKKKLMRKOURXOQNQVOTJFJOJJJNOQRTOPYVONFROTQUVOYNTVOTQJJOJFNOQQQROPTRNOYTQQROQUFNWTVTOQRTONQUSOQYGWRKLFKOSTJJOJJNFOPQQROTRDNOQQQPQROQNQFJOJJQOQNQPQQFQQQRNORTQOQPQSNOQRTOQQFJNJJEOGPKJJOJFKJJJJJNJJJFJJJMJJNOQRTOFUYRNOTVYOURTONQVOTUYWDRNOFTJJJJJONQPQQRFOTRNOUTBJJOGJKFKKKLOQQPQQQQQJNFJJO

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask T29_Shaman_Enhancement_Phys 50000.0/50000: 100% mana
Pre precombat 1 food T29_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 2 augmentation T29_Shaman_Enhancement_Phys 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 3 windfury_weapon Fluffy_Pillow 50000.0/50000: 100% mana elemental_chaos_air
Pre precombat 4 flametongue_weapon Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
Pre precombat 6 windfury_totem Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
Pre precombat 7 trinket1_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
Pre precombat 8 trinket2_is_weird Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
0:00.000 default A bloodlust Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_chaos_air
0:00.000 default C auto_attack Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(3), elemental_chaos_air
0:00.000 default D use_items Fluffy_Pillow 39250.0/50000: 78% mana bloodlust, flurry(2), elemental_chaos_air
0:01.564 default E berserking Fluffy_Pillow 41752.4/50000: 84% mana bloodlust, flurry(3), forceful_winds, elemental_chaos_air
0:01.564 default F feral_spirit Fluffy_Pillow 41752.4/50000: 84% mana bloodlust, berserking, flurry(3), forceful_winds, elemental_chaos_air
0:02.377 default G doom_winds Fluffy_Pillow 43053.2/50000: 86% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_weapon, elemental_chaos_air
0:03.190 single K stormstrike Fluffy_Pillow 44354.0/50000: 89% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon, doom_winds_talent, elemental_chaos_air
0:04.002 single K stormstrike Fluffy_Pillow 44653.2/50000: 89% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(5), doom_winds_talent, elemental_chaos_air
0:04.814 single K stormstrike Fluffy_Pillow 44952.4/50000: 90% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(9), doom_winds_talent, elemental_chaos_air
0:05.625 single L ice_strike Fluffy_Pillow 45250.0/50000: 90% mana bloodlust, berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), doom_winds_talent, elemental_chaos_air
0:06.440 single M flame_shock Fluffy_Pillow 44904.0/50000: 90% mana bloodlust, berserking, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, elemental_chaos_air
0:07.254 single R elemental_blast Fluffy_Pillow 45456.4/50000: 91% mana bloodlust, berserking, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(10), doom_winds_talent, ice_strike, elemental_chaos_air
0:08.067 single K stormstrike Fluffy_Pillow 45382.2/50000: 91% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon, hailstorm(10), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
0:08.822 single O frost_shock Fluffy_Pillow 45590.2/50000: 91% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon(2), hailstorm(10), doom_winds_talent, ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
0:09.576 single U lava_lash Fluffy_Pillow 46296.6/50000: 93% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(4), doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_air
0:10.331 single R elemental_blast Fluffy_Pillow 47104.6/50000: 94% mana bloodlust, berserking, flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(6), doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_air
0:11.087 single X earth_elemental Fluffy_Pillow 46939.2/50000: 94% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), hailstorm(6), legacy_of_the_frost_witch, elemental_chaos_air
0:11.840 single O frost_shock Fluffy_Pillow 48144.0/50000: 96% mana bloodlust, berserking, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), hailstorm(6), legacy_of_the_frost_witch, elemental_chaos_air
0:12.595 single Q stormstrike Fluffy_Pillow 48852.0/50000: 98% mana bloodlust, berserking, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(5), elemental_lariat__empowered_earth, elemental_chaos_air
0:13.348 single N ice_strike Fluffy_Pillow 49056.8/50000: 98% mana bloodlust, berserking, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(6), elemental_lariat__empowered_earth, elemental_chaos_air
0:14.103 single Q stormstrike Fluffy_Pillow 48614.8/50000: 97% mana bloodlust, flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(9), ice_strike, elemental_lariat__empowered_earth, elemental_chaos_air
0:14.917 single V lightning_bolt Fluffy_Pillow 48917.2/50000: 98% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(9), ice_strike, elemental_lariat__empowered_earth, elemental_chaos_air
0:15.810 single O frost_shock Fluffy_Pillow 49846.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), hailstorm(10), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:16.623 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, fury_of_the_storm(10), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:17.436 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), elemental_blast_mastery, forceful_winds, fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(5), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:18.249 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), elemental_blast_mastery, forceful_winds(2), fury_of_the_storm(10), maelstrom_weapon(6), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:19.062 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(9), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:19.874 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(7), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_air
0:20.677 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_air
0:21.481 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(10), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_air
0:22.285 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(8), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_air
0:23.089 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(6), hailstorm(10), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_air
0:23.891 single O frost_shock Fluffy_Pillow 49633.2/50000: 99% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(7), hailstorm(10), ice_strike, legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:24.694 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:25.497 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon(9), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:26.301 single T stormstrike Fluffy_Pillow 49911.4/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), hailstorm(10), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:27.080 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon, hailstorm(10), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:27.859 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(4), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:28.639 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(4), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:29.418 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(7), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:30.198 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon, hailstorm(7), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:30.978 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), inspired_by_fire_and_earth, elemental_chaos_air
0:31.758 default F feral_spirit Fluffy_Pillow 49598.0/50000: 99% mana bloodlust, flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(5), ice_strike, inspired_by_fire_and_earth, elemental_chaos_air
0:32.537 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(4), fury_of_the_storm(10), maelstrom_weapon(5), ice_strike, elemental_chaos_air
0:33.327 single O frost_shock Fluffy_Pillow 49889.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), hailstorm(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_air
0:34.113 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_air
0:34.902 single Q stormstrike Fluffy_Pillow 48262.4/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_chaos_air
0:35.691 single U lava_lash Fluffy_Pillow 48524.8/50000: 97% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_air
0:36.504 single V lightning_bolt Fluffy_Pillow 49425.6/50000: 99% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:37.317 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon, hailstorm(5), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:38.129 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), elemental_lariat__empowered_earth, elemental_chaos_air
0:38.942 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), elemental_lariat__empowered_earth, elemental_chaos_air
0:39.755 single T stormstrike Fluffy_Pillow 49650.8/50000: 99% mana bloodlust, flurry, elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(6), ice_strike, elemental_lariat__empowered_earth, elemental_chaos_air
0:40.569 single V lightning_bolt Fluffy_Pillow 49953.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(7), ice_strike, elemental_lariat__empowered_earth, elemental_chaos_air
0:41.729 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(8), maelstrom_weapon(2), hailstorm(8), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:42.803 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(8), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:43.877 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(8), maelstrom_of_elements, stormbringer, maelstrom_weapon(8), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:44.954 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:46.115 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(5), maelstrom_weapon(7), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:47.221 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, forceful_winds(5), fury_of_the_storm(10), maelstrom_weapon(7), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_air
0:48.275 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, forceful_winds(5), fury_of_the_storm(10), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_air
0:49.329 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(8), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_air
0:50.385 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(10), hailstorm(5), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:51.428 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(10), hailstorm(5), ice_strike, legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:52.473 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:53.619 single Q stormstrike Fluffy_Pillow 49833.6/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, elemental_chaos_air
0:54.763 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, elemental_chaos_air
0:55.909 single R elemental_blast Fluffy_Pillow 49833.6/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), inspired_by_fire_and_earth, elemental_chaos_air
0:57.055 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon, hailstorm(10), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:58.100 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(2), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
0:59.142 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_air
1:00.184 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(6), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_fire
1:01.364 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(7), maelstrom_weapon, hailstorm(7), inspired_by_fire_and_earth, elemental_chaos_fire
1:02.435 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(7), maelstrom_weapon(3), hailstorm(7), ice_strike, inspired_by_fire_and_earth, elemental_chaos_fire
1:03.507 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(7), maelstrom_weapon(4), inspired_by_fire_and_earth, elemental_chaos_fire
1:04.577 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, elemental_blast_mastery, forceful_winds(5), maelstrom_weapon(5), inspired_by_fire_and_earth, elemental_chaos_fire
1:05.723 single Q stormstrike Fluffy_Pillow 49833.6/50000: 100% mana flurry(3), elemental_blast_haste, elemental_blast_mastery, maelstrom_of_elements, stormbringer, maelstrom_weapon(7), inspired_by_fire_and_earth, elemental_chaos_fire
1:06.868 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_of_elements, stormbringer, maelstrom_weapon(9), inspired_by_fire_and_earth, elemental_chaos_fire
1:08.014 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, maelstrom_of_elements, maelstrom_weapon(9), elemental_chaos_fire
1:09.174 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, fury_of_the_storm(10), stormbringer, hailstorm(10), legacy_of_the_frost_witch, elemental_chaos_fire
1:10.229 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds, fury_of_the_storm(10), stormbringer, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
1:11.284 single U lava_lash Fluffy_Pillow 49688.0/50000: 99% mana flurry, elemental_blast_haste, forceful_winds, fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
1:12.340 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
1:13.501 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(3), elemental_chaos_fire
1:14.661 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(4), ice_strike, elemental_chaos_fire
1:15.822 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_fire
1:16.995 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(6), elemental_lariat__empowered_earth, elemental_chaos_fire
1:18.156 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(3), earthen_weapon(2), fury_of_the_storm(7), hailstorm(7), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_fire
1:19.273 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(7), maelstrom_of_elements, stormbringer, maelstrom_weapon(3), hailstorm(7), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_fire
1:20.389 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(7), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, sophic_devotion, elemental_chaos_fire
1:21.507 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
1:22.687 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(7), hailstorm(7), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
1:23.758 single O frost_shock Fluffy_Pillow 49713.6/50000: 99% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(7), maelstrom_of_elements, stormbringer, maelstrom_weapon(2), hailstorm(7), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
1:24.832 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(7), stormbringer, maelstrom_weapon(6), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
1:25.904 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(8), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
1:27.050 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(8), ice_strike, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_fire
1:28.197 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds, maelstrom_weapon(10), ice_strike, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:29.343 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon, hailstorm(10), ice_strike, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:30.385 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:31.426 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_haste, forceful_winds(2), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon(3), legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:32.467 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_of_elements, maelstrom_weapon(3), legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:33.649 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(2), maelstrom_of_elements, maelstrom_weapon(4), doom_winds_talent, inspired_by_fire_and_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:34.869 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), forceful_winds(3), maelstrom_weapon(6), doom_winds_talent, inspired_by_fire_and_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_fire
1:36.050 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(3), fury_of_the_storm(6), hailstorm(6), doom_winds_talent, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:37.131 single L ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), fury_of_the_storm(6), maelstrom_of_elements, maelstrom_weapon, hailstorm(6), doom_winds_talent, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:38.214 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), fury_of_the_storm(6), stormbringer, maelstrom_weapon(5), hailstorm(6), doom_winds_talent, ice_strike, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:39.296 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(8), hailstorm(6), doom_winds_talent, ice_strike, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:40.441 single O frost_shock Fluffy_Pillow 49832.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), hailstorm(6), doom_winds_talent, ice_strike, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:41.587 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(10), sophic_devotion_oh, elemental_chaos_fire
1:42.747 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), hailstorm(10), legacy_of_the_frost_witch, elemental_chaos_fire
1:43.803 single J windstrike Fluffy_Pillow 49689.6/50000: 99% mana ascendance, flurry(3), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(4), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:44.845 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(6), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:45.886 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(5), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:46.960 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(3), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:48.035 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(9), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:49.109 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(8), hailstorm(10), legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:50.183 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(9), hailstorm(10), ice_strike, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:51.256 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(4), fury_of_the_storm(10), stormbringer, maelstrom_weapon(9), hailstorm(10), ice_strike, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:52.328 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(4), stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:53.510 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:54.692 single Q stormstrike Fluffy_Pillow 49891.2/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:55.871 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), sophic_devotion_oh, elemental_chaos_fire
1:57.067 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(2), hailstorm(10), legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:58.142 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_fire
1:59.215 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon(5), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_fire
2:00.287 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), fury_of_the_storm(10), hailstorm(6), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_frost
2:01.960 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), fury_of_the_storm(10), hailstorm(6), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_frost
2:03.002 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(5), hailstorm(6), ice_strike, legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_frost
2:04.044 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(2), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_frost
2:05.190 single Q stormstrike Fluffy_Pillow 49833.6/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, forceful_winds(2), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(9), inspired_by_fire_and_earth, elemental_chaos_frost
2:06.336 single Q stormstrike Fluffy_Pillow 49667.2/50000: 99% mana flurry, elemental_blast_haste, forceful_winds(3), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, elemental_chaos_frost
2:07.480 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(4), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, elemental_chaos_frost
2:08.625 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(10), elemental_chaos_frost
2:09.787 single R elemental_blast Fluffy_Pillow 49859.2/50000: 100% mana flurry(2), forceful_winds(5), maelstrom_of_elements, maelstrom_weapon(10), elemental_chaos_frost
2:10.982 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), fury_of_the_storm(10), stormbringer, maelstrom_weapon, hailstorm(10), legacy_of_the_frost_witch, elemental_chaos_frost
2:12.038 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), fury_of_the_storm(10), stormbringer, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_frost
2:13.093 single N ice_strike Fluffy_Pillow 49688.0/50000: 99% mana flurry(2), elemental_blast_haste, forceful_winds(5), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_frost
2:14.147 single Q stormstrike Fluffy_Pillow 49724.4/50000: 99% mana flurry, elemental_blast_haste, forceful_winds(5), stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_frost
2:15.306 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, maelstrom_of_elements, maelstrom_weapon(10), static_accumulation, ice_strike, elemental_chaos_frost
2:16.466 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), static_accumulation, ice_strike, sophic_devotion_oh, elemental_chaos_frost
2:17.627 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), fury_of_the_storm(5), maelstrom_weapon(9), hailstorm(5), static_accumulation, ice_strike, sophic_devotion_oh, elemental_chaos_frost
2:18.733 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_haste, feral_spirit, forceful_winds, earthen_weapon(2), fury_of_the_storm(5), maelstrom_weapon(10), static_accumulation, sophic_devotion_oh, elemental_chaos_frost
2:19.839 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(8), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_frost
2:20.925 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds, earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(6), hailstorm(10), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, sophic_devotion_oh, elemental_chaos_frost
2:22.011 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(7), hailstorm(10), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, sophic_devotion_oh, elemental_chaos_frost
2:23.096 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(9), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, sophic_devotion_oh, elemental_chaos_frost
2:24.182 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), elemental_lariat__empowered_earth, sophic_devotion_oh, elemental_chaos_frost
2:25.378 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_lariat__empowered_earth, sophic_devotion_oh, elemental_chaos_frost
2:26.573 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(4), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), ice_strike, elemental_lariat__empowered_earth, sophic_devotion_oh, elemental_chaos_frost
2:27.767 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), stormbringer, maelstrom_weapon(10), ice_strike, elemental_lariat__empowered_earth, sophic_devotion_oh, elemental_chaos_frost
2:28.965 single Q stormstrike Fluffy_Pillow 48916.8/50000: 98% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), ice_strike, elemental_lariat__empowered_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:30.160 default F feral_spirit Fluffy_Pillow 46828.8/50000: 94% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), ice_strike, elemental_lariat__empowered_earth, sophic_devotion, sophic_devotion_oh, elemental_chaos_frost
2:31.357 single Q stormstrike Fluffy_Pillow 48744.0/50000: 97% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), ice_strike, elemental_lariat__empowered_earth, sophic_devotion, elemental_chaos_frost
2:32.552 single Q stormstrike Fluffy_Pillow 49656.0/50000: 99% mana flurry(2), feral_spirit, earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_frost
2:33.747 single Q stormstrike Fluffy_Pillow 49568.0/50000: 99% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_frost
2:34.943 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), ice_strike, sophic_devotion, elemental_chaos_frost
2:36.139 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon, hailstorm(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:37.226 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), hailstorm(10), ice_strike, legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:38.312 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:39.400 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon, hailstorm(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:40.488 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(2), hailstorm(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:41.573 single O frost_shock Fluffy_Pillow 49736.0/50000: 99% mana elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(3), hailstorm(5), legacy_of_the_frost_witch, sophic_devotion, elemental_chaos_frost
2:42.658 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(3), earthen_weapon(2), stormbringer, maelstrom_weapon(7), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, sophic_devotion, elemental_chaos_frost
2:43.853 single P lava_lash Fluffy_Pillow 49912.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, elemental_blast_mastery, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(8), elemental_lariat__empowered_earth, sophic_devotion, elemental_chaos_frost
2:45.048 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(9), elemental_lariat__empowered_earth, elemental_chaos_frost
2:46.242 single S lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), maelstrom_of_elements, maelstrom_weapon(10), elemental_lariat__empowered_earth, elemental_chaos_frost
2:47.438 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(5), fury_of_the_storm(10), hailstorm(10), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_frost
2:48.525 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, fury_of_the_storm(10), stormbringer, maelstrom_weapon(2), hailstorm(10), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_frost
2:49.611 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_frost
2:50.697 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry, maelstrom_of_elements, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_frost
2:51.893 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, fury_of_the_storm(6), hailstorm(6), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_frost
2:53.020 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, fury_of_the_storm(6), maelstrom_of_elements, stormbringer, maelstrom_weapon(2), hailstorm(6), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_frost
2:54.148 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, fury_of_the_storm(6), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_frost
2:55.260 single Q stormstrike Fluffy_Pillow 49779.2/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_frost
2:56.441 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_critical_strike, forceful_winds(3), maelstrom_of_elements, stormbringer, maelstrom_weapon(9), static_accumulation, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_frost
2:57.621 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), static_accumulation, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_frost
2:58.802 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), fury_of_the_storm(5), maelstrom_weapon(8), hailstorm(5), static_accumulation, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_frost
2:59.926 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(3), earthen_weapon(2), fury_of_the_storm(5), maelstrom_weapon(10), hailstorm(5), static_accumulation, ice_strike, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_frost
3:01.050 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(8), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:02.124 default E berserking Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(6), hailstorm(10), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:02.124 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(6), hailstorm(10), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:03.099 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(9), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:04.074 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(9), doom_winds_talent, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:05.048 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(10), doom_winds_talent, inspired_by_fire_and_earth, elemental_chaos_fire
3:06.022 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), static_accumulation, doom_winds_talent, inspired_by_fire_and_earth, elemental_chaos_fire
3:07.096 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, earthen_weapon(2), fury_of_the_storm(5), stormbringer, maelstrom_weapon(10), hailstorm(5), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_fire
3:08.132 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(7), hailstorm(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_fire
3:09.119 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_fire
3:10.107 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(8), hailstorm(5), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_fire
3:11.095 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(4), fury_of_the_storm(10), maelstrom_weapon(10), hailstorm(5), doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_fire
3:12.082 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon(10), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
3:13.070 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(8), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
3:14.060 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana berserking, ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(5), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
3:15.050 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(6), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
3:16.134 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(7), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
3:17.220 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(8), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_chaos_fire
3:18.306 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(10), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:19.393 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(8), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:20.478 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(6), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_fire
3:21.566 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(7), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_fire
3:22.652 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds, earthen_weapon(4), fury_of_the_storm(10), stormbringer, maelstrom_weapon(10), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_fire
3:23.738 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), feral_spirit, forceful_winds(2), earthen_weapon(4), fury_of_the_storm(10), stormbringer, maelstrom_weapon(9), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_fire
3:24.824 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(4), fury_of_the_storm(10), maelstrom_weapon(10), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_fire
3:25.911 single M flame_shock Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(9), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:26.984 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(10), hailstorm(10), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:28.058 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry, feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(6), hailstorm(10), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:29.131 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(6), hailstorm(10), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:30.204 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(7), hailstorm(10), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:31.278 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(10), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:32.352 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:33.534 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), hailstorm(10), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:34.607 single O frost_shock Fluffy_Pillow 49716.8/50000: 99% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, maelstrom_weapon, hailstorm(10), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:35.682 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:36.755 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_fire
3:37.934 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(4), elemental_chaos_fire
3:39.130 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), elemental_chaos_fire
3:40.327 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(5), hailstorm(5), legacy_of_the_frost_witch, elemental_chaos_fire
3:41.433 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(5), maelstrom_weapon, hailstorm(5), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:42.539 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(5), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_fire
3:43.644 single V lightning_bolt Fluffy_Pillow 49768.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
3:44.804 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(6), maelstrom_weapon, hailstorm(6), elemental_chaos_fire
3:45.900 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(6), maelstrom_weapon, hailstorm(6), elemental_chaos_fire
3:46.995 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, earthen_weapon(2), fury_of_the_storm(6), maelstrom_weapon(2), elemental_chaos_fire
3:48.091 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, earthen_weapon(2), maelstrom_weapon(6), elemental_chaos_fire
3:49.251 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), fury_of_the_storm(6), maelstrom_weapon, hailstorm(6), legacy_of_the_frost_witch, elemental_chaos_fire
3:50.378 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), fury_of_the_storm(6), maelstrom_of_elements, maelstrom_weapon, hailstorm(6), legacy_of_the_frost_witch, elemental_chaos_fire
3:51.507 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, fury_of_the_storm(6), stormbringer, maelstrom_weapon(5), legacy_of_the_frost_witch, elemental_chaos_fire
3:52.636 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, forceful_winds, stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:53.831 single V lightning_bolt Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds, maelstrom_of_elements, maelstrom_weapon(8), ice_strike, elemental_chaos_fire
3:55.027 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_critical_strike, forceful_winds, fury_of_the_storm(9), hailstorm(9), ice_strike, legacy_of_the_frost_witch, elemental_chaos_fire
3:56.125 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, forceful_winds, fury_of_the_storm(9), maelstrom_weapon, legacy_of_the_frost_witch, elemental_chaos_fire
3:57.221 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_critical_strike, forceful_winds(2), fury_of_the_storm(9), maelstrom_of_elements, maelstrom_weapon(2), legacy_of_the_frost_witch, elemental_chaos_fire
3:58.319 single Y flame_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, forceful_winds(2), maelstrom_weapon(4), legacy_of_the_frost_witch, elemental_chaos_fire
3:59.514 single W frost_shock Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(4), elemental_chaos_fire
4:00.732 default D use_items Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(5), elemental_chaos_earth
4:02.486 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana forceful_winds(2), maelstrom_weapon(5), elemental_chaos_earth
4:03.682 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana elemental_blast_mastery, forceful_winds(2), fury_of_the_storm(5), hailstorm(5), inspired_by_fire_and_earth, elemental_chaos_earth
4:04.805 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_mastery, forceful_winds(3), fury_of_the_storm(5), maelstrom_weapon(2), hailstorm(5), ice_strike, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_earth
4:05.929 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_mastery, fury_of_the_storm(5), maelstrom_weapon(4), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_earth
4:07.054 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_weapon(5), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_earth
4:08.234 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(7), static_accumulation, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, elemental_chaos_earth
4:09.415 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), fury_of_the_storm(5), maelstrom_weapon(7), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:10.540 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_mastery, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(5), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:11.613 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(3), elemental_blast_mastery, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:12.687 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(4), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:13.759 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(2), hailstorm(10), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:14.832 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(3), legacy_of_the_frost_witch, elemental_lariat__empowered_earth, sophic_devotion_oh, elemental_chaos_earth
4:15.917 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, earthen_weapon(2), fury_of_the_storm(10), stormbringer, maelstrom_weapon(5), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:17.004 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(7), ice_strike, legacy_of_the_frost_witch, sophic_devotion_oh, elemental_chaos_earth
4:18.198 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), stormbringer, maelstrom_weapon(9), ice_strike, sophic_devotion_oh, elemental_chaos_earth
4:19.392 single Q stormstrike Fluffy_Pillow 49910.4/50000: 100% mana feral_spirit, forceful_winds(3), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), ice_strike, sophic_devotion_oh, elemental_chaos_earth
4:20.587 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), ice_strike, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:21.766 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, forceful_winds(5), fury_of_the_storm(10), maelstrom_weapon, hailstorm(10), ice_strike, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:22.969 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(2), hailstorm(10), ice_strike, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:24.011 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(4), legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:25.054 single R elemental_blast Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(8), legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:26.199 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(9), hailstorm(9), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:27.250 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(9), maelstrom_weapon, hailstorm(9), ice_strike, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:28.300 single U lava_lash Fluffy_Pillow 50000.0/50000: 100% mana flurry, elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(9), maelstrom_weapon(3), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:29.350 single T stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_weapon(4), inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:30.495 default B potion Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(8), static_accumulation, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth
4:30.495 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, elemental_blast_haste, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(8), static_accumulation, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:31.640 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(5), stormbringer, maelstrom_weapon(8), hailstorm(5), static_accumulation, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:32.763 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(9), hailstorm(10), static_accumulation, legacy_of_the_frost_witch, inspired_by_fire_and_earth, sophic_devotion_oh, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:33.835 default G doom_winds Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(10), static_accumulation, legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:34.910 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), elemental_blast_critical_strike, feral_spirit, earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(10), static_accumulation, doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:35.996 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(2), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(8), hailstorm(5), doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:37.082 default F feral_spirit Fluffy_Pillow 47737.6/50000: 95% mana flurry(2), forceful_winds(5), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), hailstorm(5), doom_winds_talent, legacy_of_the_frost_witch, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:38.168 single K stormstrike Fluffy_Pillow 49475.2/50000: 99% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), fury_of_the_storm(10), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), hailstorm(5), doom_winds_talent, legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:39.243 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), hailstorm(5), doom_winds_talent, legacy_of_the_frost_witch, inspired_by_fire_and_earth, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:40.422 single K stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), hailstorm(5), doom_winds_talent, inspired_by_fire_and_earth, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:41.604 single L ice_strike Fluffy_Pillow 49891.2/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), hailstorm(5), doom_winds_talent, inspired_by_fire_and_earth, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:42.785 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry, feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), hailstorm(5), ice_strike, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:43.966 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:45.147 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(3), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:46.326 single P lava_lash Fluffy_Pillow 50000.0/50000: 100% mana feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:47.507 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:48.687 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:49.868 single Q stormstrike Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(5), earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:51.048 single Q stormstrike Fluffy_Pillow 49888.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds, earthen_weapon(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:52.227 single Q stormstrike Fluffy_Pillow 48774.4/50000: 98% mana flurry(2), forceful_winds(2), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:53.409 single J windstrike Fluffy_Pillow 48665.6/50000: 97% mana ascendance, flurry(2), forceful_winds(3), maelstrom_of_elements, stormbringer, maelstrom_weapon(10), static_accumulation, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:54.588 single N ice_strike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(3), fury_of_the_storm(5), maelstrom_weapon(7), hailstorm(5), static_accumulation, elemental_lariat__empowered_earth, inspired_by_fire_and_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:55.711 default F feral_spirit Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), forceful_winds(3), fury_of_the_storm(5), stormbringer, maelstrom_weapon(10), hailstorm(5), static_accumulation, ice_strike, elemental_lariat__empowered_earth, sophic_devotion, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:56.848 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, flurry(2), feral_spirit, forceful_winds(3), earthen_weapon(2), fury_of_the_storm(5), stormbringer, maelstrom_weapon(10), hailstorm(5), static_accumulation, ice_strike, elemental_lariat__empowered_earth, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:57.986 single J windstrike Fluffy_Pillow 50000.0/50000: 100% mana ascendance, feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(9), hailstorm(10), static_accumulation, ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_earth, elemental_potion_of_ultimate_power
4:59.073 single O frost_shock Fluffy_Pillow 50000.0/50000: 100% mana flurry(2), feral_spirit, forceful_winds(4), earthen_weapon(2), fury_of_the_storm(10), maelstrom_weapon(8), hailstorm(10), ice_strike, legacy_of_the_frost_witch, elemental_lariat__empowered_earth, elemental_chaos_earth, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 898 1 985 899 0
Agility 2089 2 8087 7918 5450 (4550)
Stamina 3463 0 17495 16662 13199
Intellect 2089 -3 2280 2086 0
Spirit 0 0 0 0 0
Health 349900 333240 0
Mana 50000 50000 0
Spell Power 10377 9712 0
Crit 22.19% 18.57% 1543
Haste 25.92% 25.92% 4406
Versatility 9.16% 6.16% 1263
Mana Regen 1600 1600 0
Attack Power 8491 7918 0
Mastery 56.63% 56.63% 3657
Armor 4851 4851 4851
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 422.00
Local Head Faceguard of Infused Earth
ilevel: 424, stats: { 630 Armor, +1383 Sta, +547 Haste, +239 Mastery, +512 AgiInt }, gems: { +75 StrAgiInt, +66 Haste }
Local Neck Elemental Lariat
ilevel: 418, stats: { +722 Sta, +592 Mastery, +592 Haste }, gems: { +70 Haste, +33 Mastery, +70 Haste, +33 Mastery, +70 Haste, +33 Mastery }
item effects: { equip: Elemental Lariat }
Local Shoulders Calderas of Infused Earth
ilevel: 424, stats: { 578 Armor, +1037 Sta, +181 Vers, +408 Mastery, +384 AgiInt }
Local Chest Robe of Infused Earth
ilevel: 421, stats: { 824 Armor, +1333 Sta, +268 Crit, +506 Mastery, +498 AgiInt }, enchant: { +150 StrAgiInt }
Local Waist Morningscale Waistguard
ilevel: 421, stats: { 464 Armor, +1000 Sta, +308 Haste, +262 Mastery, +374 AgiInt }, gems: { +70 Haste, +33 Mastery }
Local Legs Tassets of the Tarasek Legion
ilevel: 424, stats: { 735 Armor, +1383 Sta, +530 Haste, +256 Mastery, +512 AgiInt }, enchant: { +141 BonusArmor, +177 StrAgi }
Local Feet Daring Chasm-Leapers
ilevel: 421, stats: { 515 Armor, +1000 Sta, +407 Haste, +173 Vers, +374 AgiInt }
Local Wrists Shikaar Ranger Bracers
ilevel: 421, stats: { 412 Armor, +750 Sta, +162 Haste, +274 Mastery, +280 AgiInt }, gems: { +70 Haste, +33 Mastery }
Local Hands Gauntlets of Infused Earth
ilevel: 424, stats: { 473 Armor, +1037 Sta, +421 Crit, +168 Mastery, +384 AgiInt }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 421, stats: { +750 Sta, +553 Crit, +657 Haste }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Haste }
item effects: { equip: Signet of Melandrus }
Local Finger2 Seal of Diurna's Chosen
ilevel: 421, stats: { +750 Sta, +301 Crit, +909 Vers }, gems: { +70 Haste, +33 Mastery }, enchant: { +82 Haste }
item effects: { equip: Broodkeeper's Blaze }
Local Trinket1 Manic Grieftorch
ilevel: 424, stats: { +487 StrAgi }
item effects: { use: Manic Grieftorch, equip: Manic Grieftorch }
Local Trinket2 Whispering Incarnate Icon
ilevel: 421, stats: { +473 StrAgiInt }
item effects: { equip: Whispering Incarnate Icon }
Local Back Vibrant Wildercloth Shawl
ilevel: 418, stats: { 220 Armor, +722 Sta, +215 Mastery, +215 Haste, +272 StrAgiInt }, enchant: sophic_devotion_3
Local Main Hand Fist of the Grand Summoner
ilevel: 421, weapon: { 607 - 866, 2.6 }, stats: { +249 Agi, +666 Sta, +134 Haste, +253 Mastery }, enchant: sophic_devotion_3
Local Off Hand Fist of the Grand Summoner
ilevel: 421, weapon: { 607 - 866, 2.6 }, stats: { +249 Agi, +666 Sta, +134 Haste, +253 Mastery }, enchant: sophic_devotion_3

Talents

Talent Tables

RowShaman Talents [31]
1
2
3
4
5
6
7
8
9
10
RowEnhancement Talents [30]
1
2
3
4
5
6
7
8
9
10

Profile

shaman="T29_Shaman_Enhancement_Phys"
source=default
spec=enhancement
level=70
race=troll
role=attack
position=back
talents=BcQAAAAAAAAAAAAAAAAAAAAAAIJJpAJRSSiAJJSAAAAAAAAAAAAAAtIEhEtUEgUSSSBQJRSgC

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=phial_of_elemental_chaos_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/windfury_weapon
actions.precombat+=/flametongue_weapon
actions.precombat+=/lightning_shield
actions.precombat+=/windfury_totem
actions.precombat+=/variable,name=trinket1_is_weird,value=trinket.1.is.the_first_sigil|trinket.1.is.scars_of_fraternal_strife|trinket.1.is.cache_of_acquired_treasures
actions.precombat+=/variable,name=trinket2_is_weird,value=trinket.2.is.the_first_sigil|trinket.2.is.scars_of_fraternal_strife|trinket.2.is.cache_of_acquired_treasures
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats

# Executed every time the actor is available.
actions=bloodlust,line_cd=600
actions+=/potion,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/auto_attack
actions+=/use_item,name=the_first_sigil,if=(talent.ascendance.enabled&raid_event.adds.in>=90&cooldown.ascendance.remains<10)|(talent.hot_hand.enabled&buff.molten_weapon.up)|buff.icy_edge.up|(talent.stormflurry.enabled&buff.crackling_surge.up)|active_enemies>1|fight_remains<30
actions+=/use_item,name=cache_of_acquired_treasures,if=buff.acquired_sword.up|fight_remains<25
actions+=/use_item,name=scars_of_fraternal_strife,if=!buff.scars_of_fraternal_strife_4.up|fight_remains<31|raid_event.adds.in<16|active_enemies>1
actions+=/use_items,slots=trinket1,if=!variable.trinket1_is_weird
actions+=/use_items,slots=trinket2,if=!variable.trinket2_is_weird
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/fireblood,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/ancestral_call,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/feral_spirit
actions+=/ascendance,if=(ti_lightning_bolt&active_enemies=1&raid_event.adds.in>=90)|(ti_chain_lightning&active_enemies>1)
actions+=/doom_winds,if=raid_event.adds.in>=90|active_enemies>1
# If_only_one_enemy,_priority_follows_the_'single'_action_list.
actions+=/call_action_list,name=single,if=active_enemies=1
# On_multiple_enemies,_the_priority_follows_the_'aoe'_action_list.
actions+=/call_action_list,name=aoe,if=active_enemies>1

actions.aoe=crash_lightning,if=buff.doom_winds_talent.up|!buff.crash_lightning.up
actions.aoe+=/lightning_bolt,if=(active_dot.flame_shock=active_enemies|active_dot.flame_shock=6)&buff.primordial_wave.up&buff.maelstrom_weapon.stack>=(5+5*talent.overflowing_maelstrom.enabled)&(!buff.splintered_elements.up|fight_remains<=12|raid_event.adds.remains<=gcd)
actions.aoe+=/sundering,if=buff.doom_winds_talent.up
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=6|(active_dot.flame_shock>=4&active_dot.flame_shock=active_enemies)
actions.aoe+=/primordial_wave,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=!buff.primordial_wave.up
actions.aoe+=/windstrike,if=talent.thorims_invocation.enabled&ti_chain_lightning&buff.maelstrom_weapon.stack>1
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=dot.flame_shock.ticking&(active_dot.flame_shock<active_enemies&active_dot.flame_shock<6)
actions.aoe+=/flame_shock,if=!ticking
actions.aoe+=/flame_shock,target_if=min:dot.flame_shock.remains,cycle_targets=1,if=talent.fire_nova.enabled&active_dot.flame_shock<active_enemies&active_dot.flame_shock<6
actions.aoe+=/ice_strike,if=talent.hailstorm.enabled
actions.aoe+=/frost_shock,if=talent.hailstorm.enabled&buff.hailstorm.up
actions.aoe+=/sundering
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=4
actions.aoe+=/lava_lash,target_if=min:debuff.lashing_flames.remains,cycle_targets=1,if=talent.lashing_flames.enabled
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=3
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack=10&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack=10
actions.aoe+=/crash_lightning,if=buff.cl_crash_lightning.up
actions.aoe+=/lava_lash,if=buff.crash_lightning.up&buff.ashen_catalyst.stack=8
actions.aoe+=/windstrike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up&buff.converging_storms.stack=6
actions.aoe+=/lava_lash,if=buff.crash_lightning.up
actions.aoe+=/ice_strike,if=buff.crash_lightning.up
actions.aoe+=/stormstrike,if=buff.crash_lightning.up
actions.aoe+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5&(!talent.crashing_storms.enabled|active_enemies<=3)
actions.aoe+=/fire_nova,if=active_dot.flame_shock>=2
actions.aoe+=/crash_lightning
actions.aoe+=/windstrike
actions.aoe+=/lava_lash
actions.aoe+=/ice_strike
actions.aoe+=/stormstrike
actions.aoe+=/flame_shock,target_if=refreshable,cycle_targets=1
actions.aoe+=/frost_shock
actions.aoe+=/chain_lightning,if=buff.maelstrom_weapon.stack>=5
actions.aoe+=/earth_elemental
actions.aoe+=/windfury_totem,if=buff.windfury_totem.remains<30

actions.single=windstrike
actions.single+=/lava_lash,if=buff.hot_hand.up|buff.ashen_catalyst.stack=8
actions.single+=/windfury_totem,if=!buff.windfury_totem.up
actions.single+=/stormstrike,if=buff.doom_winds_talent.up
actions.single+=/crash_lightning,if=buff.doom_winds_talent.up
actions.single+=/ice_strike,if=buff.doom_winds_talent.up
actions.single+=/sundering,if=buff.doom_winds_talent.up
actions.single+=/primordial_wave,if=buff.primordial_wave.down&(raid_event.adds.in>42|raid_event.adds.in<6)
actions.single+=/flame_shock,if=!ticking
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.up&raid_event.adds.in>buff.primordial_wave.remains&(!buff.splintered_elements.up|fight_remains<=12)
actions.single+=/ice_strike,if=talent.hailstorm.enabled
actions.single+=/frost_shock,if=buff.hailstorm.up
actions.single+=/lava_lash,if=dot.flame_shock.refreshable
actions.single+=/stormstrike,if=talent.stormflurry.enabled&buff.stormbringer.up
actions.single+=/elemental_blast,if=(!talent.elemental_spirits.enabled|(talent.elemental_spirits.enabled&(charges=max_charges|buff.feral_spirit.up)))&buff.maelstrom_weapon.stack>=5
actions.single+=/lava_burst,if=buff.maelstrom_weapon.stack>=5
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack=10&buff.primordial_wave.down
actions.single+=/stormstrike
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<10
actions.single+=/ice_strike
actions.single+=/lava_lash
actions.single+=/bag_of_tricks
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.stack>=5&buff.primordial_wave.down
actions.single+=/sundering,if=raid_event.adds.in>=40
actions.single+=/fire_nova,if=talent.swirling_maelstrom.enabled&active_dot.flame_shock
actions.single+=/frost_shock
actions.single+=/crash_lightning
actions.single+=/fire_nova,if=active_dot.flame_shock
actions.single+=/earth_elemental
actions.single+=/flame_shock
actions.single+=/windfury_totem,if=buff.windfury_totem.remains<30

head=faceguard_of_infused_earth,id=200399,bonus_id=4800/4786/1498/6935,gem_id=192985
neck=elemental_lariat,id=193001,bonus_id=6652/7936/7979/1540/8767/6935/6935,gem_id=192948/192948/192948,crafted_stats=49/36
shoulders=calderas_of_infused_earth,id=200401,bonus_id=4800/4786/1498
back=vibrant_wildercloth_shawl,id=193511,bonus_id=6652/7936/7979/1540/8767,enchant_id=6643,crafted_stats=49/36
chest=robe_of_infused_earth,id=200396,bonus_id=4800/4786/1498,enchant=waking_stats_3
wrists=shikaar_ranger_bracers,id=193693,bonus_id=6808/4786/1643,gem_id=192948
hands=gauntlets_of_infused_earth,id=200398,bonus_id=4800/4786/1501
waist=morningscale_waistguard,id=109843,bonus_id=4238/4786/6808/3306,gem_id=192948
legs=tassets_of_the_tarasek_legion,id=195522,bonus_id=4800/4786/1498,enchant_id=6496
feet=daring_chasmleapers,id=195495,bonus_id=4800/4786/1498
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1795/6808/4786/3300,gem_id=192948,enchant_id=6556
finger2=seal_of_diurnas_chosen,id=195480,bonus_id=4800/4786/1498,gem_id=192948,enchant_id=6556
trinket1=manic_grieftorch,id=194308,bonus_id=4800/4786/1498
trinket2=whispering_incarnate_icon,id=194301,bonus_id=4800/4786/1498
main_hand=fist_of_the_grand_summoner,id=195512,bonus_id=4800/4786/1498,enchant=sophic_devotion_3
off_hand=fist_of_the_grand_summoner,id=195512,bonus_id=4800/4786/1498,enchant=sophic_devotion_3

# Gear Summary
# gear_ilvl=421.56
# gear_agility=5450
# gear_stamina=13199
# gear_crit_rating=1543
# gear_haste_rating=4406
# gear_mastery_rating=3657
# gear_versatility_rating=1263
# gear_armor=4851
# set_bonus=tier29_2pc=1
# set_bonus=tier29_4pc=1

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 417101253
Max Event Queue: 541
Sim Seconds: 2250297
CPU Seconds: 618.3746
Physical Seconds: 311.5727
Speed Up: 3639

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
T29_Death_Knight_Frost T29_Death_Knight_Frost abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.60sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost abomination_limb_damage 383313 259582 865 7.65 4789 9615 38.2 38.2 41.4% 0.0% 0.0% 0.0% 6.90sec 259582 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost arcane_torrent 50613 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 140.38sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost auto_attack_mh 0 1311430 4371 40.03 5222 10448 200.2 200.2 41.8% 16.3% 0.0% 0.0% 1.75sec 1873519 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost auto_attack_oh 1 638967 2130 39.11 2610 5224 195.6 195.6 41.8% 16.7% 0.0% 0.0% 1.75sec 912834 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost breath_of_sindragosa 152279 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 125.92sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost breath_of_sindragosa_tick 155166 6911304 23038 45.32 21516 42976 226.6 226.6 41.9% 0.0% 0.0% 0.0% 1.25sec 6911304 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost burnout_wave 389710 366712 1222 0.55 93496 186518 2.9 2.8 41.6% 0.0% 0.0% 0.0% 119.96sec 366712 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost death_and_decay 43265 8679 29 2.07 591 1181 1.0 10.4 41.7% 0.0% 0.0% 0.0% 107.09sec 8679 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost empower_rune_weapon 47568 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 86.98sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost frost_fever ticks -55095 1036032 3453 19.74 7405 14782 72.5 98.7 41.9% 0.0% 0.0% 0.0% 4.12sec 1036032 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost frost_strike 49143 326851 1090 3.43 13450 26892 17.2 17.2 41.7% 0.0% 0.0% 0.0% 6.83sec 326851 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost frost_strike_offhand 66196 163374 545 3.43 6726 13442 17.2 17.2 41.7% 0.0% 0.0% 0.0% 6.83sec 163374 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost horn_of_winter 57330 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 59.23sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost howling_blast 49184 3908756 13029 14.50 38032 76036 72.5 72.5 41.8% 0.0% 0.0% 0.0% 4.12sec 3908756 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost avalanche 207150 818299 2728 14.46 7988 15953 72.3 72.3 41.8% 0.0% 0.0% 0.0% 4.13sec 818299 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost obliterate 49020 634147 2114 9.60 9317 18640 48.0 48.0 41.7% 0.0% 0.0% 0.0% 6.14sec 787780 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost obliterate_offhand 66198 317408 1058 9.60 4656 9326 48.0 48.0 41.8% 0.0% 0.0% 0.0% 6.14sec 394305 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost obliterate_km 222024 3656474 12188 13.88 0 52704 69.4 69.4 100.0% 0.0% 0.0% 0.0% 4.28sec 3179543 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost obliterate_offhand_km 66198 1828237 6094 13.88 0 26352 69.4 69.4 100.0% 0.0% 0.0% 0.0% 4.28sec 1589771 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost pillar_of_frost 51271 0 0 0.00 0 0 8.9 0.0 0.0% 0.0% 0.0% 0.0% 35.14sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 305.80sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.73sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost remorseless_winter 196770 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 20.57sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost remorseless_winter_damage 196771 3206885 10690 51.71 8747 17493 258.6 258.6 41.8% 0.0% 0.0% 0.0% 1.16sec 3206885 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost strike_twice 384177 111490 372 4.25 3699 7398 21.2 21.2 41.9% 0.0% 0.0% 0.0% 13.74sec 159276 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost strike_twice_oh 384177 111451 372 4.25 3699 7398 21.2 21.2 42.0% 0.0% 0.0% 0.0% 13.76sec 159220 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost unholy_strength 53365 0 0 0.00 0 0 21.3 0.0 0.0% 0.0% 0.0% 0.0% 13.72sec 0 300.00sec
T29_Death_Knight_Frost T29_Death_Knight_Frost_ghoul claw 91776 159396 973 19.73 2086 4175 53.8 53.8 41.9% 0.0% 0.0% 0.0% 5.21sec 227715 163.78sec
T29_Death_Knight_Frost T29_Death_Knight_Frost_ghoul gnaw 91800 301 2 1.07 73 146 2.9 2.9 41.0% 0.0% 0.0% 0.0% 120.72sec 430 163.78sec
T29_Death_Knight_Frost T29_Death_Knight_Frost_ghoul main_hand 0 330212 2016 36.45 2338 4678 99.5 99.5 41.9% 0.0% 0.0% 0.0% 2.78sec 471744 163.78sec
T29_Death_Knight_Frost T29_Death_Knight_Frost_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.73sec 0 163.78sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 122.44sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h abomination_limb_damage 383313 271755 906 7.62 5381 11053 38.1 38.1 30.9% 0.0% 0.0% 0.0% 6.99sec 271755 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h auto_attack_mh 0 1692089 5640 32.31 7899 16140 161.6 161.6 31.2% 0.0% 0.0% 0.0% 2.24sec 2417332 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h burnout_wave 389710 343673 1146 0.54 95074 194060 2.9 2.7 31.6% 0.0% 0.0% 0.0% 123.52sec 343673 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h chains_of_ice 45524 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 34.52sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h cold_heart 281210 847396 2825 1.65 77645 157933 8.3 8.3 31.0% 0.0% 0.0% 0.0% 34.53sec 847396 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h empower_rune_weapon 47568 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 81.73sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h frost_fever ticks -55095 1084765 3616 19.79 8281 16854 34.9 99.0 31.3% 0.0% 0.0% 0.0% 8.58sec 1084765 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h frost_strike 49143 4374033 14580 21.60 30583 62263 108.0 108.0 31.3% 0.0% 0.0% 0.0% 2.76sec 4374033 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h frostwhelps_aid 377245 84369 281 1.94 6613 13455 9.7 9.7 30.7% 0.0% 0.0% 0.0% 32.19sec 84369 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h howling_blast 49184 1514046 5047 6.99 32728 66730 34.9 34.9 31.2% 0.0% 0.0% 0.0% 8.58sec 1514046 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h avalanche 207150 396030 1320 6.91 8655 17653 34.5 34.5 31.2% 0.0% 0.0% 0.0% 8.68sec 396030 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h inexorable_assault 253597 489065 1630 8.42 8769 17879 42.1 42.1 31.2% 0.0% 0.0% 0.0% 7.16sec 489065 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h obliterate 49020 722057 2407 5.21 20914 42765 26.1 26.1 31.1% 0.0% 0.0% 0.0% 11.25sec 896989 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h obliterate_km 325461 13618910 45396 18.59 0 146556 92.9 92.9 100.0% 0.0% 0.0% 0.0% 3.19sec 11842530 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h pillar_of_frost 51271 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 32.19sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.24sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.89sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h unholy_strength 53365 0 0 0.00 0 0 22.9 0.0 0.0% 0.0% 0.0% 0.0% 12.76sec 0 300.00sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h_ghoul claw 91776 179316 1096 21.44 2290 4768 58.5 58.5 31.3% 0.0% 0.0% 0.0% 4.80sec 256172 163.66sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h_ghoul gnaw 91800 310 2 1.07 79 165 2.9 2.9 31.4% 0.0% 0.0% 0.0% 120.89sec 443 163.66sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h_ghoul main_hand 0 371880 2272 39.74 2561 5335 108.4 108.4 31.3% 0.0% 0.0% 0.0% 2.56sec 531271 163.66sec
T29_Death_Knight_Frost_2h T29_Death_Knight_Frost_2h_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.89sec 0 163.66sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW abomination_limb 383269 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.16sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW abomination_limb_damage 383313 261483 872 7.57 5266 10793 37.8 37.8 29.7% 0.0% 0.0% 0.0% 7.01sec 261483 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW auto_attack_mh 0 1390817 4636 43.48 5572 11379 217.4 217.4 29.9% 16.4% 0.0% 0.0% 1.61sec 1986933 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW auto_attack_oh 1 677591 2259 42.51 2786 5690 212.5 212.5 29.9% 16.7% 0.0% 0.0% 1.61sec 968012 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW burnout_wave 389710 341755 1139 0.55 94158 192263 3.0 2.8 29.6% 0.0% 0.0% 0.0% 120.55sec 341755 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW chains_of_ice 45524 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 35.46sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW cold_heart 281210 868864 2896 1.71 77710 158887 8.5 8.5 29.8% 0.0% 0.0% 0.0% 35.46sec 868864 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW empower_rune_weapon 47568 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 81.24sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW frost_fever ticks -55095 1098326 3661 19.75 8502 17266 25.9 98.7 29.9% 0.0% 0.0% 0.0% 11.64sec 1098326 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW frost_strike 49143 4420145 14734 22.48 30015 61094 112.4 112.4 29.9% 0.0% 0.0% 0.0% 2.65sec 4420145 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW frost_strike_offhand 66196 2210122 7367 22.48 15015 30514 112.4 112.4 30.0% 0.0% 0.0% 0.0% 2.65sec 2210122 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW frostwhelps_aid 377245 96534 322 2.18 6775 13798 10.9 10.9 29.7% 0.0% 0.0% 0.0% 28.43sec 96534 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW frostwyrms_fury 279303 462980 1543 0.39 182070 370379 1.9 1.9 29.9% 0.0% 0.0% 0.0% 213.05sec 462980 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW frostwyrms_fury_driver 279302 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 213.05sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW howling_blast 49184 866932 2890 5.17 25605 52159 25.9 25.9 29.9% 0.0% 0.0% 0.0% 11.64sec 866932 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW avalanche 207150 273445 911 5.08 8215 16745 25.4 25.4 29.9% 0.0% 0.0% 0.0% 11.85sec 273445 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW inexorable_assault 253597 478244 1594 8.42 8666 17624 42.1 42.1 30.1% 0.0% 0.0% 0.0% 7.16sec 478244 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW obliterate 49020 209459 698 3.14 10210 20865 15.7 15.7 29.5% 0.0% 0.0% 0.0% 18.34sec 260204 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW obliterate_offhand 66198 104968 350 3.14 5103 10441 15.7 15.7 29.8% 0.0% 0.0% 0.0% 18.34sec 130398 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW obliterate_km 222024 7882723 26276 21.33 0 73912 106.6 106.6 100.0% 0.0% 0.0% 0.0% 2.79sec 6854542 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW obliterate_offhand_km 66198 3941361 13138 21.33 0 36956 106.6 106.6 100.0% 0.0% 0.0% 0.0% 2.79sec 3427271 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW pillar_of_frost 51271 0 0 0.00 0 0 10.9 0.0 0.0% 0.0% 0.0% 0.0% 28.43sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.43sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW raise_dead 46585 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.53sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW razorice 50401 294590 982 82.35 546 1111 411.7 411.7 30.0% 0.0% 0.0% 0.0% 0.77sec 294590 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW strike_twice 384177 111331 371 4.58 3699 7546 22.9 22.9 30.2% 0.0% 0.0% 0.0% 12.76sec 159048 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW strike_twice_oh 384177 111763 373 4.60 3699 7546 23.0 23.0 30.2% 0.0% 0.0% 0.0% 12.72sec 159665 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW unholy_strength 53365 0 0 0.00 0 0 23.0 0.0 0.0% 0.0% 0.0% 0.0% 12.71sec 0 300.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW_ghoul claw 91776 174567 1064 21.49 2245 4670 58.7 58.7 30.0% 0.0% 0.0% 0.0% 4.78sec 249388 164.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW_ghoul gnaw 91800 304 2 1.07 79 163 2.9 2.9 29.8% 0.0% 0.0% 0.0% 120.53sec 435 164.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW_ghoul main_hand 0 361506 2204 39.89 2504 5212 109.0 109.0 30.0% 0.0% 0.0% 0.0% 2.54sec 516450 164.00sec
T29_Death_Knight_Frost_DW T29_Death_Knight_Frost_DW_ghoul spawn_travel 0 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 120.53sec 0 164.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy apocalypse 275699 116018 387 1.39 13652 27291 7.0 7.0 21.9% 0.0% 0.0% 0.0% 45.72sec 116018 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy army_of_the_dead 42650 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 173.03sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy auto_attack_mh 0 1419646 4732 33.80 6880 13763 169.0 169.0 22.1% 0.0% 0.0% 0.0% 2.14sec 2028118 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.30sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy dark_transformation 63560 97488 325 1.40 11427 22856 7.0 7.0 22.0% 0.0% 0.0% 0.0% 45.81sec 97488 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy death_coil 47541 2405677 8019 21.73 18142 36274 108.7 108.6 22.1% 0.0% 0.0% 0.0% 2.72sec 2405677 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy coil_of_devastation ticks -390271 711030 2370 27.50 5172 0 0.0 137.5 0.0% 0.0% 0.0% 0.0% 0.00sec 711030 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy empower_rune_weapon 47568 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 167.97sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy festering_strike 85948 656588 2189 6.29 17094 34163 31.4 31.4 22.2% 0.0% 0.0% 0.0% 9.32sec 938006 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy festering_wound 194311 1028696 3429 22.69 7426 14850 113.4 113.4 22.1% 0.0% 0.0% 0.0% 3.19sec 1028696 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy manic_grieftorch 382135 930380 3101 4.99 30545 61090 24.9 24.9 22.1% 0.0% 0.0% 0.0% 9.02sec 930380 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy manic_grieftorch_channel 377463 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.59sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy outbreak 77575 41586 139 2.37 2863 5741 11.9 11.9 22.2% 0.0% 0.0% 0.0% 26.31sec 41586 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.24sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy raise_dead 46584 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy scourge_strike 55090 491503 1638 17.16 4689 9381 85.8 85.8 22.1% 0.0% 0.0% 0.0% 3.41sec 702164 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy scourge_strike_shadow 70890 709257 2364 17.16 6770 13548 0.0 85.8 22.0% 0.0% 0.0% 0.0% 0.00sec 709257 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy solved_the_puzzle 383781 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.40sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy soul_reaper 343294 233726 779 3.25 11802 23568 16.2 16.2 22.0% 0.0% 0.0% 0.0% 6.62sec 233726 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy soul_reaper_execute 343295 1074930 3583 3.25 54239 108443 16.2 16.2 22.1% 0.0% 0.0% 0.0% 6.62sec 1074930 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy summon_gargoyle 49206 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.13sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy unholy_assault 207289 85146 284 0.74 18737 37459 3.7 3.7 22.2% 0.0% 0.0% 0.0% 90.70sec 85146 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy unholy_pact 319236 692989 2310 24.62 4610 9216 123.1 123.1 22.2% 0.0% 0.0% 0.0% 2.64sec 692989 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy unholy_strength 53365 0 0 0.00 0 0 24.7 0.0 0.0% 0.0% 0.0% 0.0% 11.92sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy virulent_plague ticks -191587 445642 1485 19.84 3680 7361 11.9 99.2 22.1% 0.0% 0.0% 0.0% 26.31sec 445642 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_ghoul claw 91776 191887 640 8.16 3852 7707 40.8 40.8 22.1% 0.0% 0.0% 0.0% 7.27sec 274131 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_ghoul gnaw 91800 3 0 0.00 122 234 0.0 0.0 19.7% 0.0% 0.0% 0.0% 90.11sec 4 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_ghoul main_hand 0 3259264 10864 47.78 11170 22376 238.9 238.9 22.1% 0.0% 0.0% 0.0% 1.25sec 4656211 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_ghoul monstrous_blow 91797 23639 79 0.73 5321 10622 3.6 3.6 22.1% 0.0% 0.0% 0.0% 91.17sec 33771 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_ghoul spawn_travel 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_ghoul sweeping_claws 91778 927621 3092 15.76 9642 19281 78.8 78.8 22.1% 0.0% 0.0% 0.0% 3.72sec 927621 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_gargoyle gargoyle_strike 51963 2917983 58360 53.56 53536 107110 44.6 44.6 22.1% 0.0% 0.0% 0.0% 4.66sec 2917983 50.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_gargoyle spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.14sec 0 50.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_risen_skulker skulker_shot 212423 647912 2160 35.18 3018 6034 176.0 175.9 22.0% 0.0% 0.0% 0.0% 1.70sec 925612 300.00sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_magus_of_the_dead frostbolt 317792 534141 4315 18.25 11621 23223 37.7 37.7 22.1% 0.0% 0.0% 0.0% 7.80sec 534141 123.78sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_magus_of_the_dead shadow_bolt 317791 1387378 11208 47.96 11488 22967 99.0 98.9 22.1% 0.0% 0.0% 0.0% 2.92sec 1387378 123.78sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul claw 199373 485424 8089 233.23 1705 3411 233.3 233.3 22.0% 0.0% 0.0% 0.0% 0.91sec 693481 60.01sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul main_hand 0 2507328 41780 398.55 5153 10307 398.6 398.6 22.1% 0.0% 0.0% 0.0% 0.53sec 3581988 60.01sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.67sec 0 60.01sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.93sec 0 60.02sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.15sec 0 60.02sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.33sec 0 60.02sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.53sec 0 60.03sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.46sec 0 60.03sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 179.57sec 0 60.04sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_army_ghoul spawn_travel 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 178.67sec 0 60.05sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_apoc_ghoul claw 199373 311490 3064 98.72 1526 3052 167.3 167.3 22.1% 0.0% 0.0% 0.0% 1.68sec 444997 101.66sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_apoc_ghoul main_hand 0 1253878 12334 129.65 4676 9352 219.7 219.7 22.1% 0.0% 0.0% 0.0% 1.27sec 1791300 101.66sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 46.04sec 0 101.66sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 45.93sec 0 101.81sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 46.04sec 0 101.49sec
T29_Death_Knight_Unholy T29_Death_Knight_Unholy_apoc_ghoul spawn_travel 0 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 46.52sec 0 100.49sec
T29_Priest_Shadow T29_Priest_Shadow augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow blood_fury 33702 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.25sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow dark_ascension 391109 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.72sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow desperate_prayer 19236 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow devouring_plague 335467 2350505 7835 10.91 36887 79115 54.6 54.6 14.7% 0.0% 0.0% 0.0% 5.49sec 5700792 300.00sec
T29_Priest_Shadow T29_Priest_Shadow devouring_plague ticks -335467 3350287 11168 26.63 22029 44905 54.6 133.2 13.7% 0.0% 0.0% 0.0% 5.49sec 5700792 300.00sec
T29_Priest_Shadow T29_Priest_Shadow devouring_plague_heal 335467 0 0 0.00 0 0 187.7 0.0 0.0% 0.0% 0.0% 0.0% 1.59sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow halo 120644 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 57.01sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow halo_heal 390971 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 57.01sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow halo_damage 390964 230464 768 1.08 36674 80698 5.5 5.4 13.3% 0.0% 0.0% 0.0% 57.01sec 230464 300.00sec
T29_Priest_Shadow T29_Priest_Shadow idol_of_cthun 377349 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow_void_tendril mind_flay ticks -193473 1505347 5018 36.78 7271 14739 24.5 183.9 12.3% 0.0% 0.0% 0.0% 11.44sec 1505347 29.08sec
T29_Priest_Shadow T29_Priest_Shadow mental_fortitude 377065 255496 852 74.53 686 0 360.3 372.6 0.0% 0.0% 0.0% 0.0% 0.83sec 12396437 300.00sec
T29_Priest_Shadow T29_Priest_Shadow mind_blast 8092 2084893 6950 13.56 26326 58098 67.8 67.8 13.9% 0.0% 0.0% 0.0% 4.43sec 2084893 300.00sec
T29_Priest_Shadow T29_Priest_Shadow mind_flay ticks -15407 304747 1016 9.07 6004 12432 7.6 45.3 11.2% 0.0% 0.0% 0.0% 35.36sec 304747 300.00sec
T29_Priest_Shadow T29_Priest_Shadow mind_flay_insanity ticks -391403 2883030 9610 34.74 14579 29844 43.6 173.7 13.2% 0.0% 0.0% 0.0% 6.77sec 2883030 300.00sec
T29_Priest_Shadow T29_Priest_Shadow mind_spike 73510 467592 1559 2.32 35371 77075 11.6 11.6 11.8% 0.0% 0.0% 0.0% 22.18sec 467592 300.00sec
T29_Priest_Shadow T29_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.65sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow mindgames 375901 674756 2249 1.60 71719 157947 8.0 8.0 14.9% 0.0% 0.0% 0.0% 39.20sec 674756 300.00sec
T29_Priest_Shadow T29_Priest_Shadow mindgames_damage_reversal 323706 0 0 0.00 0 0 8.0 0.0 0.0% 0.0% 0.0% 0.0% 39.20sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow potion 371028 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 308.61sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow power_infusion 10060 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.45sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 32.79sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadow_crash_damage 205386 575274 1918 1.93 50857 110710 9.6 9.6 14.6% 0.0% 0.0% 0.0% 32.59sec 575274 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadow_crash_dots 391286 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 32.79sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadow_weaving 346111 588716 1962 28.53 4126 0 143.7 142.7 0.0% 0.0% 0.0% 0.0% 2.04sec 588716 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadow_word_death 32379 606755 2023 2.64 39985 82905 13.2 13.2 14.0% 0.0% 0.0% 0.0% 23.50sec 606755 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadow_word_death_self_damage ticks -32409 122837 409 2.62 6748 26049 13.2 13.1 13.6% 0.0% 0.0% 0.0% 23.50sec 392015 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadow_word_pain ticks -589 1145156 3817 43.40 4619 9488 9.6 217.0 13.5% 0.0% 0.0% 0.0% 32.59sec 1145156 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadowy_apparitions 341491 0 0 0.00 0 0 122.3 0.0 0.0% 0.0% 0.0% 0.0% 2.44sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow shadowy_apparition 148859 651265 2171 23.70 5497 0 120.4 118.5 0.0% 0.0% 0.0% 0.0% 2.44sec 651265 300.00sec
T29_Priest_Shadow T29_Priest_Shadow soulseeker_arrow ticks -388755 713624 2379 19.85 7190 0 8.0 99.2 0.0% 0.0% 0.0% 0.0% 34.31sec 713624 300.00sec
T29_Priest_Shadow T29_Priest_Shadow vampiric_touch ticks -34914 1732702 5776 36.08 8417 17299 9.6 180.4 13.4% 0.0% 0.0% 0.0% 32.59sec 1732702 300.00sec
T29_Priest_Shadow T29_Priest_Shadow vampiric_touch_heal 34914 0 0 0.00 0 0 180.4 0.0 0.0% 0.0% 0.0% 0.0% 1.65sec 0 300.00sec
T29_Priest_Shadow T29_Priest_Shadow_mindbender inescapable_torment 373427 0 0 0.00 0 0 44.9 0.0 0.0% 0.0% 0.0% 0.0% 6.55sec 0 141.51sec
T29_Priest_Shadow T29_Priest_Shadow_mindbender inescapable_torment_damage 373442 1449530 10243 19.04 27025 56948 44.9 44.9 17.5% 0.0% 0.0% 0.0% 6.55sec 1449530 141.51sec
T29_Priest_Shadow T29_Priest_Shadow_mindbender melee 0 1025616 7248 60.92 6059 12318 143.7 143.7 17.3% 0.0% 0.0% 0.0% 2.04sec 1025616 141.51sec
T29_Shaman_Elemental T29_Shaman_Elemental ascendance_dre 114050 0 0 0.00 0 0 7.9 0.0 0.0% 0.0% 0.0% 0.0% 32.62sec 0 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental lava_burst_dre 51505 521077 1737 1.57 0 66455 7.9 7.8 100.0% 0.0% 0.0% 0.0% 32.62sec 521077 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental lava_burst_overload_dre 285466 434249 1447 1.34 0 64837 6.7 6.7 100.0% 0.0% 0.0% 0.0% 36.75sec 434249 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental elemental_blast 117014 6538397 21795 9.08 104912 267461 45.5 45.4 24.1% 0.0% 0.0% 0.0% 6.46sec 6538397 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental elemental_blast_overload 120588 2641930 8806 7.37 52196 132976 37.0 36.9 24.1% 0.0% 0.0% 0.0% 7.88sec 2641930 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental fire_elemental 198067 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 150.51sec 0 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental flame_shock 188389 110242 367 3.75 4455 11381 18.8 18.8 20.5% 0.0% 0.0% 0.0% 16.24sec 910616 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental flame_shock ticks -188389 800374 2668 45.68 2657 6790 18.8 228.4 20.5% 0.0% 0.0% 0.0% 16.24sec 910616 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental flametongue_attack 10444 4988 17 13.14 58 148 65.7 65.7 20.1% 0.0% 0.0% 0.0% 5.57sec 4988 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental flask 370652 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental frost_shock 196840 719285 2398 2.97 36650 93797 14.8 14.8 20.8% 0.0% 0.0% 0.0% 18.67sec 719285 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental icefury 210714 143501 478 1.45 15116 38454 7.2 7.2 20.3% 0.0% 0.0% 0.0% 42.33sec 143501 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental icefury_overload 219271 116579 389 1.21 14646 37157 6.1 6.1 20.4% 0.0% 0.0% 0.0% 48.67sec 116579 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental lava_burst 51505 6457705 21526 22.34 0 57814 111.9 111.7 100.0% 0.0% 0.0% 0.0% 2.67sec 6457705 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental lava_burst_overload 285466 5323483 17745 19.14 0 55630 95.9 95.7 100.0% 0.0% 0.0% 0.0% 3.11sec 5323483 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental lightning_bolt 188196 197041 657 2.14 13313 34115 10.7 10.7 24.4% 0.0% 0.0% 0.0% 23.84sec 197041 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental lightning_bolt_overload 45284 164655 549 1.79 13331 34133 8.9 8.9 24.4% 0.0% 0.0% 0.0% 28.07sec 164655 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental main_hand 0 60561 202 13.14 763 1557 65.7 65.7 20.0% 0.0% 0.0% 0.0% 5.57sec 86518 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental primordial_wave 375982 128645 429 2.45 8693 17702 12.3 12.2 20.2% 0.0% 0.0% 0.0% 25.39sec 128645 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental lava_burst_pw 51505 486698 1622 2.44 0 39933 12.2 12.2 100.0% 0.0% 0.0% 0.0% 25.42sec 486698 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental lava_burst_overload_pw 285466 391302 1304 2.02 0 38811 10.1 10.1 100.0% 0.0% 0.0% 0.0% 29.83sec 391302 300.00sec
T29_Shaman_Elemental T29_Shaman_Elemental_greater_fire_elemental fire_blast 57984 410574 5783 25.54 11208 23222 30.2 30.2 19.8% 0.0% 0.0% 0.0% 8.37sec 410574 70.99sec
T29_Shaman_Enhancement T29_Shaman_Enhancement augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.37sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement broodkeepers_blaze ticks -394453 462459 1542 8.41 9140 18374 15.6 42.0 20.1% 0.0% 0.0% 0.0% 18.52sec 462459 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 311.02sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement elemental_blast 117014 4621528 15405 4.64 160760 322343 23.2 23.2 23.9% 0.0% 0.0% 0.0% 12.79sec 4621528 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 12.1 0.0 0.0% 0.0% 0.0% 0.0% 25.63sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement flame_shock 188389 1078750 3596 17.19 10420 20951 85.9 85.9 20.2% 0.0% 0.0% 0.0% 3.47sec 2617549 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement flame_shock ticks -188389 1538799 5129 41.35 6177 12422 85.9 206.8 20.3% 0.0% 0.0% 0.0% 3.47sec 2617549 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement flametongue_attack 10444 510384 1701 143.95 589 1183 719.8 719.8 20.3% 0.0% 0.0% 0.0% 0.69sec 510384 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement frost_shock 196840 3114222 10381 8.94 57861 116195 44.7 44.7 20.3% 0.0% 0.0% 0.0% 6.65sec 3114222 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement ice_strike 342240 1072625 3575 5.25 33874 68080 26.3 26.3 20.3% 0.0% 0.0% 0.0% 11.45sec 1072625 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement lava_lash 60103 5373765 17913 14.56 61209 123193 72.8 72.8 20.3% 0.0% 0.0% 0.0% 4.05sec 5373765 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement lightning_bolt 188196 2343959 7813 4.32 87103 174922 21.6 21.6 24.4% 0.0% 0.0% 0.0% 13.93sec 2343959 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement main_hand 0 824249 2748 41.74 3793 7624 208.7 208.7 20.3% 16.4% 0.0% 0.0% 1.67sec 1177528 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement manic_grieftorch 382135 1121515 3738 5.36 34788 69938 26.8 26.8 20.0% 0.0% 0.0% 0.0% 9.33sec 1121515 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement manic_grieftorch_channel 377463 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.53sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement offhand 1 409296 1364 41.47 1897 3814 207.4 207.4 20.3% 16.4% 0.0% 0.0% 1.67sec 584723 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.76sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement primordial_wave 375982 70130 234 1.40 8310 16689 7.0 7.0 20.3% 0.0% 0.0% 0.0% 45.71sec 70130 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement lightning_bolt_pw 188196 1317091 4390 1.39 152090 306161 7.0 7.0 23.9% 0.0% 0.0% 0.0% 45.85sec 1317091 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 49.4 0.0 0.0% 0.0% 0.0% 0.0% 5.94sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement stormstrike_mh 32175 584883 1950 9.88 9823 19744 49.4 49.4 20.3% 0.0% 0.0% 0.0% 5.94sec 835569 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement stormstrike_offhand 32176 292406 975 9.88 4911 9873 49.4 49.4 20.3% 0.0% 0.0% 0.0% 5.94sec 417734 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement sundering 197214 375613 1252 1.03 60507 122041 5.1 5.1 20.3% 0.0% 0.0% 0.0% 58.66sec 375613 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement windfury_attack 25504 371828 1239 33.77 1827 3674 168.9 168.9 20.3% 0.0% 0.0% 0.0% 3.66sec 531197 300.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement_greater_earth_elemental melee 0 42548 699 41.04 851 1701 41.6 41.6 20.1% 0.0% 0.0% 0.0% 1.85sec 60784 60.86sec
T29_Shaman_Enhancement T29_Shaman_Enhancement_frost_wolf melee 0 373102 14924 259.32 2870 5738 108.0 108.0 20.3% 0.0% 0.0% 0.0% 2.88sec 533017 25.00sec
T29_Shaman_Enhancement T29_Shaman_Enhancement_fiery_wolf melee 0 374205 9781 169.86 2870 5738 108.3 108.3 20.4% 0.0% 0.0% 0.0% 2.88sec 534592 38.26sec
T29_Shaman_Enhancement T29_Shaman_Enhancement_lightning_wolf melee 0 372738 9796 170.84 2858 5714 108.3 108.3 20.4% 0.0% 0.0% 0.0% 2.89sec 532496 38.05sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys ascendance_dre 114051 0 0 0.00 0 0 7.9 0.0 0.0% 0.0% 0.0% 0.0% 32.18sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys ascendance_damage_dre 344548 487855 1626 1.57 49330 99027 7.9 7.9 25.6% 0.0% 0.0% 0.0% 32.18sec 487855 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.34sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys bloodlust 2825 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys broodkeepers_blaze ticks -394453 488158 1627 8.57 9211 18517 15.9 42.8 23.5% 0.0% 0.0% 0.0% 18.05sec 488158 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys doom_winds 384352 34584 115 0.74 9294 0 3.7 3.7 0.0% 0.0% 0.0% 0.0% 90.37sec 49407 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys earth_elemental 198103 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 309.65sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys elemental_blast 117014 3586084 11954 4.85 116256 233005 24.3 24.3 27.0% 0.0% 0.0% 0.0% 12.10sec 3586084 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys feral_spirit 51533 0 0 0.00 0 0 15.5 0.0 0.0% 0.0% 0.0% 0.0% 19.85sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys flame_shock 188389 160188 534 5.93 4370 8773 29.7 29.7 23.4% 0.0% 0.0% 0.0% 9.96sec 820849 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys flame_shock ticks -188389 660661 2202 41.17 2596 5215 29.7 205.8 23.4% 0.0% 0.0% 0.0% 9.96sec 820849 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys flametongue_weapon 318038 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys flametongue_attack 10444 771271 2571 231.82 539 1082 1159.1 1159.1 23.3% 0.0% 0.0% 0.0% 0.64sec 771271 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys flask 371339 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys frost_shock 196840 2865384 9551 9.52 48646 97651 47.6 47.6 23.5% 0.0% 0.0% 0.0% 6.11sec 2865384 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys ice_strike 342240 951183 3171 5.29 29124 58496 26.5 26.5 23.3% 0.0% 0.0% 0.0% 11.33sec 951183 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys lava_lash 60103 756249 2521 3.90 31367 63032 19.5 19.5 23.3% 0.0% 0.0% 0.0% 14.77sec 756249 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys lightning_bolt 188196 1322204 4407 2.94 70576 141494 14.7 14.7 27.4% 0.0% 0.0% 0.0% 18.80sec 1322204 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys main_hand 0 746073 2487 36.06 3854 7748 180.3 180.3 23.5% 16.3% 0.0% 0.0% 1.93sec 1065846 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys manic_grieftorch 382135 1161221 3871 5.37 35058 70481 26.8 26.8 23.2% 0.0% 0.0% 0.0% 9.33sec 1161221 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys manic_grieftorch_channel 377463 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.56sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys offhand 1 377795 1259 36.54 1928 3876 182.7 182.7 23.4% 16.4% 0.0% 0.0% 1.89sec 539721 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys potion 371028 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys stormstrike 17364 0 0 0.00 0 0 81.6 0.0 0.0% 0.0% 0.0% 0.0% 3.64sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys stormstrike_mh 32175 1630761 5436 21.77 12114 24379 108.8 108.8 23.4% 0.0% 0.0% 0.0% 3.64sec 2329719 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys stormstrike_offhand 32176 815645 2719 21.77 6055 12202 108.8 108.8 23.4% 0.0% 0.0% 0.0% 3.64sec 1165236 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys windfury_totem 8512 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys windfury_weapon 33757 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys windfury_attack 25504 3821538 12738 86.99 7113 14295 434.9 434.9 23.3% 0.0% 0.0% 0.0% 2.30sec 5459480 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys windlash 114089 251537 838 7.18 5503 11063 35.9 35.9 27.1% 0.0% 0.0% 0.0% 7.77sec 251537 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys windlash_offhand 114093 136404 455 7.78 2752 5531 38.9 38.9 27.2% 0.0% 0.0% 0.0% 7.19sec 136404 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys windstrike 115356 0 0 0.00 0 0 30.9 0.0 0.0% 0.0% 0.0% 0.0% 7.52sec 0 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys windstrike_mh 115357 987748 3292 8.22 19499 39133 41.1 41.1 23.1% 0.0% 0.0% 0.0% 7.52sec 987748 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys windstrike_offhand 115360 493586 1645 8.22 9749 19575 41.1 41.1 23.0% 0.0% 0.0% 0.0% 7.52sec 493586 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys lightning_bolt_ti 188196 2214260 7381 6.15 56461 113389 30.8 30.8 27.2% 0.0% 0.0% 0.0% 7.55sec 2214260 300.00sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys_greater_earth_elemental melee 0 46573 754 43.11 849 1697 44.4 44.4 23.6% 0.0% 0.0% 0.0% 2.07sec 66534 61.80sec
T29_Shaman_Enhancement_Phys T29_Shaman_Enhancement_Phys_spirit_wolf melee 0 1503803 13279 222.80 2900 5797 420.5 420.5 23.3% 0.0% 0.0% 0.0% 1.41sec 2148345 113.25sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
682026.0 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Brittle 12.6 2.2 22.3sec 18.8sec 5.5sec 22.95% 23.00% 2.2 (2.2) 12.3

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.0s / 186.0s
  • trigger_min/max:0.4s / 183.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • brittle_1:22.95%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3sec 18.8sec 5.5sec 23.08% 23.38% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 204.0s
  • trigger_min/max:0.3s / 195.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • brittle_1:23.08%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.2sec 18.7sec 5.5sec 23.13% 23.32% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 235.0s
  • trigger_min/max:0.0s / 235.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.9s

Stack Uptimes

  • brittle_1:23.13%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Brittle 12.7 2.2 22.3sec 18.7sec 5.5sec 23.14% 23.34% 2.2 (2.2) 12.4

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_brittle
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.9s / 207.0s
  • trigger_min/max:3.0s / 207.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s

Stack Uptimes

  • brittle_1:23.14%

Spelldata

  • id:374557
  • name:Brittle
  • tooltip:Damage taken from {$@=}auracaster increased by {$s1=6}%.
  • description:{$@spelldesc374504=Your diseases have a chance to weaken your enemy causing your attacks against them to deal {$374557s1=6}% increased damage for {$374557d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Death and Madness (_death_check) 10.4 2.8 30.3sec 23.5sec 7.2sec 25.02% 0.00% 2.8 (2.8) 10.1

Buff Details

  • buff initial source:T29_Priest_Shadow
  • cooldown name:buff_death_and_madness_death_check
  • max_stacks:1
  • base duration:7.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:3.5s / 68.2s
  • trigger_min/max:0.9s / 68.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.4s

Stack Uptimes

  • death_and_madness_death_check_1:25.02%

Spelldata

  • id:322098
  • name:Death and Madness
  • tooltip:If the target dies within {$d=7 seconds}, the Priest gains {$321291m2=20} Insanity.
  • description:{$@spelldesc321291=If your Shadow Word: Death fails to kill a target at or below {$s2=20}% health, its cooldown is reset. Cannot occur more than once every {$390628d=20 seconds}. {$?=}c3[ If a target dies within {$322098d=7 seconds} after being struck by your Shadow Word: Death, you gain {$=}{{$321973s1=750}*{$321973t1=1}*{$321973d=4 seconds}/100} Insanity over {$321973d=4 seconds}.][]}
  • max_stacks:0
  • duration:7.00
  • cooldown:0.00
  • default_chance:0.00%
Death Rot 1.4 130.6 154.0sec 2.2sec 217.8sec 98.07% 0.00% 118.6 (118.6) 0.4

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_death_rot
  • max_stacks:10
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:5.4s / 326.2s
  • trigger_min/max:0.0s / 16.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.7s

Stack Uptimes

  • death_rot_1:0.32%
  • death_rot_2:0.49%
  • death_rot_3:0.67%
  • death_rot_4:0.60%
  • death_rot_5:0.71%
  • death_rot_6:0.67%
  • death_rot_7:0.66%
  • death_rot_8:0.68%
  • death_rot_9:0.67%
  • death_rot_10:92.61%

Spelldata

  • id:377540
  • name:Death Rot
  • tooltip:Shadow damage taken from {$@=}auracaster is increased by {$s1=1}%.
  • description:{$@spelldesc377537=Death Coil and Epidemic debilitate your enemy applying Death Rot causing them to take {$377540s1=1}% increased Shadow damage, up to {$=}{{$377540s1=1}*{$377540u=10}}% for {$377540d=10 seconds}. If Death Coil or Epidemic consume Sudden Doom it applies two stacks of Death Rot.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Everfrost 2.9 255.7 113.6sec 1.2sec 103.3sec 98.68% 98.88% 230.4 (230.4) 1.9

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_everfrost
  • max_stacks:10
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.0s / 353.8s
  • trigger_min/max:0.0s / 15.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.5s

Stack Uptimes

  • everfrost_1:0.96%
  • everfrost_2:0.95%
  • everfrost_3:0.95%
  • everfrost_4:0.95%
  • everfrost_5:0.94%
  • everfrost_6:0.94%
  • everfrost_7:0.93%
  • everfrost_8:0.93%
  • everfrost_9:0.93%
  • everfrost_10:90.20%

Spelldata

  • id:376974
  • name:Everfrost
  • tooltip:Damage taken from Remorseless Winter increased by {$=}w1%.
  • description:{$@spelldesc376938=Remorseless Winter deals {$s1=6}% increased damage to enemies it hits, stacking up to {$376974u=10} times.}
  • max_stacks:10
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Festering Wound 31.5 39.4 9.6sec 4.2sec 7.7sec 80.61% 100.00% 8.3 (13.8) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Unholy
  • cooldown name:buff_festering_wound
  • max_stacks:6
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.8s / 63.0s
  • trigger_min/max:0.0s / 23.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 57.6s

Stack Uptimes

  • festering_wound_1:21.25%
  • festering_wound_2:26.45%
  • festering_wound_3:18.15%
  • festering_wound_4:5.27%
  • festering_wound_5:2.83%
  • festering_wound_6:6.65%

Spelldata

  • id:194310
  • name:Festering Wound
  • tooltip:Suffering from a wound that will deal {$=}{{$194311s1=0}/{$s1=1}} Shadow damage when damaged by Scourge Strike.
  • description:A pustulent lesion that will burst on death or when damaged by Scourge Strike, dealing {$194311s1=0} Shadow damage and generating {$=}{{$195757s2=30}/10} Runic Power.
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Lashing Flames 1.0 71.8 6.7sec 4.0sec 293.9sec 97.94% 98.10% 71.8 (71.8) 0.0

Buff Details

  • buff initial source:T29_Shaman_Enhancement
  • cooldown name:buff_lashing_flames
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.4s / 7.0s
  • trigger_min/max:0.8s / 15.1s
  • trigger_pct:100.00%
  • duration_min/max:229.8s / 357.5s

Stack Uptimes

  • lashing_flames_1:97.94%

Spelldata

  • id:334168
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's Flame Shock increased by {$s1=100}%.
  • description:{$@spelldesc334046=Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spelldata

  • id:334046
  • name:Lashing Flames
  • tooltip:
  • description:Lava Lash increases the damage of Flame Shock on its target by {$334168s1=100}% for {$334168d=20 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.0 71.3 191.8sec 4.1sec 293.5sec 99.20% 0.00% 67.2 (67.2) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.0s / 353.2s
  • trigger_min/max:0.8s / 43.6s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 358.0s

Stack Uptimes

  • razorice_1:0.94%
  • razorice_2:0.68%
  • razorice_3:0.75%
  • razorice_4:0.78%
  • razorice_5:96.04%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 1.5 33.0 150.1sec 8.7sec 197.0sec 98.93% 0.00% 27.3 (27.3) 0.5

Buff Details

  • buff initial source:T29_Death_Knight_Frost_2h
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 353.4s
  • trigger_min/max:0.8s / 61.1s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 359.0s

Stack Uptimes

  • razorice_1:4.60%
  • razorice_2:3.29%
  • razorice_3:3.16%
  • razorice_4:3.60%
  • razorice_5:84.28%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Razorice 68.9 368.3 4.4sec 0.7sec 4.4sec 99.94% 100.00% 93.9 (93.9) 0.0

Buff Details

  • buff initial source:T29_Death_Knight_Frost_DW
  • cooldown name:buff_razorice
  • max_stacks:5
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 14.2s
  • trigger_min/max:0.0s / 6.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.2s

Stack Uptimes

  • razorice_1:18.99%
  • razorice_2:11.91%
  • razorice_3:17.50%
  • razorice_4:14.91%
  • razorice_5:36.63%

Spelldata

  • id:51714
  • name:Razorice
  • tooltip:Frost damage taken from the Death Knight's abilities increased by {$s1=3}%.
  • description:{$@spelldesc53343=Engrave your weapon with a rune that causes {$=}{$max(({$=}<coeff>*{$=}AP),1)}% extra weapon damage as Frost damage and increases enemies' vulnerability to your Frost attacks by {$51714s1=3}%, stacking up to {$51714u=5} times. {$?a332944=false}[][ Modifying your rune requires a Runeforge in Ebon Hold.]}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 685054.60
Minimum 641546.70
Maximum 736832.16
Spread ( max - min ) 95285.46
Range [ ( max - min ) / 2 * 100% ] 6.95%
Standard Deviation 13428.0858
5th Percentile 663437.05
95th Percentile 706917.57
( 95th Percentile - 5th Percentile ) 43480.52
Mean Distribution
Standard Deviation 155.0645
95.00% Confidence Interval ( 684750.68 - 685358.52 )
Normalized 95.00% Confidence Interval ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1476
0.1 Scale Factor Error with Delta=300 1539260
0.05 Scale Factor Error with Delta=300 6157039
0.01 Scale Factor Error with Delta=300 153925965
HPS
Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 3829
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 247702647 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.