close

SimulationCraft 801-01

for World of Warcraft 8.0.1 Live (wow build level 26095, git build 416dabe)

Beta Release

Current simulator hotfixes

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

T22_Death_Knight_Blood : 9135 dps, 0 dtps, 82 hps (22 aps), 52.2k TMI, 61.0k ETMI

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR   HPS HPS(e) HPS Error HPS Range HPR   APS APS Error APS Range APR
9135.0 9135.0 5.5 / 0.060% 947.0 / 10.4% 1352.9       59.9 59.9 0.16 / 0.27% 23 / 38.9% 9.9       22.1 0.03 / 0.14% 4 / 17.0% 9.9
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max   Window Bin Size
0.0 0.00 / 0.00% 0 / 0.0%       52.2k 9 / 0.02% 50.6k 53.5k 1.6k / 3.0%       0.0% -0.0% 0.0%       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.0 6.0 Runic Power 13.09% 50.1 100.0% 100%
Talents
  • 15: Rune Strike (Blood Death Knight)
  • 30: Hemostasis (Blood Death Knight)
  • 45: Ossuary (Blood Death Knight)
  • 60: Anti-Magic Barrier (Blood Death Knight)
  • 90: Bloodworms (Blood Death Knight)
  • 100: Red Thirst (Blood Death Knight)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
T22_Death_Knight_Blood 9135
auto_attack_mh 2491 27.3% 125.4 2.40sec 5956 2497 Direct 125.4 4740 9474 5956 25.7% 3.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.38 125.38 0.00 0.00 2.3854 0.0000 746743.72 1077191.79 30.68 2496.67 2496.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.43 72.12% 4782.90 4174 5996 4784.16 4585 5020 432525 618346 30.05
hit (blocked) 2.76 2.20% 3346.85 2922 4197 3130.85 0 4093 9245 18881 47.74
crit 31.22 24.90% 9560.55 8347 11992 9563.07 8965 10208 298499 426739 30.05
crit (blocked) 0.97 0.77% 6687.80 5843 8395 4133.11 0 8186 6476 13225 31.55
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Blood Boil 1089 11.9% 56.2 5.34sec 5804 5359 Direct 56.2 4625 9248 5804 25.5% 0.0%  

Stats details: blood_boil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.22 56.22 0.00 0.00 1.0831 0.0000 326290.93 326290.93 0.00 5358.52 5358.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.89 74.51% 4625.48 4034 5813 4626.81 4404 4859 193761 193761 0.00
crit 14.33 25.49% 9248.14 8069 11625 9251.70 8561 10213 132530 132530 0.00
 
 

Action details: blood_boil

Static Values
  • id:50842
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:7.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges_fractional>=1.8&(buff.hemostasis.stack<=(5-spell_targets.blood_boil)|spell_targets.blood_boil>2)
Spelldata
  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within $A1 yds.][ and infects all enemies within $A1 yds with Blood Plague. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {$@spelldesc55078=A shadowy disease that drains $o1 health from the target over {$d=24 seconds}. }]
 
Blood Plague 396 4.3% 56.2 5.34sec 2112 0 Periodic 98.8 956 1912 1203 25.8% 0.0% 98.8%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.22 0.00 98.75 98.75 0.0000 3.0000 118755.39 118755.39 0.00 400.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.3 74.20% 955.89 837 1206 956.15 918 1000 70038 70038 0.00
crit 25.5 25.80% 1911.75 1674 2412 1912.32 1809 2051 48717 48717 0.00
 
 

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining $w1 health from the target every $t1 sec.
  • description:A shadowy disease that drains $o1 health from the target over {$d=24 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.062244
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Death and Decay 381 4.2% 15.2 19.47sec 7511 6872 Direct 164.4 553 1106 695 25.7% 0.0%  

Stats details: death_and_decay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 164.44 0.00 0.00 1.0929 0.0000 114319.07 114319.07 0.00 6872.20 6872.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.16 74.29% 553.04 485 698 553.23 523 584 67557 67557 0.00
crit 42.28 25.71% 1106.07 969 1396 1106.36 1033 1180 46762 46762 0.00
 
 

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.death_and_decay>=3
Spelldata
  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing ${$52212m1*11} Shadow damage over {$d=10 seconds} to targets within the area. While you remain within the area, your $?c1[Heart Strike will hit up to $188290m3 additional targets.]?s207311[Clawing Shadows will hit all enemies near the target.][Scourge Strike will hit all enemies near the target.]
 
Death Strike 1823 20.0% 44.4 6.55sec 12298 11220 Direct 44.4 9785 19569 12298 25.7% 3.0%  

Stats details: death_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.44 44.44 0.00 0.00 1.0962 0.0000 546482.26 788373.77 30.68 11219.56 11219.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.02 72.06% 9874.43 7861 14950 9876.84 9306 10480 316195 452038 30.05
hit (blocked) 1.00 2.25% 6913.73 5502 10163 4329.37 0 9878 6904 14099 31.97
crit 11.08 24.92% 19745.06 15721 29900 19750.74 16957 23086 218680 312630 30.05
crit (blocked) 0.34 0.77% 13832.65 11005 20342 4003.86 0 20327 4704 9607 14.76
 
 

Action details: death_strike

Static Values
  • id:49998
  • school:physical
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power.deficit<=10
Spelldata
  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of ${{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$s2=25}% of all damage taken in the last {$s4=5} sec, minimum {$s3=7}% of maximum health.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Heart Strike 944 10.3% 87.2 3.38sec 3245 2981 Direct 87.2 2583 5168 3245 25.6% 3.0%  

Stats details: heart_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.19 87.19 0.00 0.00 1.0885 0.0000 282957.63 408228.44 30.69 2981.42 2981.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.90 72.14% 2607.11 2278 3282 2607.77 2491 2737 163976 234424 30.05
hit (blocked) 1.97 2.25% 1824.47 1595 2298 1578.23 0 2233 3585 7323 44.14
crit 21.65 24.83% 5215.47 4556 6565 5217.44 4828 5682 112932 161450 30.05
crit (blocked) 0.68 0.78% 3646.20 3189 4595 1768.00 0 4595 2464 5033 24.74
 
 

Action details: heart_strike

Static Values
  • id:206930
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.dancing_rune_weapon.up|rune.time_to_4<gcd
Spelldata
  • id:206930
  • name:Heart Strike
  • school:physical
  • tooltip:Movement speed reduced by {$s5=20}%.
  • description:Instantly strike the target and 1 other nearby enemy, causing {$s2=0} Physical damage, and reducing enemies' movement speed by {$s5=20}% for {$d=8 seconds}. |cFFFFFFFFGenerates {$?s221536=false}[${{$s3=5}+{$221536s1=0}}][{$s3=5}] bonus Runic Power{$?s221536=false}[, plus ${{$210738s1=20}/10} Runic Power per additional enemy struck][].|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Marrowrend 398 4.4% 23.7 12.85sec 5039 4698 Direct 23.7 4034 8048 5039 25.0% 3.0%  

Stats details: marrowrend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.66 23.66 0.00 0.00 1.0727 0.0000 119240.98 171996.28 30.67 4698.23 4698.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.20 72.71% 4070.49 3533 5090 4072.08 3789 4379 70029 100115 30.05
hit (blocked) 0.53 2.25% 2853.97 2473 3563 1182.18 0 3563 1516 3097 21.14
crit 5.75 24.32% 8118.67 7066 10180 8109.53 0 9609 46720 66792 30.02
crit (blocked) 0.17 0.73% 5682.21 4946 7126 902.83 0 7126 976 1993 8.11
 
 

Action details: marrowrend

Static Values
  • id:195182
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bone_shield.remains<=rune.time_to_3|buff.bone_shield.remains<=(gcd+cooldown.blooddrinker.ready*talent.blooddrinker.enabled*2)|buff.bone_shield.stack<3)&runic_power.deficit>=20
Spelldata
  • id:195182
  • name:Marrowrend
  • school:physical
  • tooltip:
  • description:Smash the target, dealing {$s2=0} Physical damage and generating {$s3=3} charges of Bone Shield. |Tinterface\icons\ability_deathknight_boneshield.blp:24|t |cFFFFFFFFBone Shield|r {$@spelldesc195181=Surrounds you with a barrier of whirling bones, increasing Armor by ${{$s1=40}*$STR/100}, and your Haste by {$s4=10}%. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Rune Strike 220 2.4% 8.0 38.23sec 8197 7700 Direct 8.0 6551 13079 8197 25.2% 2.9%  

Stats details: rune_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.03 8.03 0.00 0.00 1.0646 0.0000 65850.08 94964.78 30.66 7699.96 7699.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.83 72.63% 6608.20 5644 8132 6610.23 0 7489 38558 55124 30.05
hit (blocked) 0.17 2.16% 4621.26 3951 5532 746.10 0 5532 803 1640 8.24
crit 1.97 24.48% 13194.97 11288 16264 11703.21 0 16264 25947 37094 26.67
crit (blocked) 0.06 0.73% 9218.97 7901 11384 526.28 0 11065 542 1107 2.91
 
 

Action details: rune_strike

Static Values
  • id:210764
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges_fractional>=1.8|buff.dancing_rune_weapon.up)&rune.time_to_3>=gcd
Spelldata
  • id:210764
  • name:Rune Strike
  • school:physical
  • tooltip:
  • description:Strike the target for {$s1=0} Physical damage. Cooldown reduced by {$s2=1} sec for every Rune you spend. |cFFFFFFFFGenerates {$s2=1} Rune.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Touch of the Grave 230 2.5% 18.0 17.03sec 3836 0 Direct 18.0 3058 6114 3836 25.5% 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.97 17.97 0.00 0.00 0.0000 0.0000 68937.19 68937.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.39 74.54% 3058.00 2598 3940 3059.57 2827 3336 40961 40961 0.00
crit 4.58 25.46% 6114.01 5196 7879 6080.27 0 7658 27976 27976 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing $<damage> Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.312500
  • spell_power_mod.direct:0.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Wasting Infection 104 1.1% 7.7 35.70sec 4026 0 Periodic 42.7 581 1162 730 25.7% 0.0% 28.1%

Stats details: wasting_infection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.74 0.00 42.71 42.71 0.0000 1.9770 31180.15 31180.15 0.00 369.28 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.7 74.31% 580.87 0 603 581.36 539 596 18435 18435 0.00
crit 11.0 25.69% 1161.63 1 1207 1162.43 0 1207 12745 12745 0.00
 
 

Action details: wasting_infection

Static Values
  • id:278110
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278110
  • name:Wasting Infection
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. The caster's attacks will grant them Critical Strike.
  • description:
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:533.46
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - dancing_rune_weapon 2983 / 238
Blood Boil 298 0.3% 3.4 76.92sec 2065 0 Direct 3.4 1654 3308 2065 24.8% 0.0%  

Stats details: blood_boil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.41 3.41 0.00 0.00 0.0000 0.0000 7041.79 7041.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.56 75.19% 1654.24 1345 1938 1638.20 0 1938 4242 4242 0.00
crit 0.85 24.81% 3308.45 2690 3875 2022.97 0 3875 2799 2799 0.00
 
 

Action details: blood_boil

Static Values
  • id:50842
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within $A1 yds.][ and infects all enemies within $A1 yds with Blood Plague. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {$@spelldesc55078=A shadowy disease that drains $o1 health from the target over {$d=24 seconds}. }]
 
Blood Plague 391 0.3% 3.4 76.92sec 2709 0 Periodic 22.4 328 655 412 25.7% 0.0% 22.0%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.41 0.00 22.44 22.44 0.0000 2.9402 9240.88 9240.88 0.00 140.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.7 74.34% 327.74 11 402 327.84 273 369 5468 5468 0.00
crit 5.8 25.66% 655.05 13 804 652.45 0 781 3773 3773 0.00
 
 

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining $w1 health from the target every $t1 sec.
  • description:A shadowy disease that drains $o1 health from the target over {$d=24 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.062244
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Death Strike 665 0.6% 3.8 42.49sec 4130 0 Direct 3.8 3282 6561 4130 25.9% 0.0%  

Stats details: death_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.82 3.82 0.00 0.00 0.0000 0.0000 15793.54 22578.76 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.83 74.12% 3281.76 2620 4379 3256.50 0 4134 9301 13297 29.79
crit 0.99 25.88% 6561.42 5240 8759 4417.93 0 8512 6492 9281 20.23
 
 

Action details: death_strike

Static Values
  • id:49998
  • school:physical
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of ${{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$s2=25}% of all damage taken in the last {$s4=5} sec, minimum {$s3=7}% of maximum health.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Heart Strike 376 0.3% 7.7 35.38sec 1152 0 Direct 7.7 915 1830 1152 26.0% 0.0%  

Stats details: heart_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.75 7.75 0.00 0.00 0.0000 0.0000 8928.73 12764.69 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.74 74.03% 914.74 759 1094 915.25 0 1063 5247 7501 30.05
crit 2.01 25.97% 1829.97 1519 2188 1651.09 0 2188 3682 5264 27.11
 
 

Action details: heart_strike

Static Values
  • id:206930
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:206930
  • name:Heart Strike
  • school:physical
  • tooltip:Movement speed reduced by {$s5=20}%.
  • description:Instantly strike the target and 1 other nearby enemy, causing {$s2=0} Physical damage, and reducing enemies' movement speed by {$s5=20}% for {$d=8 seconds}. |cFFFFFFFFGenerates {$?s221536=false}[${{$s3=5}+{$221536s1=0}}][{$s3=5}] bonus Runic Power{$?s221536=false}[, plus ${{$210738s1=20}/10} Runic Power per additional enemy struck][].|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
main_hand 720 0.6% 7.9 34.86sec 2153 860 Direct 7.9 1724 3444 2153 24.9% 0.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.92 7.92 0.00 0.00 2.5045 0.0000 17040.95 24362.09 30.05 859.53 859.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.94 75.09% 1724.38 1418 2043 1725.08 1476 1974 10250 14654 30.05
crit 1.97 24.91% 3443.74 2836 4086 3078.33 0 4086 6791 9709 26.87
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Marrowrend 283 0.2% 3.8 44.39sec 1782 0 Direct 3.8 1452 2896 1782 22.8% 0.0%  

Stats details: marrowrend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.75 3.75 0.00 0.00 0.0000 0.0000 6685.37 9557.55 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.90 77.19% 1452.45 1178 1697 1445.61 0 1680 4207 6014 29.90
crit 0.86 22.81% 2895.69 2355 3393 1779.05 0 3393 2479 3544 18.47
 
 

Action details: marrowrend

Static Values
  • id:195182
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195182
  • name:Marrowrend
  • school:physical
  • tooltip:
  • description:Smash the target, dealing {$s2=0} Physical damage and generating {$s3=3} charges of Bone Shield. |Tinterface\icons\ability_deathknight_boneshield.blp:24|t |cFFFFFFFFBone Shield|r {$@spelldesc195181=Surrounds you with a barrier of whirling bones, increasing Armor by ${{$s1=40}*$STR/100}, and your Haste by {$s4=10}%. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Rune Strike 251 0.2% 2.0 2.65sec 2961 0 Direct 2.0 2369 4735 2961 25.0% 0.0%  

Stats details: rune_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 5924.53 8469.82 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.50 74.96% 2368.65 1881 2711 2219.75 0 2711 3552 5078 28.16
crit 0.50 25.04% 4735.02 4225 5421 2073.80 0 5421 2372 3392 13.16
 
 

Action details: rune_strike

Static Values
  • id:210764
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210764
  • name:Rune Strike
  • school:physical
  • tooltip:
  • description:Strike the target for {$s1=0} Physical damage. Cooldown reduced by {$s2=1} sec for every Rune you spend. |cFFFFFFFFGenerates {$s2=1} Rune.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bloodworm 1253 / 821
main_hand 1253 9.0% 401.8 0.74sec 612 606 Direct 401.8 487 974 612 25.7% 0.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 401.83 401.83 0.00 0.00 1.0104 0.0000 245982.08 351660.93 30.05 605.85 605.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 298.70 74.33% 487.16 425 613 487.27 460 517 145514 208029 30.05
crit 103.13 25.67% 974.17 851 1226 974.39 903 1037 100468 143631 30.05
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
T22_Death_Knight_Blood 60
Blood Shield 22 27.2% 44.4 6.55sec 149 0 Direct 157.4 42 0 42 0.0%  

Stats details: blood_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 44.44 157.36 0.00 0.00 0.0000 0.0000 6640.05 3670498.70 99.82 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 157.36 100.00% 42.20 0 170 42.17 39 44 6640 3670499 99.79
 
 

Action details: blood_shield

Static Values
  • id:77535
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:true
  • if_expr:
Spelldata
  • id:77535
  • name:Blood Shield
  • school:shadow
  • tooltip:Absorbs $w1 Physical damage.
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14044.96
  • base_dd_max:14044.96
 
Death Strike (_heal) 44 53.2% 44.4 6.55sec 292 0 Direct 44.4 292 0 292 0.0%  

Stats details: death_strike_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 44.44 44.44 0.00 0.00 0.0000 0.0000 12971.93 1089393.11 98.81 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.44 100.00% 291.93 0 2660 295.57 137 482 12972 1089393 98.79
 
 

Action details: death_strike_heal

Static Values
  • id:45470
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:true
  • if_expr:
Spelldata
  • id:45470
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc49998=Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of ${{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$s2=25}% of all damage taken in the last {$s4=5} sec, minimum {$s3=7}% of maximum health.}
 
Unholy Strength 16 19.6% 23.7 12.63sec 201 0 Direct 23.7 201 0 201 0.0%  

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 23.71 23.71 0.00 0.00 0.0000 0.0000 4768.07 451935.58 98.94 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.71 100.00% 201.11 0 2660 204.60 0 507 4768 451936 98.93
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 
Simple Action Stats Execute Interval
T22_Death_Knight_Blood
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:false
  • if_expr:
 
Dancing Rune Weapon 3.0 120.29sec

Stats details: dancing_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 1.1763 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dancing_rune_weapon

Static Values
  • id:49028
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.blooddrinker.enabled|!cooldown.blooddrinker.ready
Spelldata
  • id:49028
  • name:Dancing Rune Weapon
  • school:physical
  • tooltip:
  • description:Summons a rune weapon for {$s4=8} sec that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=40}% parry chance.
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:false
  • if_expr:
 
Mind Freeze 10.6 29.34sec

Stats details: mind_freeze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mind_freeze

Static Values
  • id:47528
  • school:frost
  • resource:runic_power
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47528
  • name:Mind Freeze
  • school:frost
  • tooltip:
  • description:Smash the target's mind with cold, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:stamina
  • amount:24.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=6}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Strength 2.0 0.0 121.5sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_battle_potion_of_strength
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:900.00

Stack Uptimes

  • battle_potion_of_strength_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279153
  • name:Battle Potion of Strength
  • tooltip:Strength increased by $w1.
  • description:Increases your Strength by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Shield 4.4 40.0 65.3sec 6.5sec 94.85% 100.00% 40.0(40.0) 3.4

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_blood_shield
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_shield_1:94.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:77535
  • name:Blood Shield
  • tooltip:Absorbs $w1 Physical damage.
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bone Shield 1.0 21.7 159.5sec 13.5sec 99.57% 99.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_bone_shield
  • max_stacks:10
  • duration:30.00
  • cooldown:2.50
  • default_chance:100.00%
  • default_value:0.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bone_shield_1:0.00%
  • bone_shield_2:0.00%
  • bone_shield_3:0.94%
  • bone_shield_4:4.79%
  • bone_shield_5:33.10%
  • bone_shield_6:32.92%
  • bone_shield_7:27.81%
  • bone_shield_8:0.00%
  • bone_shield_9:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:195181
  • name:Bone Shield
  • tooltip:Armor increased by ${$w1*$STR/100}. Haste increased by $w4%.
  • description:Surrounds you with a barrier of whirling bones, increasing Armor by ${{$s1=40}*$STR/100}, and your Haste by {$s4=10}%. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Scourge 15.3 1.1 19.6sec 18.2sec 6.76% 0.00% 1.1(1.1) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_crimson_scourge
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • crimson_scourge_1:6.76%

Trigger Attempt Success

  • trigger_pct:25.67%

Spelldata details

  • id:81141
  • name:Crimson Scourge
  • tooltip:Your next Death and Decay costs no Runes and generates no Runic Power.
  • description:{$@spelldesc81136=Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spell details

  • id:81136
  • name:Crimson Scourge
  • tooltip:
  • description:Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
Critical Prowess 1.0 151.7 0.0sec 2.0sec 100.00% 0.00% 147.7(147.7) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_critical_prowess
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Syringe of Bloodborne Infirmity

Stat Buff details

  • stat:crit_rating
  • amount:101.29

Stack Uptimes

  • critical_prowess_1:0.43%
  • critical_prowess_2:0.62%
  • critical_prowess_3:0.45%
  • critical_prowess_4:0.44%
  • critical_prowess_5:98.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278108
  • name:Critical Prowess
  • tooltip:Increases your Critical Strike by $w1.
  • description:
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Dancing Rune Weapon 3.0 0.0 120.3sec 120.3sec 7.98% 9.41% 0.0(0.0) 2.9

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_dancing_rune_weapon
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dancing_rune_weapon_1:7.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81256
  • name:Dancing Rune Weapon
  • tooltip:Parry chance increased by {$s1=40}%.
  • description:{$@spelldesc49028=Summons a rune weapon for {$s4=8} sec that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=40}% parry chance.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.6 0.2 74.2sec 66.0sec 9.00% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.3sec 65.9sec 8.97% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:8.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 74.5sec 66.3sec 9.00% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 75.4sec 67.5sec 8.96% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:8.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Undertow 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_flask_of_the_undertow
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:238.00

Stack Uptimes

  • flask_of_the_undertow_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251839
  • name:Flask of the Undertow
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Hemostasis 39.6 16.6 7.6sec 5.3sec 67.21% 87.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_hemostasis
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • hemostasis_1:50.20%
  • hemostasis_2:15.74%
  • hemostasis_3:0.90%
  • hemostasis_4:0.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:273947
  • name:Hemostasis
  • tooltip:Damage and healing done by your next Death Strike increased by {$s1=8}%.
  • description:{$@spelldesc273946=Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:273946
  • name:Hemostasis
  • tooltip:
  • description:Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Incite the Pack 4.1 1.5 67.0sec 45.6sec 30.94% 0.00% 1.5(1.5) 3.8

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_incite_the_pack
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:666.00

Stack Uptimes

  • incite_the_pack_1:30.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280412
  • name:Incite the Pack
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc280410=You occasionally loose a tremendous roar, increasing your Mastery by {$s1=0} and granting {$s2=0} Mastery to up to $280413i nearby allies. Lasts {$280412d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 5.1 0.0 57.9sec 35.7sec 39.27% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.53%
  • overwhelming_power_2:1.54%
  • overwhelming_power_3:1.54%
  • overwhelming_power_4:1.55%
  • overwhelming_power_5:1.56%
  • overwhelming_power_6:1.56%
  • overwhelming_power_7:1.57%
  • overwhelming_power_8:1.57%
  • overwhelming_power_9:1.58%
  • overwhelming_power_10:1.58%
  • overwhelming_power_11:1.59%
  • overwhelming_power_12:1.59%
  • overwhelming_power_13:1.60%
  • overwhelming_power_14:1.60%
  • overwhelming_power_15:1.61%
  • overwhelming_power_16:1.61%
  • overwhelming_power_17:1.62%
  • overwhelming_power_18:1.62%
  • overwhelming_power_19:1.63%
  • overwhelming_power_20:1.63%
  • overwhelming_power_21:1.64%
  • overwhelming_power_22:1.64%
  • overwhelming_power_23:1.65%
  • overwhelming_power_24:1.68%
  • overwhelming_power_25:0.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 100.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (swamp_fish_n_chips) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_swamp_fish_n_chips
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:70.00

Stack Uptimes

  • swamp_fish_n_chips_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:257415
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=70} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.7 15.0 35.7sec 12.6sec 73.75% 72.19% 15.0(15.0) 8.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • unholy_strength_1:73.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 25.5 27.5 11.9sec 5.7sec 66.25% 0.00% 2.0(2.0) 24.9

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:31.97%
  • unstable_flames_2:16.49%
  • unstable_flames_3:8.56%
  • unstable_flames_4:4.44%
  • unstable_flames_5:4.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
parry_haste 33.0 8.7sec
Rune ready 130.2 2.6sec
Bloodworms 28.4 10.6sec

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=36225)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0051.387 / 1.2653.1275.110
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
5.4795.6016.697 / 6.5248.48113.400

Resources

Resource Usage Type Count Total Average RPE APR
T22_Death_Knight_Blood
death_strike Runic Power 44.4 1789.4 40.3 40.3 305.4
heart_strike Rune 87.2 87.2 1.0 1.0 3245.3
marrowrend Rune 23.7 47.3 2.0 2.0 2519.7
pet - dancing_rune_weapon
death_strike Runic Power 3.8 172.1 45.0 45.0 91.8
heart_strike Rune 7.7 7.7 1.0 1.0 1152.4
marrowrend Rune 3.8 7.5 2.0 2.0 890.8
Resource Gains Type Count Total Average Overflow
death_strike_heal Health 44.44 12972.03 (73.12%) 291.93 1076418.55 98.81%
marrowrend Runic Power 23.66 466.99 (25.75%) 19.74 6.25 1.32%
heart_strike Runic Power 87.19 1307.86 (72.11%) 15.00 0.00 0.00%
unholy_strength Health 23.71 4767.97 (26.88%) 201.11 447156.07 98.94%
Rune Regeneration Rune 122.21 122.21 (93.83%) 1.00 0.00 0.00%
Rune Weapon Heart Strike Runic Power 7.75 38.74 (2.14%) 5.00 0.00 0.00%
Rune Strike Rune 8.03 8.03 (6.17%) 1.00 0.00 0.00%
pet - dancing_rune_weapon
rune_strike Rune 2.00 0.00 (0.00%) 0.00 2.00 100.00%
Resource RPS-Gain RPS-Loss
Health 59.13 0.00
Runic Power 6.05 5.96
Rune 0.43 0.45
Combat End Resource Mean Min Max
Runic Power 24.38 0.00 75.00
Rune 1.72 0.00 4.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 1.1%

Statistics & Data Analysis

Fight Length
Sample Data T22_Death_Knight_Blood Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Death_Knight_Blood Damage Per Second
Count 7499
Mean 9135.00
Minimum 8343.44
Maximum 10016.71
Spread ( max - min ) 1673.27
Range [ ( max - min ) / 2 * 100% ] 9.16%
Standard Deviation 242.1491
5th Percentile 8751.90
95th Percentile 9551.78
( 95th Percentile - 5th Percentile ) 799.88
Mean Distribution
Standard Deviation 2.7963
95.00% Confidence Intervall ( 9129.52 - 9140.48 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2700
0.1 Scale Factor Error with Delta=300 501
0.05 Scale Factor Error with Delta=300 2003
0.01 Scale Factor Error with Delta=300 50056
Priority Target DPS
Sample Data T22_Death_Knight_Blood Priority Target Damage Per Second
Count 7499
Mean 9135.00
Minimum 8343.44
Maximum 10016.71
Spread ( max - min ) 1673.27
Range [ ( max - min ) / 2 * 100% ] 9.16%
Standard Deviation 242.1491
5th Percentile 8751.90
95th Percentile 9551.78
( 95th Percentile - 5th Percentile ) 799.88
Mean Distribution
Standard Deviation 2.7963
95.00% Confidence Intervall ( 9129.52 - 9140.48 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2700
0.1 Scale Factor Error with Delta=300 501
0.05 Scale Factor Error with Delta=300 2003
0.01 Scale Factor Error with Delta=300 50056
DPS(e)
Sample Data T22_Death_Knight_Blood Damage Per Second (Effective)
Count 7499
Mean 9135.00
Minimum 8343.44
Maximum 10016.71
Spread ( max - min ) 1673.27
Range [ ( max - min ) / 2 * 100% ] 9.16%
Damage
Sample Data T22_Death_Knight_Blood Damage
Count 7499
Mean 2420757.39
Minimum 1847453.93
Maximum 3013711.39
Spread ( max - min ) 1166257.46
Range [ ( max - min ) / 2 * 100% ] 24.09%
DTPS
Sample Data T22_Death_Knight_Blood Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS
Sample Data T22_Death_Knight_Blood Healing Per Second
Count 7499
Mean 59.94
Minimum 49.28
Maximum 73.91
Spread ( max - min ) 24.63
Range [ ( max - min ) / 2 * 100% ] 20.55%
Standard Deviation 7.0350
5th Percentile 50.11
95th Percentile 72.11
( 95th Percentile - 5th Percentile ) 22.00
Mean Distribution
Standard Deviation 0.0812
95.00% Confidence Intervall ( 59.78 - 60.10 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 530
0.1% Error 52915
0.1 Scale Factor Error with Delta=300 1
0.05 Scale Factor Error with Delta=300 2
0.01 Scale Factor Error with Delta=300 43
HPS(e)
Sample Data T22_Death_Knight_Blood Healing Per Second (Effective)
Count 7499
Mean 59.94
Minimum 49.28
Maximum 73.91
Spread ( max - min ) 24.63
Range [ ( max - min ) / 2 * 100% ] 20.55%
Heal
Sample Data T22_Death_Knight_Blood Heal
Count 7499
Mean 17740.00
Minimum 17740.00
Maximum 17740.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Death_Knight_Blood Healing Taken Per Second
Count 7499
Mean 59.94
Minimum 49.28
Maximum 73.91
Spread ( max - min ) 24.63
Range [ ( max - min ) / 2 * 100% ] 20.55%
TMI
Sample Data T22_Death_Knight_Blood Theck-Meloree Index
Count 7499
Mean 52210.26
Minimum 50567.93
Maximum 53517.69
Spread ( max - min ) 2949.77
Range [ ( max - min ) / 2 * 100% ] 2.82%
Standard Deviation 394.9206
5th Percentile 51539.57
95th Percentile 52821.67
( 95th Percentile - 5th Percentile ) 1282.10
Mean Distribution
Standard Deviation 4.5605
95.00% Confidence Intervall ( 52201.32 - 52219.20 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 3
0.1% Error 220
0.1 Scale Factor Error with Delta=300 1332
0.05 Scale Factor Error with Delta=300 5326
0.01 Scale Factor Error with Delta=300 133139
ETMI
Sample Data T22_Death_Knight_BloodTheck-Meloree Index (Effective)
Count 7499
Mean 60981.51
Minimum 60934.51
Maximum 61015.38
Spread ( max - min ) 80.88
Range [ ( max - min ) / 2 * 100% ] 0.07%
MSD
Sample Data T22_Death_Knight_Blood Max Spike Value
Count 3737
Mean 0.00
Minimum -0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 337.66%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 10.59 mind_freeze
0.00 blood_fury,if=cooldown.dancing_rune_weapon.ready&(!cooldown.blooddrinker.ready|!talent.blooddrinker.enabled)
0.00 berserking
0.00 use_items
7 1.00 potion,if=buff.dancing_rune_weapon.up
8 2.99 dancing_rune_weapon,if=!talent.blooddrinker.enabled|!cooldown.blooddrinker.ready
0.00 tombstone,if=buff.bone_shield.stack>=7
9 0.00 call_action_list,name=standard
actions.standard
# count action,conditions
A 28.71 death_strike,if=runic_power.deficit<=10
0.00 blooddrinker,if=!buff.dancing_rune_weapon.up
B 1.24 marrowrend,if=(buff.bone_shield.remains<=rune.time_to_3|buff.bone_shield.remains<=(gcd+cooldown.blooddrinker.ready*talent.blooddrinker.enabled*2)|buff.bone_shield.stack<3)&runic_power.deficit>=20
C 4.46 blood_boil,if=charges_fractional>=1.8&(buff.hemostasis.stack<=(5-spell_targets.blood_boil)|spell_targets.blood_boil>2)
D 22.42 marrowrend,if=buff.bone_shield.stack<5&talent.ossuary.enabled&runic_power.deficit>=15
0.00 bonestorm,if=runic_power>=100&!buff.dancing_rune_weapon.up
E 15.73 death_strike,if=runic_power.deficit<=(15+buff.dancing_rune_weapon.up*5+spell_targets.heart_strike*talent.heartbreaker.enabled*2)|target.time_to_die<10
0.00 death_and_decay,if=spell_targets.death_and_decay>=3
F 2.00 rune_strike,if=(charges_fractional>=1.8|buff.dancing_rune_weapon.up)&rune.time_to_3>=gcd
G 22.52 heart_strike,if=buff.dancing_rune_weapon.up|rune.time_to_4<gcd
H 0.57 blood_boil,if=buff.dancing_rune_weapon.up
I 15.22 death_and_decay,if=buff.crimson_scourge.up|talent.rapid_decomposition.enabled|spell_targets.death_and_decay>=2
0.00 consumption
J 51.20 blood_boil
K 64.67 heart_strike,if=rune.time_to_3<gcd|buff.bone_shield.stack>6
L 6.03 rune_strike
0.00 arcane_torrent,if=runic_power.deficit>20

Sample Sequence

012458B6CDBFCGFDJKAIJKKJGAGDAJKJKJIGADJKAKKJKA6KJKEILJGGGADJKJKAKJDAKJKIKA6JKDAJKJKKAIJKDAKJLKKAJKIDAJKK6JKAK87GAGHGAGJJDAKKJLKAKJIDAKJ6KJIGAKJDAKKJKAIJKKEJGKLJGADK6JIKAJGKEDJKKAKJ6KEJIKKJDAKJLGE6KJKDAKJIG8EGCGEG6GCEJKDKAJIKJ6KEKDJKALJKKEIJKKKADJK6JEEKEJKDI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Death_Knight_Blood 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune
Pre precombat 1 food T22_Death_Knight_Blood 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune
Pre precombat 2 augmentation T22_Death_Knight_Blood 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune
Pre precombat 4 potion Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune battle_potion_of_strength
0:00.000 default 5 auto_attack Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/304280: 100% health | 6.0/6: 100% rune resounding_protection, archive_of_the_titans, battle_potion_of_strength
0:00.000 default 8 dancing_rune_weapon Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/304280: 100% health | 6.0/6: 100% rune unholy_strength, resounding_protection, archive_of_the_titans, critical_prowess, battle_potion_of_strength
0:01.266 standard B marrowrend Fluffy_Pillow 0.0/125: 0% runic_power | 304280.0/304280: 100% health | 6.0/6: 100% rune bloodlust, dancing_rune_weapon, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans, critical_prowess, battle_potion_of_strength
0:02.240 default 6 mind_freeze Fluffy_Pillow 20.0/125: 16% runic_power | 304280.0/304280: 100% health | 4.0/6: 67% rune bloodlust, bone_shield(3), dancing_rune_weapon, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans, critical_prowess(2), battle_potion_of_strength
0:02.240 standard C blood_boil Fluffy_Pillow 20.0/125: 16% runic_power | 304280.0/304280: 100% health | 4.0/6: 67% rune bloodlust, bone_shield(3), dancing_rune_weapon, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans, critical_prowess(2), battle_potion_of_strength
0:03.126 standard D marrowrend Fluffy_Pillow 20.0/125: 16% runic_power | 304280.0/304280: 100% health | 4.0/6: 67% rune bloodlust, bone_shield(3), dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans, critical_prowess(2), battle_potion_of_strength
0:04.011 standard B marrowrend Fluffy_Pillow 40.0/125: 32% runic_power | 304280.0/304280: 100% health | 2.0/6: 33% rune bloodlust, bone_shield(2), dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans, critical_prowess(3), battle_potion_of_strength
0:04.898 standard F rune_strike Fluffy_Pillow 60.0/125: 48% runic_power | 304280.0/304280: 100% health | 0.0/6: 0% rune bloodlust, bone_shield(5), dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans, critical_prowess(4), battle_potion_of_strength
0:05.784 standard C blood_boil Fluffy_Pillow 60.0/125: 48% runic_power | 304280.0/305160: 100% health | 1.0/6: 17% rune bloodlust, bone_shield(5), dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(2), critical_prowess(4), battle_potion_of_strength
0:06.670 standard G heart_strike Fluffy_Pillow 60.0/125: 48% runic_power | 304280.0/305160: 100% health | 1.0/6: 17% rune bloodlust, bone_shield(5), dancing_rune_weapon, hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:07.557 standard F rune_strike Fluffy_Pillow 80.0/125: 64% runic_power | 304280.0/305160: 100% health | 2.0/6: 33% rune bloodlust, bone_shield(5), dancing_rune_weapon, hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:08.444 standard D marrowrend Fluffy_Pillow 80.0/125: 64% runic_power | 304280.0/305160: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:09.330 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 304280.0/305160: 100% health | 2.0/6: 33% rune bloodlust, bone_shield(7), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:10.216 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 304280.0/306060: 99% health | 2.0/6: 33% rune bloodlust, bone_shield(7), hemostasis(3), unholy_strength, resounding_protection, archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:11.103 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 304280.0/306060: 99% health | 1.0/6: 17% rune bloodlust, bone_shield(7), crimson_scourge, hemostasis(3), unholy_strength, resounding_protection, archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:11.991 standard I death_and_decay Fluffy_Pillow 75.0/125: 60% runic_power | 306060.0/306060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), crimson_scourge, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:12.878 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 306060.0/306060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:13.763 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 306060.0/306060: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:14.649 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 306060.0/306060: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:15.535 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 306060.0/306940: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:16.422 Waiting     1.700 sec 105.0/125: 84% runic_power | 306060.0/306940: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:18.122 standard G heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 306060.0/306940: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:19.008 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 306060.0/306940: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:19.895 standard G heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 306940.0/306940: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:20.783 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 306940.0/307820: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(4), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(5), critical_prowess(5), battle_potion_of_strength
0:21.668 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 306940.0/307820: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(4), archive_of_the_titans(5), critical_prowess(5), battle_potion_of_strength
0:22.554 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 307820.0/307820: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(4), archive_of_the_titans(5), critical_prowess(5), battle_potion_of_strength
0:23.440 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 307820.0/307820: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(4), archive_of_the_titans(5), critical_prowess(5)
0:24.325 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 307820.0/307820: 100% health | 0.0/6: 0% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(4), archive_of_the_titans(5), critical_prowess(5)
0:25.212 Waiting     0.600 sec 90.0/125: 72% runic_power | 307820.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(4), archive_of_the_titans(6), critical_prowess(5)
0:25.812 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 307820.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(6), critical_prowess(5)
0:26.698 Waiting     1.800 sec 105.0/125: 84% runic_power | 307820.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(6), critical_prowess(5)
0:28.498 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 307820.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(6), critical_prowess(5)
0:29.599 standard I death_and_decay Fluffy_Pillow 105.0/125: 84% runic_power | 307820.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), crimson_scourge, hemostasis(3), unholy_strength, resounding_protection, archive_of_the_titans(6), critical_prowess(5)
0:30.484 standard G heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 307820.0/309600: 99% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis(3), resounding_protection, archive_of_the_titans(7), critical_prowess(5)
0:31.370 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 307820.0/309600: 99% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(5), hemostasis(3), resounding_protection, incite_the_pack, archive_of_the_titans(7), critical_prowess(5)
0:32.256 standard D marrowrend Fluffy_Pillow 80.0/125: 64% runic_power | 309600.0/309600: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(4), resounding_protection, incite_the_pack, archive_of_the_titans(7), critical_prowess(5)
0:33.142 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 309600.0/309600: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), resounding_protection, incite_the_pack, archive_of_the_titans(7), critical_prowess(5)
0:34.029 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 309600.0/309600: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), hemostasis, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(7), critical_prowess(5)
0:34.916 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 309600.0/309600: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(7), critical_prowess(5)
0:35.802 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 309600.0/310500: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(8), critical_prowess(5)
0:36.687 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 309600.0/310500: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(8), critical_prowess(5)
0:37.573 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 309600.0/310500: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(8), critical_prowess(5)
0:38.460 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 309600.0/310500: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(8), critical_prowess(5)
0:39.319 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 309600.0/310500: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(8), critical_prowess(5)
0:40.178 default 6 mind_freeze Fluffy_Pillow 80.0/125: 64% runic_power | 310500.0/311380: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(9), critical_prowess(5)
0:40.178 Waiting     1.400 sec 80.0/125: 64% runic_power | 310500.0/311380: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(9), critical_prowess(5)
0:41.578 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 311380.0/311380: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(9), critical_prowess(5)
0:42.693 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 311380.0/311380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(9), critical_prowess(5)
0:43.808 Waiting     0.200 sec 95.0/125: 76% runic_power | 311380.0/311380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(9), critical_prowess(5)
0:44.008 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 311380.0/311380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(9), critical_prowess(5)
0:45.122 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 311380.0/312260: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(10), critical_prowess(5)
0:46.238 standard I death_and_decay Fluffy_Pillow 70.0/125: 56% runic_power | 312260.0/312260: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(10), critical_prowess(5)
0:47.354 standard L rune_strike Fluffy_Pillow 70.0/125: 56% runic_power | 312260.0/312260: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(10), critical_prowess(5)
0:48.470 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 312260.0/312260: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(10), critical_prowess(5)
0:49.620 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 312260.0/312260: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(10), critical_prowess(5)
0:50.771 standard G heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 312260.0/313160: 100% health | 4.0/6: 67% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(11), critical_prowess(5)
0:51.922 standard G heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 312260.0/313160: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(11), critical_prowess(5)
0:53.074 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 312260.0/313160: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(11), critical_prowess(5)
0:54.226 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 313160.0/313160: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(11), critical_prowess(5)
0:55.377 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 313160.0/314040: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(12), critical_prowess(5)
0:56.529 Waiting     0.800 sec 90.0/125: 72% runic_power | 313160.0/314040: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(12), critical_prowess(5)
0:57.329 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 313160.0/314040: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(12), critical_prowess(5)
0:58.479 Waiting     0.400 sec 105.0/125: 84% runic_power | 313160.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(12), critical_prowess(5)
0:58.879 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 313160.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(12), critical_prowess(5)
1:00.230 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 313160.0/314920: 99% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(13), critical_prowess(5)
1:01.382 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 313160.0/314920: 99% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(13), critical_prowess(5)
1:02.532 Waiting     1.800 sec 80.0/125: 64% runic_power | 314920.0/314920: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, incite_the_pack, unstable_flames(4), archive_of_the_titans(13), critical_prowess(5)
1:04.332 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 314920.0/314920: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, incite_the_pack, unstable_flames(5), archive_of_the_titans(13), critical_prowess(5)
1:05.483 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 314920.0/315820: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, incite_the_pack, unstable_flames(5), archive_of_the_titans(14), critical_prowess(5)
1:06.635 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 314920.0/315820: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), hemostasis, resounding_protection, incite_the_pack, unstable_flames(5), archive_of_the_titans(14), critical_prowess(5)
1:07.788 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 315820.0/315820: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(5), archive_of_the_titans(14), critical_prowess(5)
1:08.940 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 315820.0/315820: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, archive_of_the_titans(14), critical_prowess(5)
1:10.093 Waiting     0.300 sec 90.0/125: 72% runic_power | 315820.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, archive_of_the_titans(15), critical_prowess(5)
1:10.393 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 315820.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, archive_of_the_titans(15), critical_prowess(5)
1:11.700 Waiting     0.900 sec 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(15), critical_prowess(5)
1:12.600 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 316700.0/316700: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(15), critical_prowess(5)
1:13.751 Waiting     0.400 sec 105.0/125: 84% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(15), critical_prowess(5)
1:14.151 standard I death_and_decay Fluffy_Pillow 105.0/125: 84% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(15), critical_prowess(5)
1:15.303 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 316700.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(16), critical_prowess(5)
1:16.454 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 316700.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(16), critical_prowess(5)
1:17.605 default 6 mind_freeze Fluffy_Pillow 80.0/125: 64% runic_power | 317580.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, archive_of_the_titans(16), critical_prowess(5)
1:17.605 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 317580.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, archive_of_the_titans(16), critical_prowess(5)
1:18.757 Waiting     0.900 sec 80.0/125: 64% runic_power | 317580.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(16), critical_prowess(5)
1:19.657 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 317580.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(16), critical_prowess(5)
1:20.807 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 317580.0/318480: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(17), critical_prowess(5)
1:21.960 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 317580.0/318480: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(17), critical_prowess(5)
1:23.112 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 318480.0/318480: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(17), critical_prowess(5)
1:24.263 Waiting     3.000 sec 75.0/125: 60% runic_power | 318480.0/318480: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(17), critical_prowess(5)
1:27.263 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 319360.0/319360: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(18), critical_prowess(5)
1:28.415 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 319360.0/319360: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(18), critical_prowess(5)
1:29.568 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 319360.0/319360: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(18), critical_prowess(5)
1:30.685 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 319360.0/320240: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(19), critical_prowess(5)
1:31.800 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 319360.0/320240: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(19), critical_prowess(5)
1:32.914 standard I death_and_decay Fluffy_Pillow 80.0/125: 64% runic_power | 320240.0/320240: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(19), critical_prowess(5)
1:34.028 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 320240.0/320240: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(19), critical_prowess(5)
1:35.141 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 320240.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(20), critical_prowess(5)
1:36.257 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 320240.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(20), critical_prowess(5)
1:37.371 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 320240.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
1:38.486 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
1:39.600 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
1:40.750 standard L rune_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
1:41.901 Waiting     0.300 sec 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
1:42.201 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
1:43.241 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
1:44.283 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, overwhelming_power(22), archive_of_the_titans(20), critical_prowess(5)
1:45.328 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
1:46.378 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
1:47.432 Waiting     0.200 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
1:47.632 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
1:48.687 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, overwhelming_power(18), archive_of_the_titans(20), critical_prowess(5)
1:49.745 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, unstable_flames, overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
1:50.807 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, incite_the_pack, unstable_flames, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
1:51.871 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
1:52.973 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
1:54.076 default 6 mind_freeze Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
1:54.076 Waiting     0.800 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
1:54.876 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
1:56.146 Waiting     0.900 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
1:57.046 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5)
1:58.169 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5)
1:59.292 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
2:00.418 default 8 dancing_rune_weapon Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
2:01.548 default 7 potion Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), dancing_rune_weapon, unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(5), archive_of_the_titans(20), critical_prowess(5)
2:01.548 standard G heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), dancing_rune_weapon, unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(5), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:02.682 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), dancing_rune_weapon, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:03.819 standard G heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), dancing_rune_weapon, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:04.959 standard H blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(5), dancing_rune_weapon, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:06.106 standard G heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), dancing_rune_weapon, hemostasis, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:07.258 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), dancing_rune_weapon, hemostasis, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:08.409 standard G heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), dancing_rune_weapon, resounding_protection, elemental_whirl_mastery, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:09.561 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_mastery, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:10.713 Waiting     1.100 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(4), hemostasis, resounding_protection, elemental_whirl_mastery, incite_the_pack, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:11.813 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(4), hemostasis, resounding_protection, elemental_whirl_mastery, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:13.182 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis(2), resounding_protection, elemental_whirl_mastery, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:14.333 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis(2), resounding_protection, elemental_whirl_mastery, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:15.483 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), resounding_protection, elemental_whirl_mastery, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:16.634 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, elemental_whirl_mastery, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:17.748 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:18.865 standard L rune_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:19.979 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:21.094 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:22.209 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:23.323 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_haste, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:24.439 Waiting     0.200 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:24.639 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:25.752 Waiting     0.300 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:26.052 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:27.205 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:28.355 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:29.510 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:30.661 Waiting     1.500 sec 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:32.161 default 6 mind_freeze Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:32.161 Waiting     2.000 sec 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:34.161 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:35.312 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
2:36.464 standard I death_and_decay Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
2:37.615 standard G heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
2:38.765 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:39.915 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:41.067 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:42.218 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:43.368 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:44.520 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), resounding_protection, archive_of_the_titans(20), critical_prowess(5)
2:45.669 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), resounding_protection, archive_of_the_titans(20), critical_prowess(5)
2:46.820 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:47.971 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:49.122 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:50.272 Waiting     1.300 sec 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:51.572 standard I death_and_decay Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:52.723 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:53.875 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:55.027 Waiting     2.100 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, incite_the_pack, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
2:57.127 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, incite_the_pack, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
2:58.280 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
2:59.429 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:00.579 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:01.733 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(5), overwhelming_power(25), archive_of_the_titans(20), critical_prowess(5)
3:02.801 standard L rune_strike Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(5), overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
3:03.873 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(5), overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
3:04.948 standard G heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(5), overwhelming_power(22), archive_of_the_titans(20), critical_prowess(5)
3:06.026 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(5), overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
3:07.112 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 4.0/6: 67% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(5), overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
3:08.201 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(5), overwhelming_power(18), archive_of_the_titans(20), critical_prowess(5)
3:09.292 default 6 mind_freeze Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(5), overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
3:09.292 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(5), overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
3:10.386 Waiting     0.300 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
3:10.686 standard I death_and_decay Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
3:11.784 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
3:12.884 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
3:13.987 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
3:15.169 standard G heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
3:16.283 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
3:17.400 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5)
3:18.521 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), resounding_protection, overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5)
3:19.647 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), resounding_protection, overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
3:20.773 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
3:21.903 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, overwhelming_power(5), archive_of_the_titans(20), critical_prowess(5)
3:23.035 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5)
3:24.177 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, unstable_flames, overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5)
3:25.321 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), resounding_protection, overwhelming_power, archive_of_the_titans(20), critical_prowess(5)
3:26.467 Waiting     0.700 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:27.167 default 6 mind_freeze Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:27.167 Waiting     0.700 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:27.867 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:29.019 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:30.172 Waiting     0.600 sec 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:30.772 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:32.168 standard I death_and_decay Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:33.319 Waiting     1.100 sec 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:34.419 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:35.571 Waiting     0.400 sec 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:35.971 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:37.123 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:38.275 standard D marrowrend Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), hemostasis(2), resounding_protection, elemental_whirl_mastery, archive_of_the_titans(20), critical_prowess(5)
3:39.426 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune bone_shield(7), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:40.577 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:41.728 Waiting     0.600 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:42.328 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:43.636 standard L rune_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:44.788 standard G heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, archive_of_the_titans(20), critical_prowess(5)
3:45.940 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, archive_of_the_titans(20), critical_prowess(5)
3:47.092 default 6 mind_freeze Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_mastery, overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
3:47.092 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_mastery, incite_the_pack, overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
3:48.167 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_mastery, incite_the_pack, overwhelming_power(22), archive_of_the_titans(20), critical_prowess(5)
3:49.246 Waiting     0.200 sec 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
3:49.446 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
3:50.529 standard D marrowrend Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
3:51.613 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
3:52.702 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, overwhelming_power(18), archive_of_the_titans(20), critical_prowess(5)
3:53.793 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
3:54.886 Waiting     3.100 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_crit, incite_the_pack, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
3:57.986 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, resounding_protection, incite_the_pack, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
3:59.094 standard G heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
4:00.206 default 8 dancing_rune_weapon Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
4:01.535 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), dancing_rune_weapon, hemostasis, resounding_protection, incite_the_pack, overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5)
4:02.654 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), dancing_rune_weapon, resounding_protection, incite_the_pack, overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5)
4:03.777 standard C blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), dancing_rune_weapon, resounding_protection, incite_the_pack, overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
4:04.903 standard G heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), dancing_rune_weapon, hemostasis, resounding_protection, incite_the_pack, overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
4:06.035 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), dancing_rune_weapon, hemostasis, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5)
4:07.174 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), dancing_rune_weapon, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5)
4:08.315 default 6 mind_freeze Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), dancing_rune_weapon, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5)
4:08.315 standard G heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), dancing_rune_weapon, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5)
4:09.459 standard C blood_boil Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), overwhelming_power, archive_of_the_titans(20), critical_prowess(5)
4:10.607 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:11.758 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:12.908 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:14.059 standard D marrowrend Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:15.212 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:16.366 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:17.517 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:18.668 standard I death_and_decay Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:19.819 Waiting     1.100 sec 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:20.919 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:22.069 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:23.221 default 6 mind_freeze Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:23.315 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:24.468 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:25.622 Waiting     1.400 sec 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:27.022 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:28.174 standard D marrowrend Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:29.325 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:30.475 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:31.625 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:32.776 standard L rune_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:33.927 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:35.078 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:36.229 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:37.379 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:38.528 standard I death_and_decay Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), crimson_scourge, unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:39.680 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
4:40.831 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
4:41.981 Waiting     0.300 sec 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:42.281 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:43.431 Waiting     0.400 sec 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:43.831 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames, overwhelming_power(25), archive_of_the_titans(20), critical_prowess(5)
4:44.900 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, resounding_protection, unstable_flames, overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
4:45.971 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), resounding_protection, unstable_flames, overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
4:47.047 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
4:48.130 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
4:49.212 default 6 mind_freeze Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
4:49.212 Waiting     0.500 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
4:49.712 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
4:51.014 standard E death_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
4:52.108 standard E death_strike Fluffy_Pillow 65.0/125: 52% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
4:53.206 standard K heart_strike Fluffy_Pillow 25.0/125: 20% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
4:54.306 standard E death_strike Fluffy_Pillow 40.0/125: 32% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
4:55.410 standard J blood_boil Fluffy_Pillow 0.0/125: 0% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
4:56.517 Waiting     0.300 sec 0.0/125: 0% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
4:56.817 standard K heart_strike Fluffy_Pillow 0.0/125: 0% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
4:57.928 Waiting     0.100 sec 15.0/125: 12% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
4:58.028 standard D marrowrend Fluffy_Pillow 15.0/125: 12% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
4:59.144 standard I death_and_decay Fluffy_Pillow 35.0/125: 28% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), crimson_scourge, hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5)

Stats

Level Bonus (120) Race Bonus (undead) Raid-Buffed Unbuffed Gear Amount
Strength 1467 2 5842 5544 4075 (3433)
Agility 1467 -1 1526 1466 0
Stamina 1001 1 15170 13791 7207
Intellect 1467 -2 1677 1465 0
Spirit 0 0 0 0 0
Health 303400 275820 0
Runic Power 125 125 0
Rune 6 6 0
Crit 17.08% 17.08% 870
Haste 18.87% 17.84% 1213
Damage / Heal Versatility 4.69% 4.69% 399
Mitigation Versatility 2.35% 2.35% 399
Attack Power 7562 6524 0
Mastery 35.36% 35.36% 697
Armor 4663 4663 4055
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 6.00% 6.00% 0
Tank-Parry 22.43% 22.00% 870
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 386.00
Local Head Gridrunner Galea
ilevel: 390, stats: { 571 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Azerite Empowered, Incite the Pack, Elemental Whirl, Resounding Protection }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Chitinspine Pauldrons
ilevel: 390, stats: { 527 Armor, +491 StrInt, +892 Sta }
azerite powers: { Azerite Empowered, Archive of the Titans, Overwhelming Power, Runic Barrier }
Local Chest Chestguard of Virulent Mutagens
ilevel: 390, stats: { 702 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Azerite Empowered, Archive of the Titans, Unstable Flames, Resounding Protection }
Local Waist Decontaminator's Greatbelt
ilevel: 385, stats: { 382 Armor, +247 StrInt, +417 Sta, +123 Mastery, +60 Crit }
Local Legs Greaves of Unending Vigil
ilevel: 385, stats: { 594 Armor, +329 StrInt, +556 Sta, +165 Haste, +81 Mastery }
Local Feet Warboots of Absolute Eradication
ilevel: 385, stats: { 467 Armor, +247 StrInt, +417 Sta, +111 Haste, +72 Vers }
Local Wrists Imperious Vambraces
ilevel: 385, stats: { 297 Armor, +185 StrInt, +312 Sta, +83 Vers, +54 Haste }
Local Hands Waste Disposal Crushers
ilevel: 385, stats: { 424 Armor, +247 StrInt, +417 Sta, +115 Crit, +68 Vers }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Syringe of Bloodborne Infirmity
ilevel: 385, stats: { +313 Str }
Local Trinket2 Vanquished Tendril of G'huun
ilevel: 385, stats: { +176 Vers }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Khor, Hammer of the Corrupted
ilevel: 385, weapon: { 778 - 1003, 3.6 }, stats: { +329 Str, +556 Sta, +142 Crit, +103 Haste }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Heartbreaker (Blood Death Knight) Blooddrinker (Blood Death Knight) Rune Strike (Blood Death Knight)
30 Rapid Decomposition (Blood Death Knight) Hemostasis (Blood Death Knight) Consumption (Blood Death Knight)
45 Foul Bulwark (Blood Death Knight) Ossuary (Blood Death Knight) Tombstone (Blood Death Knight)
60 Will of the Necropolis (Blood Death Knight) Anti-Magic Barrier (Blood Death Knight) Rune Tap (Blood Death Knight)
75 Grip of the Dead (Blood Death Knight) Tightening Grasp (Blood Death Knight) Wraith Walk (Blood Death Knight)
90 Voracious (Blood Death Knight) Bloodworms (Blood Death Knight) Mark of Blood (Blood Death Knight)
100 Purgatory (Blood Death Knight) Red Thirst (Blood Death Knight) Bonestorm (Blood Death Knight)

Profile

deathknight="T22_Death_Knight_Blood"
spec=blood
level=120
race=undead
role=tank
position=front
talents=3222022

# Default consumables
potion=battle_potion_of_strength
flask=flask_of_the_undertow
food=swamp_fish_n_chips
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze
actions+=/blood_fury,if=cooldown.dancing_rune_weapon.ready&(!cooldown.blooddrinker.ready|!talent.blooddrinker.enabled)
actions+=/berserking
actions+=/use_items
actions+=/potion,if=buff.dancing_rune_weapon.up
actions+=/dancing_rune_weapon,if=!talent.blooddrinker.enabled|!cooldown.blooddrinker.ready
actions+=/tombstone,if=buff.bone_shield.stack>=7
actions+=/call_action_list,name=standard

actions.standard=death_strike,if=runic_power.deficit<=10
actions.standard+=/blooddrinker,if=!buff.dancing_rune_weapon.up
actions.standard+=/marrowrend,if=(buff.bone_shield.remains<=rune.time_to_3|buff.bone_shield.remains<=(gcd+cooldown.blooddrinker.ready*talent.blooddrinker.enabled*2)|buff.bone_shield.stack<3)&runic_power.deficit>=20
actions.standard+=/blood_boil,if=charges_fractional>=1.8&(buff.hemostasis.stack<=(5-spell_targets.blood_boil)|spell_targets.blood_boil>2)
actions.standard+=/marrowrend,if=buff.bone_shield.stack<5&talent.ossuary.enabled&runic_power.deficit>=15
actions.standard+=/bonestorm,if=runic_power>=100&!buff.dancing_rune_weapon.up
actions.standard+=/death_strike,if=runic_power.deficit<=(15+buff.dancing_rune_weapon.up*5+spell_targets.heart_strike*talent.heartbreaker.enabled*2)|target.time_to_die<10
actions.standard+=/death_and_decay,if=spell_targets.death_and_decay>=3
actions.standard+=/rune_strike,if=(charges_fractional>=1.8|buff.dancing_rune_weapon.up)&rune.time_to_3>=gcd
actions.standard+=/heart_strike,if=buff.dancing_rune_weapon.up|rune.time_to_4<gcd
actions.standard+=/blood_boil,if=buff.dancing_rune_weapon.up
actions.standard+=/death_and_decay,if=buff.crimson_scourge.up|talent.rapid_decomposition.enabled|spell_targets.death_and_decay>=2
actions.standard+=/consumption
actions.standard+=/blood_boil
actions.standard+=/heart_strike,if=rune.time_to_3<gcd|buff.bone_shield.stack>6
actions.standard+=/rune_strike
actions.standard+=/arcane_torrent,if=runic_power.deficit>20

head=gridrunner_galea,id=160634,bonus_id=4824/1507/4775,azerite_powers=13/481/21/15
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=chitinspine_pauldrons,id=160641,bonus_id=4824/1507/4775,azerite_powers=13/483/30/201
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=chestguard_of_virulent_mutagens,id=160636,bonus_id=4824/1507/4775,azerite_powers=13/483/459/15
wrists=imperious_vambraces,id=160723,bonus_id=4800/1507
hands=waste_disposal_crushers,id=160635,bonus_id=4800/1507
waist=decontaminators_greatbelt,id=160638,bonus_id=4800/1507
legs=greaves_of_unending_vigil,id=160639,bonus_id=4800/1507
feet=warboots_of_absolute_eradication,id=160640,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=syringe_of_bloodborne_infirmity,id=160655,bonus_id=4800/1507
trinket2=vanquished_tendril_of_ghuun,id=160654,bonus_id=4800/1507
main_hand=khor_hammer_of_the_corrupted,id=160679,bonus_id=4800/1507,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=386.27
# gear_strength=4075
# gear_stamina=7207
# gear_crit_rating=870
# gear_haste_rating=1213
# gear_mastery_rating=697
# gear_versatility_rating=399
# gear_armor=4055

T22_Hunter_Beast_Mastery : 16546 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16546.1 16546.1 11.1 / 0.067% 1873.4 / 11.3% 415.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.1 15.9 Focus 9.88% 45.1 100.0% 100%
Talents
  • 15: Killer Instinct (Beast Mastery Hunter)
  • 30: Chimaera Shot (Beast Mastery Hunter)
  • 60: A Murder of Crows (Beast Mastery Hunter)
  • 90: Stomp (Beast Mastery Hunter)
  • 100: Aspect of the Beast (Beast Mastery Hunter)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Hunter_Beast_Mastery 16546
A Murder of Crows 1319 8.0% 5.5 60.59sec 72222 57701 Periodic 85.3 3426 7372 4621 30.3% 26.6%

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 0.00 85.26 85.26 1.2518 0.9360 394040.69 563328.48 30.05 4548.18 57701.08
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.4 69.71% 3425.99 2113 5235 3433.60 2960 3936 203620 291100 30.05
crit 25.8 30.29% 7372.17 4227 10470 7390.30 5533 9451 190420 272229 30.05
 
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target, dealing ${{$131900s1=0}*16} Physical damage over {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=0} physical damage.
 
Auto Shot 1902 11.5% 119.8 2.51sec 4758 1909 Direct 119.5 3721 7581 4767 27.1%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.77 119.53 0.00 0.00 2.4921 0.0000 569825.39 814633.82 30.05 1909.04 1909.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.12 72.89% 3720.75 3221 5168 3722.64 3568 3889 324153 463416 30.05
crit 32.41 27.11% 7580.89 6442 10336 7586.42 6881 8384 245672 351218 30.05
 
 

Action details: auto_shot

Static Values
  • id:75
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:60.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Azerite Globules 132 0.8% 13.3 22.32sec 2980 0 Direct 13.3 2387 4774 2980 24.9%  

Stats details: azerite_globules

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.29 13.29 0.00 0.00 0.0000 0.0000 39606.27 39606.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.99 75.15% 2387.05 2341 2567 2387.30 2341 2510 23838 23838 0.00
crit 3.30 24.85% 4774.22 4683 5133 4645.74 0 5133 15769 15769 0.00
 
 

Action details: azerite_globules

Static Values
  • id:279958
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279958
  • name:Azerite Globules
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2200.00
  • base_dd_max:2200.00
 
Barbed Shot 300 (899) 1.8% (5.4%) 37.1 8.07sec 7248 5917 Periodic 131.2 686 0 686 0.0% 87.4%

Stats details: barbed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.15 0.00 131.15 131.15 1.2248 2.0000 89910.91 128538.45 30.05 874.68 5917.43
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.2 100.00% 685.55 655 839 685.84 673 695 89911 128538 30.05
 
 

Action details: barbed_shot

Static Values
  • id:217200
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pet.cat.buff.frenzy.up&pet.cat.buff.frenzy.remains<=gcd.max
Spelldata
  • id:217200
  • name:Barbed Shot
  • school:physical
  • tooltip:Suffering $sw1 damage every $t1 sec.
  • description:Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Stomp (cat) 600 3.6% 37.1 8.07sec 4827 0 Direct 37.1 3677 7866 4827 27.5%  

Stats details: stomp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.15 37.15 0.00 0.00 0.0000 0.0000 179314.28 256351.29 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.95 72.54% 3676.63 2784 6897 3681.51 3128 4501 99068 141630 30.05
crit 10.20 27.46% 7866.34 5568 13793 7891.85 5568 11958 80246 114721 30.05
 
 

Action details: stomp

Static Values
  • id:201754
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201754
  • name:Stomp
  • school:physical
  • tooltip:
  • description:{$@spelldesc199530=When you cast Barbed Shot, your pet stomps the ground, dealing $<damage> Physical damage to all nearby enemies.}
 
Chimaera Shot 0 (855) 0.0% (5.2%) 23.2 13.09sec 11023 8993

Stats details: chimaera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.23 0.00 0.00 0.00 1.2258 0.0000 0.00 0.00 0.00 8992.66 8992.66
 
 

Action details: chimaera_shot

Static Values
  • id:53209
  • school:froststrike
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53209
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. |cFFFFFFFFGenerates {$204304s1=10} Focus for each target hit.|r
 
    Chimaera Shot (_frost) 428 2.6% 0.0 0.00sec 0 0 Direct 11.6 8619 17612 11064 27.2%  

Stats details: chimaera_shot_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 11.58 0.00 0.00 0.0000 0.0000 128118.71 128118.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.43 72.81% 8618.64 7335 11740 8618.09 7335 10454 72661 72661 0.00
crit 3.15 27.19% 17611.54 14669 23480 17212.36 0 23480 55458 55458 0.00
 
 

Action details: chimaera_shot_frost

Static Values
  • id:171454
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171454
  • name:Chimaera Shot
  • school:frost
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. |cFFFFFFFFGenerates {$204304s1=10} Focus for each target hit.|r}
 
    Chimaera Shot (_nature) 427 2.6% 0.0 0.00sec 0 0 Direct 11.6 8610 17626 11050 27.1%  

Stats details: chimaera_shot_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 11.58 0.00 0.00 0.0000 0.0000 127965.33 127965.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.45 72.94% 8609.69 7335 11740 8610.11 7335 10454 72720 72720 0.00
crit 3.13 27.06% 17626.10 14669 23480 17221.38 0 23480 55245 55245 0.00
 
 

Action details: chimaera_shot_nature

Static Values
  • id:171457
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171457
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. |cFFFFFFFFGenerates {$204304s1=10} Focus for each target hit.|r}
 
Cobra Shot 1562 9.4% 86.3 3.43sec 5422 4462 Direct 86.0 4219 8627 5438 27.7%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.30 86.04 0.00 0.00 1.2151 0.0000 467894.67 668911.62 30.05 4461.88 4461.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.24 72.34% 4218.90 3578 5727 4221.12 4020 4501 262577 375385 30.05
crit 23.80 27.66% 8626.98 7156 11454 8634.99 7664 9961 205318 293527 30.05
 
 

Action details: cobra_shot

Static Values
  • id:193455
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(active_enemies<2|cooldown.kill_command.remains>focus.time_to_max)&(buff.bestial_wrath.up&active_enemies>1|cooldown.kill_command.remains>1+gcd&cooldown.bestial_wrath.remains>focus.time_to_max|focus-cost+focus.regen*(cooldown.kill_command.remains-1)>action.kill_command.cost)
Spelldata
  • id:193455
  • name:Cobra Shot
  • school:physical
  • tooltip:
  • description:A quick shot causing ${{$s2=0}*$<mult>} Physical damage. Reduces the cooldown of Kill Command by {$s3=1} sec.
 
Frenetic Blow (frentic_blow) 254 1.5% 3.0 80.98sec 25615 0 Direct 3.0 20441 40888 25614 25.3%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 2.97 0.00 0.00 0.0000 0.0000 76126.67 108832.21 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.22 74.70% 20441.21 20147 22086 19403.29 0 22086 45380 64876 28.53
crit 0.75 25.30% 40888.23 40294 44172 22971.43 0 44172 30747 43956 16.88
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Heed My Call 281 (401) 1.7% (2.4%) 6.7 40.70sec 17944 0 Direct 6.7 10048 20085 12564 25.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 6.70 0.00 0.00 0.0000 0.0000 84142.32 84142.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.02 74.93% 10048.18 9833 10779 10027.74 0 10779 50424 50424 0.00
crit 1.68 25.07% 20085.00 19667 21559 16655.46 0 21559 33718 33718 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9240.00
  • base_dd_max:9240.00
 
    Heed My Call (_aoe) 120 0.7% 6.7 40.70sec 5380 0 Direct 6.7 4306 8610 5380 25.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 6.70 0.00 0.00 0.0000 0.0000 36029.77 36029.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.03 75.05% 4306.06 4214 4620 4295.13 0 4620 21642 21642 0.00
crit 1.67 24.95% 8609.67 8429 9240 7087.19 0 9240 14388 14388 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3960.00
  • base_dd_max:3960.00
 
Kill Command 0 (3124) 0.0% (18.9%) 55.3 5.42sec 16924 13860

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.26 0.00 0.00 0.00 1.2211 0.0000 0.00 0.00 0.00 13860.17 13860.17
 
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:7.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to the enemy.
 
    Kill Command (cat) 3124 18.9% 55.3 5.42sec 16924 0 Direct 55.3 12928 27571 16924 27.3%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.26 55.26 0.00 0.00 0.0000 0.0000 935242.88 1337042.01 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.18 72.71% 12927.88 8453 32102 12935.37 11074 14664 519421 742575 30.05
crit 15.08 27.29% 27570.50 16907 64204 27614.68 20100 38665 415822 594467 30.05
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to the enemy.}
 
pet - cat 9822 / 9822
Claw 3087 18.7% 83.8 3.60sec 11027 10977 Direct 83.8 8446 17965 11027 27.1%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.84 83.84 0.00 0.00 1.0045 0.0000 924497.68 1321680.45 30.05 10977.31 10977.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.11 72.89% 8446.31 6551 16761 8456.14 7482 9399 516187 737951 30.05
crit 22.73 27.11% 17964.66 13103 33522 18002.58 13914 23361 408311 583730 30.05
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 3013 18.2% 289.2 1.03sec 3119 3010 Direct 289.2 2390 5084 3119 27.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 289.17 289.17 0.00 0.00 1.0361 0.0000 901847.41 1289299.17 30.05 3010.24 3010.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 210.94 72.95% 2390.14 1856 4598 2392.82 2231 2582 504186 720794 30.05
crit 78.22 27.05% 5083.64 3712 9196 5090.95 4507 5964 397662 568505 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
T22_Hunter_Beast_Mastery
Aspect of the Wild 3.0 120.79sec

Stats details: aspect_of_the_wild

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.7564 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_wild

Static Values
  • id:193530
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.3000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:193530
  • name:Aspect of the Wild
  • school:physical
  • tooltip:Gaining {$s2=5} Focus per sec. Critical Strike chance increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=5} Focus per sec and {$s1=10}% increased critical strike chance for {$d=20 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Beast_Mastery
  • harmful:false
  • if_expr:
 
Bestial Wrath 8.4 37.88sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.40 0.00 0.00 0.00 1.2119 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bestial_wrath.up
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by $w1%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=15 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=12} sec each time you use Barbed Shot.][]
 
Blood Fury 3.0 120.91sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.bestial_wrath.remains>30
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=400} for {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Beast_Mastery
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Beast_Mastery
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Wild 3.0 0.0 121.0sec 120.8sec 19.46% 0.00% 57.9(57.9) 2.8

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stack Uptimes

  • aspect_of_the_wild_1:19.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Gaining {$s2=5} Focus per sec. Critical Strike chance increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=5} Focus per sec and {$s1=10}% increased critical strike chance for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Barbed Shot (_1) 20.1 0.0 15.2sec 15.2sec 52.81% 0.00% 78.9(78.9) 19.5

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_barbed_shot_1
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • barbed_shot_1_1:52.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:246152
  • name:Barbed Shot
  • tooltip:Generating ${$w1*{$d=8 seconds}/$t1} Focus over {$d=8 seconds}.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Barbed Shot (_2) 16.8 0.0 17.8sec 17.8sec 44.20% 0.00% 66.0(66.0) 16.3

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_barbed_shot_2
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • barbed_shot_2_1:44.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:246152
  • name:Barbed Shot
  • tooltip:Generating ${$w1*{$d=8 seconds}/$t1} Focus over {$d=8 seconds}.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Barbed Shot (_3) 0.3 0.0 147.6sec 147.6sec 0.73% 0.00% 1.0(1.0) 0.2

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_barbed_shot_3
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • barbed_shot_3_1:0.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:246152
  • name:Barbed Shot
  • tooltip:Generating ${$w1*{$d=8 seconds}/$t1} Focus over {$d=8 seconds}.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Barbed Shot (_4) 0.0 0.0 0.0sec 0.0sec 0.02% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_barbed_shot_4
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • barbed_shot_4_1:0.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:246152
  • name:Barbed Shot
  • tooltip:Generating ${$w1*{$d=8 seconds}/$t1} Focus over {$d=8 seconds}.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Potion of Agility 2.0 0.0 135.3sec 0.0sec 15.84% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:15.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bestial Wrath 8.4 0.0 37.9sec 37.9sec 40.97% 0.00% 0.0(0.0) 8.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bestial_wrath_1:40.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by $w1%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=15 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=12} sec each time you use Barbed Shot.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
Blood Fury 3.0 0.0 120.9sec 120.9sec 14.63% 0.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:attack_power
  • amount:400.00

Stack Uptimes

  • blood_fury_1:14.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=400} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 4.7 10.5 67.5sec 19.2sec 75.58% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:28.90%
  • frothing_rage_2:25.08%
  • frothing_rage_3:21.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Golden Luster 3.0 0.0 120.4sec 120.4sec 19.55% 0.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_golden_luster
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Lustrous Golden Plumage

Stat Buff details

  • stat:versatility_rating
  • amount:828.62

Stack Uptimes

  • golden_luster_1:19.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271107
  • name:Golden Luster
  • tooltip:Versatility increased by $w1.
  • description:Increase your Versatility by {$s1=781} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Primal Instincts 3.0 0.0 121.0sec 120.8sec 19.46% 0.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_primal_instincts
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:2940.00

Stack Uptimes

  • primal_instincts_1:19.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279810
  • name:Primal Instincts
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc279806=Aspect of the Wild increases your Mastery by {$s1=0}, and grants you a charge of Barbed Shot.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spell details

  • id:279806
  • name:Primal Instincts
  • tooltip:
  • description:Aspect of the Wild increases your Mastery by {$s1=0}, and grants you a charge of Barbed Shot.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Quick Navigation 6.2 23.1 52.2sec 10.4sec 69.03% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.08%
  • quick_navigation_2:17.45%
  • quick_navigation_3:17.05%
  • quick_navigation_4:16.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.0sec 52.0sec 18.11% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
cat: Bestial Wrath 8.4 0.0 37.9sec 37.9sec 40.97% 0.00% 0.0(0.0) 8.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bestial_wrath_1:40.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:186254
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc19574=Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=15 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=12} sec each time you use Barbed Shot.][]}
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
cat: Frenzy 7.9 29.3 40.0sec 8.1sec 86.01% 0.00% 17.0(17.0) 7.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery_cat
  • cooldown name:buff_frenzy
  • max_stacks:3
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • frenzy_1:17.55%
  • frenzy_2:17.34%
  • frenzy_3:51.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:272790
  • name:Frenzy
  • tooltip:Attack speed increased by {$s1=30}%.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:3
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
starved: a_murder_of_crows 1.1 7.3sec
wild_call 6.5 39.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Aspect of the Wild1.2460.0014.1041.9820.0007.166
Barbed Shot1.0740.0016.1725.8160.00022.110
A Murder of Crows0.7690.0014.4042.7690.0008.384
Bestial Wrath1.1110.0015.0117.2711.39515.979
Chimaera Shot0.7280.0016.13811.7373.13128.364
Kill Command1.1210.0017.70537.15115.36163.338

Resources

Resource Usage Type Count Total Average RPE APR
T22_Hunter_Beast_Mastery
a_murder_of_crows Focus 5.5 163.7 30.0 30.0 2407.5
cobra_shot Focus 86.3 3020.6 35.0 35.0 154.9
kill_command Focus 55.3 1657.8 30.0 30.0 564.1
pet - cat
claw Focus 83.8 4192.1 50.0 50.0 220.5
Resource Gains Type Count Total Average Overflow
aspect_of_the_wild Focus 57.90 287.96 (6.03%) 4.97 1.56 0.54%
barbed_shot Focus 145.96 727.71 (15.25%) 4.99 2.07 0.28%
chimaera_shot_frost Focus 11.62 110.99 (2.33%) 9.55 5.18 4.46%
chimaera_shot_nature Focus 11.62 110.91 (2.32%) 9.55 5.25 4.52%
focus_regen Focus 763.96 3535.14 (74.07%) 4.63 37.62 1.05%
pet - cat
focus_regen Focus 547.68 3933.33 (94.48%) 7.18 536.68 12.01%
aspect_of_the_wild Focus 57.90 229.90 (5.52%) 3.97 59.62 20.59%
Resource RPS-Gain RPS-Loss
Focus 15.91 16.14
Combat End Resource Mean Min Max
Focus 50.34 0.01 120.00

Benefits & Uptimes

Benefits %
killer_instinct 33.0%
cat-wild_hunt 100.0%
Uptimes %
Focus Cap 0.6%
cat-Focus Cap 5.9%

Statistics & Data Analysis

Fight Length
Sample Data T22_Hunter_Beast_Mastery Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Hunter_Beast_Mastery Damage Per Second
Count 7499
Mean 16546.07
Minimum 14957.31
Maximum 18407.56
Spread ( max - min ) 3450.25
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 488.8375
5th Percentile 15790.69
95th Percentile 17384.74
( 95th Percentile - 5th Percentile ) 1594.04
Mean Distribution
Standard Deviation 5.6450
95.00% Confidence Intervall ( 16535.00 - 16557.13 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3354
0.1 Scale Factor Error with Delta=300 2040
0.05 Scale Factor Error with Delta=300 8160
0.01 Scale Factor Error with Delta=300 203992
Priority Target DPS
Sample Data T22_Hunter_Beast_Mastery Priority Target Damage Per Second
Count 7499
Mean 16546.07
Minimum 14957.31
Maximum 18407.56
Spread ( max - min ) 3450.25
Range [ ( max - min ) / 2 * 100% ] 10.43%
Standard Deviation 488.8375
5th Percentile 15790.69
95th Percentile 17384.74
( 95th Percentile - 5th Percentile ) 1594.04
Mean Distribution
Standard Deviation 5.6450
95.00% Confidence Intervall ( 16535.00 - 16557.13 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3354
0.1 Scale Factor Error with Delta=300 2040
0.05 Scale Factor Error with Delta=300 8160
0.01 Scale Factor Error with Delta=300 203992
DPS(e)
Sample Data T22_Hunter_Beast_Mastery Damage Per Second (Effective)
Count 7499
Mean 16546.07
Minimum 14957.31
Maximum 18407.56
Spread ( max - min ) 3450.25
Range [ ( max - min ) / 2 * 100% ] 10.43%
Damage
Sample Data T22_Hunter_Beast_Mastery Damage
Count 7499
Mean 2013660.73
Minimum 1447451.58
Maximum 2667433.80
Spread ( max - min ) 1219982.22
Range [ ( max - min ) / 2 * 100% ] 30.29%
DTPS
Sample Data T22_Hunter_Beast_Mastery Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Hunter_Beast_Mastery Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Hunter_Beast_Mastery Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Hunter_Beast_Mastery Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Hunter_Beast_Mastery Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Hunter_Beast_Mastery Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Hunter_Beast_MasteryTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Hunter_Beast_Mastery Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 summon_pet
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion
6 0.00 aspect_of_the_wild
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
0.00 counter_shot,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
8 2.99 use_items
0.00 berserking,if=cooldown.bestial_wrath.remains>30
9 2.97 blood_fury,if=cooldown.bestial_wrath.remains>30
0.00 ancestral_call,if=cooldown.bestial_wrath.remains>30
0.00 fireblood,if=cooldown.bestial_wrath.remains>30
0.00 lights_judgment
A 0.97 potion,if=buff.bestial_wrath.up&buff.aspect_of_the_wild.up
B 24.52 barbed_shot,if=pet.cat.buff.frenzy.up&pet.cat.buff.frenzy.remains<=gcd.max
C 5.46 a_murder_of_crows
0.00 spitting_cobra
0.00 stampede,if=buff.bestial_wrath.up|cooldown.bestial_wrath.remains<gcd|target.time_to_die<15
D 1.98 aspect_of_the_wild
E 8.40 bestial_wrath,if=!buff.bestial_wrath.up
0.00 multishot,if=spell_targets>2&(pet.cat.buff.beast_cleave.remains<gcd.max|pet.cat.buff.beast_cleave.down)
F 23.24 chimaera_shot
G 55.27 kill_command
0.00 dire_beast
H 12.63 barbed_shot,if=pet.cat.buff.frenzy.down&charges_fractional>1.4|full_recharge_time<gcd.max|target.time_to_die<9
0.00 multishot,if=spell_targets>1&(pet.cat.buff.beast_cleave.remains<gcd.max|pet.cat.buff.beast_cleave.down)
I 86.30 cobra_shot,if=(active_enemies<2|cooldown.kill_command.remains>focus.time_to_max)&(buff.bestial_wrath.up&active_enemies>1|cooldown.kill_command.remains>1+gcd&cooldown.bestial_wrath.remains>focus.time_to_max|focus-cost+focus.regen*(cooldown.kill_command.remains-1)>action.kill_command.cost)

Sample Sequence

01235678CE9FGHIIGHIIGIIFGBIIGIIGBFIGIGIHEFGIIGBIGIFBIGIIBGIFGCIGHIFGIBEIGIBIFGIBIGIBGFIIBGIIGIFGIEGH8C9DAFGHIIGIIBGIIFGBIIGIIBEGFIIGIGIHFGIIBGIGBFCIGBIGEBFIGIIBGIIGFIGIHGIFBGIIGIGEFHIG8I9CBDGIIFBGIIIGBIIGIFBEGIIGIIFGIHGIBGFIIGBIG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Hunter_Beast_Mastery 120.0/120: 100% focus
Pre precombat 1 augmentation T22_Hunter_Beast_Mastery 120.0/120: 100% focus
Pre precombat 2 food T22_Hunter_Beast_Mastery 120.0/120: 100% focus
Pre precombat 3 summon_pet Fluffy_Pillow 120.0/120: 100% focus
Pre precombat 5 potion Fluffy_Pillow 120.0/120: 100% focus battle_potion_of_agility
Pre precombat 6 aspect_of_the_wild Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_wild, primal_instincts, battle_potion_of_agility
0:00.000 default 7 start_auto_shot Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_wild, primal_instincts, battle_potion_of_agility
0:00.000 default 8 use_items Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_wild, primal_instincts, battle_potion_of_agility
0:00.000 default C a_murder_of_crows Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_wild, primal_instincts, battle_potion_of_agility, golden_luster
0:01.168 default E bestial_wrath Fluffy_Pillow 108.7/120: 91% focus bloodlust, aspect_of_the_wild, primal_instincts, frothing_rage, quick_navigation, battle_potion_of_agility, golden_luster
0:02.061 default 9 blood_fury Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, primal_instincts, frothing_rage, quick_navigation, battle_potion_of_agility, golden_luster
0:02.061 default F chimaera_shot Fluffy_Pillow 120.0/120: 100% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, primal_instincts, frothing_rage, quick_navigation, battle_potion_of_agility, golden_luster
0:02.952 default G kill_command Fluffy_Pillow 120.0/120: 100% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, primal_instincts, frothing_rage, quick_navigation, battle_potion_of_agility, golden_luster
0:03.845 default H barbed_shot Fluffy_Pillow 108.1/120: 90% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, primal_instincts, frothing_rage, quick_navigation, battle_potion_of_agility, golden_luster
0:04.737 default I cobra_shot Fluffy_Pillow 120.0/120: 100% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation, battle_potion_of_agility, golden_luster
0:05.630 default I cobra_shot Fluffy_Pillow 103.1/120: 86% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation, battle_potion_of_agility, golden_luster
0:06.524 default G kill_command Fluffy_Pillow 91.2/120: 76% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation, battle_potion_of_agility, golden_luster
0:07.417 default H barbed_shot Fluffy_Pillow 79.2/120: 66% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation, battle_potion_of_agility, golden_luster
0:08.309 default I cobra_shot Fluffy_Pillow 102.4/120: 85% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
0:09.197 default I cobra_shot Fluffy_Pillow 85.4/120: 71% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
0:10.083 default G kill_command Fluffy_Pillow 78.5/120: 65% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:10.964 default I cobra_shot Fluffy_Pillow 61.6/120: 51% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:11.845 default I cobra_shot Fluffy_Pillow 54.6/120: 46% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:12.724 default F chimaera_shot Fluffy_Pillow 37.7/120: 31% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(4), battle_potion_of_agility, golden_luster
0:13.599 default G kill_command Fluffy_Pillow 70.8/120: 59% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(4), battle_potion_of_agility, golden_luster
0:14.474 default B barbed_shot Fluffy_Pillow 58.9/120: 49% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(4), battle_potion_of_agility, golden_luster
0:15.348 default I cobra_shot Fluffy_Pillow 76.9/120: 64% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(4), battle_potion_of_agility, golden_luster
0:16.224 default I cobra_shot Fluffy_Pillow 65.0/120: 54% focus bloodlust, blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation(4), battle_potion_of_agility, golden_luster
0:17.101 default G kill_command Fluffy_Pillow 53.0/120: 44% focus bloodlust, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation(4), battle_potion_of_agility, golden_luster
0:17.976 default I cobra_shot Fluffy_Pillow 36.1/120: 30% focus bloodlust, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation(4), battle_potion_of_agility, golden_luster
0:18.851 Waiting     0.400 sec 24.2/120: 20% focus bloodlust, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(3), quick_navigation(4), battle_potion_of_agility, golden_luster
0:19.251 default I cobra_shot Fluffy_Pillow 35.1/120: 29% focus bloodlust, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(3), quick_navigation(4), battle_potion_of_agility, golden_luster
0:20.129 Waiting     0.500 sec 18.2/120: 15% focus bloodlust, barbed_shot_1, frothing_rage(3), quick_navigation(4), battle_potion_of_agility
0:20.629 default G kill_command Fluffy_Pillow 30.7/120: 26% focus bloodlust, barbed_shot_1, frothing_rage(3), quick_navigation(4), battle_potion_of_agility
0:21.641 default B barbed_shot Fluffy_Pillow 15.8/120: 13% focus bloodlust, barbed_shot_1, frothing_rage(3), quick_navigation(4), battle_potion_of_agility
0:22.650 default F chimaera_shot Fluffy_Pillow 35.8/120: 30% focus bloodlust, barbed_shot_2, frothing_rage(3), quick_navigation(4), battle_potion_of_agility
0:23.784 default I cobra_shot Fluffy_Pillow 67.8/120: 56% focus bloodlust, barbed_shot_2, frothing_rage(3), quick_navigation(4)
0:24.794 default G kill_command Fluffy_Pillow 47.8/120: 40% focus bloodlust, barbed_shot_2, frothing_rage(3), quick_navigation(4)
0:25.803 default I cobra_shot Fluffy_Pillow 37.9/120: 32% focus bloodlust, barbed_shot_2, frothing_rage(3), quick_navigation(4)
0:26.811 Waiting     1.800 sec 17.9/120: 15% focus bloodlust, barbed_shot_2, frothing_rage(3), quick_navigation(4)
0:28.611 default G kill_command Fluffy_Pillow 49.8/120: 41% focus bloodlust, barbed_shot_2, frothing_rage(3), quick_navigation(4)
0:29.769 default I cobra_shot Fluffy_Pillow 42.9/120: 36% focus bloodlust, frothing_rage(3), quick_navigation_final
0:30.730 default H barbed_shot Fluffy_Pillow 23.0/120: 19% focus bloodlust, quick_navigation_final
0:31.692 default E bestial_wrath Fluffy_Pillow 38.1/120: 32% focus bloodlust, barbed_shot_1, quick_navigation_final
0:32.652 default F chimaera_shot Fluffy_Pillow 53.2/120: 44% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final
0:33.614 default G kill_command Fluffy_Pillow 83.3/120: 69% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final
0:34.576 default I cobra_shot Fluffy_Pillow 68.4/120: 57% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final
0:35.537 Waiting     0.600 sec 53.4/120: 45% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final
0:36.137 default I cobra_shot Fluffy_Pillow 62.8/120: 52% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final
0:37.097 default G kill_command Fluffy_Pillow 47.9/120: 40% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final
0:38.059 default B barbed_shot Fluffy_Pillow 33.0/120: 27% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final
0:39.021 default I cobra_shot Fluffy_Pillow 52.6/120: 44% focus bloodlust, bestial_wrath, barbed_shot_2, frothing_rage
0:40.056 Waiting     0.900 sec 32.7/120: 27% focus bloodlust, bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation
0:40.956 default G kill_command Fluffy_Pillow 50.9/120: 42% focus bloodlust, bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation
0:42.497 default I cobra_shot Fluffy_Pillow 43.5/120: 36% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(2)
0:43.825 default F chimaera_shot Fluffy_Pillow 23.5/120: 20% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(2)
0:45.151 default B barbed_shot Fluffy_Pillow 53.5/120: 45% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(2)
0:46.479 default I cobra_shot Fluffy_Pillow 73.6/120: 61% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(2)
0:47.809 default G kill_command Fluffy_Pillow 58.6/120: 49% focus barbed_shot_1, frothing_rage, quick_navigation(2)
0:49.136 default I cobra_shot Fluffy_Pillow 43.7/120: 36% focus barbed_shot_1, frothing_rage(2), quick_navigation(2)
0:50.464 Waiting     0.600 sec 28.7/120: 24% focus barbed_shot_1, frothing_rage(2), quick_navigation(2)
0:51.064 default I cobra_shot Fluffy_Pillow 35.5/120: 30% focus barbed_shot_1, frothing_rage(2), quick_navigation(2)
0:52.392 default B barbed_shot Fluffy_Pillow 20.6/120: 17% focus barbed_shot_1, frothing_rage(2), quick_navigation(2)
0:53.721 default G kill_command Fluffy_Pillow 40.6/120: 34% focus barbed_shot_2, frothing_rage(2), quick_navigation(3)
0:55.041 Waiting     0.400 sec 30.7/120: 26% focus barbed_shot_2, frothing_rage(2), quick_navigation(3)
0:55.441 default I cobra_shot Fluffy_Pillow 35.3/120: 29% focus barbed_shot_2, frothing_rage(2), quick_navigation(3)
0:56.760 Waiting     0.100 sec 20.3/120: 17% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
0:56.860 default F chimaera_shot Fluffy_Pillow 21.4/120: 18% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
0:58.360 Waiting     0.700 sec 48.6/120: 40% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
0:59.060 default G kill_command Fluffy_Pillow 61.6/120: 51% focus barbed_shot_2, frothing_rage(3), quick_navigation(4)
1:00.600 default C a_murder_of_crows Fluffy_Pillow 54.3/120: 45% focus frothing_rage(3), quick_navigation(4)
1:01.910 default I cobra_shot Fluffy_Pillow 39.3/120: 33% focus frothing_rage(3), quick_navigation(4)
1:03.221 Waiting     1.300 sec 19.3/120: 16% focus frothing_rage(3), quick_navigation(4)
1:04.521 default G kill_command Fluffy_Pillow 34.8/120: 29% focus frothing_rage(3), quick_navigation_final
1:06.010 Waiting     0.200 sec 22.8/120: 19% focus frothing_rage(3), quick_navigation_final
1:06.210 default H barbed_shot Fluffy_Pillow 25.2/120: 21% focus frothing_rage(3), quick_navigation_final
1:07.458 default I cobra_shot Fluffy_Pillow 40.2/120: 34% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
1:08.705 Waiting     0.900 sec 25.3/120: 21% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
1:09.605 default F chimaera_shot Fluffy_Pillow 36.1/120: 30% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
1:11.045 default G kill_command Fluffy_Pillow 68.5/120: 57% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
1:12.294 default I cobra_shot Fluffy_Pillow 58.6/120: 49% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
1:13.541 default B barbed_shot Fluffy_Pillow 38.6/120: 32% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
1:14.789 default E bestial_wrath Fluffy_Pillow 57.7/120: 48% focus barbed_shot_2, frothing_rage(3), quick_navigation
1:16.125 default I cobra_shot Fluffy_Pillow 77.7/120: 65% focus bestial_wrath, barbed_shot_2, frothing_rage(3), quick_navigation
1:17.461 default G kill_command Fluffy_Pillow 57.7/120: 48% focus bestial_wrath, barbed_shot_2, frothing_rage(3), quick_navigation
1:18.797 default I cobra_shot Fluffy_Pillow 47.8/120: 40% focus bestial_wrath, barbed_shot_2, frothing_rage(3), quick_navigation
1:20.133 Waiting     0.100 sec 32.8/120: 27% focus bestial_wrath, barbed_shot_2, frothing_rage(3), quick_navigation
1:20.233 default B barbed_shot Fluffy_Pillow 33.9/120: 28% focus bestial_wrath, barbed_shot_2, frothing_rage(3), quick_navigation
1:21.580 Waiting     0.700 sec 54.1/120: 45% focus bestial_wrath, barbed_shot_1, frothing_rage(3), quick_navigation
1:22.280 default I cobra_shot Fluffy_Pillow 67.0/120: 56% focus bestial_wrath, barbed_shot_1, frothing_rage(3), quick_navigation(2)
1:23.606 default F chimaera_shot Fluffy_Pillow 47.1/120: 39% focus bestial_wrath, barbed_shot_1, frothing_rage(3), quick_navigation(2)
1:24.935 default G kill_command Fluffy_Pillow 77.1/120: 64% focus bestial_wrath, barbed_shot_1, frothing_rage(3), quick_navigation(2)
1:26.264 default I cobra_shot Fluffy_Pillow 67.3/120: 56% focus bestial_wrath, barbed_shot_1, frothing_rage(3), quick_navigation(3)
1:27.584 default B barbed_shot Fluffy_Pillow 47.3/120: 39% focus bestial_wrath, barbed_shot_1, frothing_rage(3), quick_navigation(3)
1:28.902 default I cobra_shot Fluffy_Pillow 67.4/120: 56% focus bestial_wrath, barbed_shot_2, frothing_rage(3), quick_navigation(3)
1:30.222 default G kill_command Fluffy_Pillow 52.4/120: 44% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
1:31.542 default I cobra_shot Fluffy_Pillow 37.5/120: 31% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
1:32.862 Waiting     1.500 sec 22.5/120: 19% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
1:34.362 default B barbed_shot Fluffy_Pillow 44.6/120: 37% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
1:35.681 default G kill_command Fluffy_Pillow 64.7/120: 54% focus barbed_shot_1, frothing_rage(3), quick_navigation(3)
1:37.117 default F chimaera_shot Fluffy_Pillow 56.0/120: 47% focus barbed_shot_1, frothing_rage(3), quick_navigation(3)
1:38.437 default I cobra_shot Fluffy_Pillow 86.1/120: 72% focus barbed_shot_1, quick_navigation(3)
1:39.755 default I cobra_shot Fluffy_Pillow 66.1/120: 55% focus barbed_shot_1, quick_navigation(3)
1:41.076 default B barbed_shot Fluffy_Pillow 51.3/120: 43% focus barbed_shot_1, frothing_rage, quick_navigation(4)
1:42.623 default G kill_command Fluffy_Pillow 74.0/120: 62% focus barbed_shot_2, frothing_rage, quick_navigation(4)
1:43.933 default I cobra_shot Fluffy_Pillow 64.1/120: 53% focus barbed_shot_2, frothing_rage, quick_navigation(4)
1:45.241 default I cobra_shot Fluffy_Pillow 44.1/120: 37% focus barbed_shot_2, frothing_rage, quick_navigation(4)
1:46.554 Waiting     0.400 sec 29.2/120: 24% focus barbed_shot_2, frothing_rage, quick_navigation(4)
1:46.954 default G kill_command Fluffy_Pillow 33.8/120: 28% focus barbed_shot_2, frothing_rage, quick_navigation(4)
1:48.467 Waiting     0.800 sec 26.1/120: 22% focus barbed_shot_2, frothing_rage, quick_navigation(4)
1:49.267 default I cobra_shot Fluffy_Pillow 35.3/120: 29% focus barbed_shot_2, frothing_rage, quick_navigation(4)
1:50.578 default F chimaera_shot Fluffy_Pillow 20.4/120: 17% focus frothing_rage, quick_navigation(4)
1:51.890 Waiting     0.600 sec 45.4/120: 38% focus frothing_rage, quick_navigation(4)
1:52.490 default G kill_command Fluffy_Pillow 52.3/120: 44% focus frothing_rage, quick_navigation(4)
1:54.001 default I cobra_shot Fluffy_Pillow 40.2/120: 33% focus frothing_rage, quick_navigation_final
1:55.248 Waiting     1.300 sec 20.2/120: 17% focus frothing_rage, quick_navigation_final
1:56.548 default E bestial_wrath Fluffy_Pillow 35.9/120: 30% focus frothing_rage, quick_navigation_final
1:58.036 default G kill_command Fluffy_Pillow 53.9/120: 45% focus bestial_wrath, frothing_rage, quick_navigation_final
1:59.282 default H barbed_shot Fluffy_Pillow 38.9/120: 32% focus bestial_wrath, frothing_rage, quick_navigation_final
2:00.530 default 8 use_items Fluffy_Pillow 53.9/120: 45% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final
2:00.530 default C a_murder_of_crows Fluffy_Pillow 53.9/120: 45% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final, golden_luster
2:01.847 default 9 blood_fury Fluffy_Pillow 44.8/120: 37% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final, golden_luster
2:02.061 default D aspect_of_the_wild Fluffy_Pillow 47.4/120: 40% focus blood_fury, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final, golden_luster
2:03.143 default A potion Fluffy_Pillow 65.5/120: 55% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage(2), golden_luster
2:03.143 default F chimaera_shot Fluffy_Pillow 65.5/120: 55% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:04.310 default G kill_command Fluffy_Pillow 98.5/120: 82% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:05.506 default H barbed_shot Fluffy_Pillow 91.9/120: 77% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:06.673 default I cobra_shot Fluffy_Pillow 109.9/120: 92% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:07.839 default I cobra_shot Fluffy_Pillow 103.0/120: 86% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:09.006 default G kill_command Fluffy_Pillow 86.0/120: 72% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:10.212 default I cobra_shot Fluffy_Pillow 84.5/120: 70% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:11.377 default I cobra_shot Fluffy_Pillow 67.5/120: 56% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:12.543 default B barbed_shot Fluffy_Pillow 55.6/120: 46% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:13.710 default G kill_command Fluffy_Pillow 78.6/120: 66% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), battle_potion_of_agility, golden_luster
2:14.919 default I cobra_shot Fluffy_Pillow 72.2/120: 60% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation, battle_potion_of_agility, golden_luster
2:16.077 default I cobra_shot Fluffy_Pillow 60.2/120: 50% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation, battle_potion_of_agility, golden_luster
2:17.236 default F chimaera_shot Fluffy_Pillow 48.3/120: 40% focus aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation, battle_potion_of_agility, golden_luster
2:18.394 default G kill_command Fluffy_Pillow 76.3/120: 64% focus aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation, battle_potion_of_agility, golden_luster
2:19.575 default B barbed_shot Fluffy_Pillow 69.6/120: 58% focus aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation, battle_potion_of_agility, golden_luster
2:20.734 default I cobra_shot Fluffy_Pillow 92.7/120: 77% focus aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(2), quick_navigation, battle_potion_of_agility
2:21.892 default I cobra_shot Fluffy_Pillow 80.7/120: 67% focus aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(2), quick_navigation, battle_potion_of_agility
2:23.053 default G kill_command Fluffy_Pillow 63.8/120: 53% focus barbed_shot_2, frothing_rage(2), quick_navigation, battle_potion_of_agility
2:24.416 default I cobra_shot Fluffy_Pillow 54.1/120: 45% focus barbed_shot_2, frothing_rage(2), quick_navigation, battle_potion_of_agility
2:25.752 default I cobra_shot Fluffy_Pillow 39.2/120: 33% focus barbed_shot_2, frothing_rage(2), quick_navigation, battle_potion_of_agility
2:27.089 default B barbed_shot Fluffy_Pillow 19.2/120: 16% focus barbed_shot_2, frothing_rage(2), quick_navigation, battle_potion_of_agility
2:28.425 default E bestial_wrath Fluffy_Pillow 39.3/120: 33% focus barbed_shot_1, frothing_rage(2), quick_navigation
2:29.761 default G kill_command Fluffy_Pillow 59.3/120: 49% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation
2:31.098 default F chimaera_shot Fluffy_Pillow 49.3/120: 41% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation
2:32.434 default I cobra_shot Fluffy_Pillow 74.5/120: 62% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation(2)
2:33.763 default I cobra_shot Fluffy_Pillow 59.5/120: 50% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation(2)
2:35.091 default G kill_command Fluffy_Pillow 44.6/120: 37% focus bestial_wrath, frothing_rage(2), quick_navigation(2)
2:36.418 Waiting     0.500 sec 29.7/120: 25% focus bestial_wrath, frothing_rage(2), quick_navigation(3)
2:36.918 default I cobra_shot Fluffy_Pillow 35.4/120: 29% focus bestial_wrath, frothing_rage(2), quick_navigation(3)
2:38.236 Waiting     2.200 sec 15.4/120: 13% focus bestial_wrath, frothing_rage(2), quick_navigation(3)
2:40.436 default G kill_command Fluffy_Pillow 40.5/120: 34% focus bestial_wrath, frothing_rage(3), quick_navigation(4)
2:41.982 Waiting     0.600 sec 28.2/120: 24% focus bestial_wrath, frothing_rage(3), quick_navigation(4)
2:42.582 default I cobra_shot Fluffy_Pillow 35.1/120: 29% focus bestial_wrath, frothing_rage(3), quick_navigation(4)
2:43.892 default H barbed_shot Fluffy_Pillow 15.1/120: 13% focus frothing_rage(3), quick_navigation(4)
2:45.205 default F chimaera_shot Fluffy_Pillow 30.2/120: 25% focus barbed_shot_1, frothing_rage(3), quick_navigation(4)
2:46.516 default G kill_command Fluffy_Pillow 61.0/120: 51% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
2:47.763 default I cobra_shot Fluffy_Pillow 46.1/120: 38% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
2:49.011 Waiting     0.400 sec 31.1/120: 26% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
2:49.411 default I cobra_shot Fluffy_Pillow 36.0/120: 30% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
2:50.658 default B barbed_shot Fluffy_Pillow 21.0/120: 18% focus barbed_shot_1, frothing_rage(3), quick_navigation_final
2:51.905 default G kill_command Fluffy_Pillow 41.1/120: 34% focus barbed_shot_2, frothing_rage(3), quick_navigation_final
2:53.151 Waiting     0.400 sec 31.1/120: 26% focus barbed_shot_2, frothing_rage(3), quick_navigation_final
2:53.551 default I cobra_shot Fluffy_Pillow 35.9/120: 30% focus barbed_shot_2, frothing_rage(3), quick_navigation_final
2:54.799 Waiting     2.300 sec 21.0/120: 17% focus barbed_shot_2, frothing_rage(3), quick_navigation_final
2:57.099 default G kill_command Fluffy_Pillow 52.1/120: 43% focus barbed_shot_2, frothing_rage(3)
2:58.616 default B barbed_shot Fluffy_Pillow 39.0/120: 33% focus barbed_shot_2
2:59.961 default F chimaera_shot Fluffy_Pillow 59.1/120: 49% focus barbed_shot_1
3:01.306 default C a_murder_of_crows Fluffy_Pillow 89.2/120: 74% focus barbed_shot_1, frothing_rage, quick_navigation
3:02.641 default I cobra_shot Fluffy_Pillow 79.2/120: 66% focus barbed_shot_1, frothing_rage, quick_navigation
3:03.978 default G kill_command Fluffy_Pillow 59.4/120: 49% focus barbed_shot_1, frothing_rage, quick_navigation(2)
3:05.305 default B barbed_shot Fluffy_Pillow 49.4/120: 41% focus barbed_shot_1, frothing_rage, quick_navigation(2)
3:06.632 default I cobra_shot Fluffy_Pillow 69.5/120: 58% focus barbed_shot_2, frothing_rage, quick_navigation(2)
3:07.959 Waiting     1.400 sec 54.5/120: 45% focus barbed_shot_2, frothing_rage, quick_navigation(2)
3:09.359 default G kill_command Fluffy_Pillow 75.4/120: 63% focus barbed_shot_2, frothing_rage, quick_navigation(2)
3:10.925 default E bestial_wrath Fluffy_Pillow 63.2/120: 53% focus barbed_shot_2, frothing_rage, quick_navigation(3)
3:12.246 default B barbed_shot Fluffy_Pillow 83.2/120: 69% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(3)
3:13.564 default F chimaera_shot Fluffy_Pillow 103.3/120: 86% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(4)
3:14.874 default I cobra_shot Fluffy_Pillow 120.0/120: 100% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(4)
3:16.185 default G kill_command Fluffy_Pillow 100.0/120: 83% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(4)
3:17.496 default I cobra_shot Fluffy_Pillow 90.1/120: 75% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(4)
3:18.806 default I cobra_shot Fluffy_Pillow 75.1/120: 63% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(4)
3:20.118 default B barbed_shot Fluffy_Pillow 55.2/120: 46% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(4)
3:21.429 default G kill_command Fluffy_Pillow 75.2/120: 63% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(4)
3:22.738 default I cobra_shot Fluffy_Pillow 65.3/120: 54% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(4)
3:24.049 default I cobra_shot Fluffy_Pillow 45.3/120: 38% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(4)
3:25.358 Waiting     0.400 sec 30.3/120: 25% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(4)
3:25.758 default G kill_command Fluffy_Pillow 34.9/120: 29% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(4)
3:27.274 default F chimaera_shot Fluffy_Pillow 27.3/120: 23% focus barbed_shot_2, frothing_rage, quick_navigation(4)
3:28.585 default I cobra_shot Fluffy_Pillow 57.4/120: 48% focus frothing_rage, quick_navigation(4)
3:29.893 Waiting     1.400 sec 37.4/120: 31% focus frothing_rage, quick_navigation(4)
3:31.293 default G kill_command Fluffy_Pillow 53.5/120: 45% focus frothing_rage, quick_navigation(4)
3:32.808 default I cobra_shot Fluffy_Pillow 40.8/120: 34% focus frothing_rage, quick_navigation(4)
3:34.119 default H barbed_shot Fluffy_Pillow 20.9/120: 17% focus frothing_rage, quick_navigation(4)
3:35.430 Waiting     1.400 sec 35.9/120: 30% focus barbed_shot_1, frothing_rage, quick_navigation(4)
3:36.830 default G kill_command Fluffy_Pillow 57.0/120: 48% focus barbed_shot_1, frothing_rage, quick_navigation(4)
3:38.342 default I cobra_shot Fluffy_Pillow 49.4/120: 41% focus barbed_shot_1, frothing_rage, quick_navigation(4)
3:39.654 Waiting     0.500 sec 29.4/120: 25% focus barbed_shot_1, frothing_rage, quick_navigation(4)
3:40.154 default F chimaera_shot Fluffy_Pillow 40.2/120: 33% focus barbed_shot_1, frothing_rage, quick_navigation(4)
3:41.581 default B barbed_shot Fluffy_Pillow 67.4/120: 56% focus barbed_shot_1, frothing_rage, quick_navigation_final
3:42.829 default G kill_command Fluffy_Pillow 87.4/120: 73% focus barbed_shot_2, frothing_rage, quick_navigation_final
3:44.076 default I cobra_shot Fluffy_Pillow 77.5/120: 65% focus barbed_shot_2, frothing_rage, quick_navigation_final
3:45.325 default I cobra_shot Fluffy_Pillow 57.5/120: 48% focus barbed_shot_2, frothing_rage, quick_navigation_final
3:46.572 Waiting     0.300 sec 42.6/120: 35% focus barbed_shot_2, quick_navigation_final
3:46.872 default G kill_command Fluffy_Pillow 46.2/120: 38% focus barbed_shot_2, quick_navigation_final
3:48.292 default I cobra_shot Fluffy_Pillow 38.3/120: 32% focus barbed_shot_2, quick_navigation_final
3:49.539 Waiting     2.700 sec 18.4/120: 15% focus barbed_shot_2, frothing_rage, quick_navigation_final
3:52.239 default G kill_command Fluffy_Pillow 54.2/120: 45% focus frothing_rage
3:53.766 default E bestial_wrath Fluffy_Pillow 41.2/120: 34% focus frothing_rage
3:55.111 default F chimaera_shot Fluffy_Pillow 56.3/120: 47% focus bestial_wrath, frothing_rage
3:56.458 default H barbed_shot Fluffy_Pillow 81.3/120: 68% focus bestial_wrath, frothing_rage(2)
3:57.803 default I cobra_shot Fluffy_Pillow 96.4/120: 80% focus bestial_wrath, barbed_shot_1, frothing_rage(2)
3:59.149 default G kill_command Fluffy_Pillow 81.4/120: 68% focus bestial_wrath, barbed_shot_1, frothing_rage(2)
4:00.493 default 8 use_items Fluffy_Pillow 71.5/120: 60% focus bestial_wrath, barbed_shot_1, frothing_rage(2)
4:00.493 default I cobra_shot Fluffy_Pillow 71.5/120: 60% focus bestial_wrath, barbed_shot_1, frothing_rage(2), golden_luster
4:01.840 default 9 blood_fury Fluffy_Pillow 51.5/120: 43% focus bestial_wrath, barbed_shot_1, frothing_rage(2), golden_luster
4:02.061 default C a_murder_of_crows Fluffy_Pillow 54.0/120: 45% focus blood_fury, bestial_wrath, barbed_shot_1, frothing_rage(2), golden_luster
4:03.408 default B barbed_shot Fluffy_Pillow 44.2/120: 37% focus blood_fury, bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation, golden_luster
4:04.744 default D aspect_of_the_wild Fluffy_Pillow 64.2/120: 54% focus blood_fury, bestial_wrath, barbed_shot_2, frothing_rage(2), quick_navigation, golden_luster
4:05.903 default G kill_command Fluffy_Pillow 87.3/120: 73% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage(2), quick_navigation, golden_luster
4:07.062 default I cobra_shot Fluffy_Pillow 75.3/120: 63% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage(2), quick_navigation, golden_luster
4:08.221 default I cobra_shot Fluffy_Pillow 63.4/120: 53% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage(3), quick_navigation, golden_luster
4:09.379 default F chimaera_shot Fluffy_Pillow 46.4/120: 39% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(3), quick_navigation, golden_luster
4:10.536 default B barbed_shot Fluffy_Pillow 79.4/120: 66% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(3), quick_navigation, golden_luster
4:11.693 default G kill_command Fluffy_Pillow 102.4/120: 85% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(3), quick_navigation, golden_luster
4:12.850 default I cobra_shot Fluffy_Pillow 100.5/120: 84% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(3), quick_navigation, golden_luster
4:14.007 default I cobra_shot Fluffy_Pillow 83.5/120: 70% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(3), quick_navigation, golden_luster
4:15.166 default I cobra_shot Fluffy_Pillow 71.5/120: 60% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(3), quick_navigation(2), golden_luster
4:16.317 default G kill_command Fluffy_Pillow 54.6/120: 45% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(3), quick_navigation(2), golden_luster
4:17.469 default B barbed_shot Fluffy_Pillow 47.6/120: 40% focus aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(3), quick_navigation(2), golden_luster
4:18.621 default I cobra_shot Fluffy_Pillow 70.7/120: 59% focus aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(3), quick_navigation(2), golden_luster
4:19.772 default I cobra_shot Fluffy_Pillow 63.7/120: 53% focus aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(3), quick_navigation(2), golden_luster
4:20.923 default G kill_command Fluffy_Pillow 46.8/120: 39% focus aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(3), quick_navigation(2)
4:22.089 default I cobra_shot Fluffy_Pillow 40.0/120: 33% focus aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(3), quick_navigation(2)
4:23.242 default F chimaera_shot Fluffy_Pillow 23.0/120: 19% focus aspect_of_the_wild, barbed_shot_2, primal_instincts, quick_navigation(2)
4:24.391 default B barbed_shot Fluffy_Pillow 56.1/120: 47% focus aspect_of_the_wild, barbed_shot_2, primal_instincts, quick_navigation(2)
4:25.543 default E bestial_wrath Fluffy_Pillow 79.1/120: 66% focus barbed_shot_1, quick_navigation(2)
4:26.871 default G kill_command Fluffy_Pillow 99.2/120: 83% focus bestial_wrath, barbed_shot_1, quick_navigation(2)
4:28.198 default I cobra_shot Fluffy_Pillow 84.2/120: 70% focus bestial_wrath, barbed_shot_1, quick_navigation(2)
4:29.524 default I cobra_shot Fluffy_Pillow 69.2/120: 58% focus bestial_wrath, barbed_shot_1, quick_navigation(2)
4:30.851 Waiting     0.400 sec 54.3/120: 45% focus bestial_wrath, barbed_shot_1, quick_navigation(2)
4:31.251 default G kill_command Fluffy_Pillow 58.8/120: 49% focus bestial_wrath, barbed_shot_1, quick_navigation(2)
4:32.818 default I cobra_shot Fluffy_Pillow 51.6/120: 43% focus bestial_wrath, quick_navigation(2)
4:34.144 Waiting     0.400 sec 31.6/120: 26% focus bestial_wrath, quick_navigation(2)
4:34.544 default I cobra_shot Fluffy_Pillow 36.1/120: 30% focus bestial_wrath, quick_navigation(2)
4:35.871 Waiting     0.400 sec 16.1/120: 13% focus bestial_wrath, quick_navigation(2)
4:36.271 default F chimaera_shot Fluffy_Pillow 20.7/120: 17% focus bestial_wrath, quick_navigation(2)
4:37.808 default G kill_command Fluffy_Pillow 48.1/120: 40% focus bestial_wrath, frothing_rage, quick_navigation(2)
4:39.135 Waiting     0.200 sec 33.2/120: 28% focus bestial_wrath, frothing_rage, quick_navigation(3)
4:39.335 default I cobra_shot Fluffy_Pillow 35.5/120: 30% focus bestial_wrath, frothing_rage, quick_navigation(3)
4:40.656 default H barbed_shot Fluffy_Pillow 15.6/120: 13% focus frothing_rage, quick_navigation(3)
4:41.975 Waiting     1.200 sec 30.6/120: 26% focus barbed_shot_1, frothing_rage, quick_navigation(3)
4:43.175 default G kill_command Fluffy_Pillow 49.3/120: 41% focus barbed_shot_1, frothing_rage, quick_navigation(3)
4:44.695 default I cobra_shot Fluffy_Pillow 41.7/120: 35% focus barbed_shot_1, frothing_rage, quick_navigation(4)
4:46.006 Waiting     1.400 sec 21.8/120: 18% focus barbed_shot_1, frothing_rage, quick_navigation(4)
4:47.406 default B barbed_shot Fluffy_Pillow 42.8/120: 36% focus barbed_shot_1, frothing_rage, quick_navigation(4)
4:48.717 default G kill_command Fluffy_Pillow 63.0/120: 53% focus barbed_shot_2, frothing_rage, quick_navigation_final
4:50.146 default F chimaera_shot Fluffy_Pillow 55.3/120: 46% focus barbed_shot_2, frothing_rage, quick_navigation_final
4:51.393 default I cobra_shot Fluffy_Pillow 80.3/120: 67% focus barbed_shot_2, frothing_rage, quick_navigation_final
4:52.639 default I cobra_shot Fluffy_Pillow 65.3/120: 54% focus barbed_shot_2, frothing_rage, quick_navigation_final
4:53.887 default G kill_command Fluffy_Pillow 50.4/120: 42% focus barbed_shot_2, frothing_rage, quick_navigation_final
4:55.135 default B barbed_shot Fluffy_Pillow 35.4/120: 30% focus barbed_shot_2, frothing_rage, quick_navigation_final
4:56.382 default I cobra_shot Fluffy_Pillow 55.5/120: 46% focus barbed_shot_1, frothing_rage, quick_navigation_final
4:57.629 Waiting     1.300 sec 40.5/120: 34% focus barbed_shot_1, frothing_rage, quick_navigation_final
4:58.929 default G kill_command Fluffy_Pillow 55.9/120: 47% focus barbed_shot_1, frothing_rage(2)

Stats

Level Bonus (120) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1467 3 1530 1470 0
Agility 1467 -3 6518 6100 4346 (3433)
Stamina 1001 1 9029 8209 7207
Intellect 1467 -1 1678 1466 0
Spirit 0 0 0 0 0
Health 180580 164180 0
Focus 120 120 0
Crit 25.04% 25.04% 1083
Haste 11.84% 11.84% 805
Damage / Heal Versatility 1.35% 1.35% 115
Attack Power 7170 6100 0
Mastery 41.65% 41.65% 1002
Armor 2738 2738 2738
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Crest of the Undying Visionary
ilevel: 390, stats: { 381 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Primal Instincts, Heed My Call, Vampiric Speed, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Cannoneer's Mantle
ilevel: 390, stats: { 352 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Primal Instincts, Azerite Globules, Gemhide, Azerite Empowered }
Local Chest Corrupted Hexxer's Vestments
ilevel: 390, stats: { 469 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Primal Instincts, Heed My Call, Longstrider, Azerite Empowered }
Local Waist Titanspark Energy Girdle
ilevel: 385, stats: { 255 Armor, +247 AgiInt, +417 Sta, +96 Haste, +88 Crit }
Local Legs Legguards of Coalescing Plasma
ilevel: 385, stats: { 397 Armor, +329 AgiInt, +556 Sta, +159 Crit, +86 Mastery }
Local Feet Fused Monstrosity Stompers
ilevel: 385, stats: { 312 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Wrists Rubywrought Sparkguards
ilevel: 385, stats: { 198 Armor, +185 AgiInt, +312 Sta, +78 Haste, +60 Mastery }
Local Hands Oblivion Crushers
ilevel: 385, stats: { 283 Armor, +247 AgiInt, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Haste }
Local Trinket1 Lustrous Golden Plumage
ilevel: 370, stats: { +271 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Plasma-Spattered Greatcloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +81 Mastery, +57 Crit }
Local Main Hand Bow of Virulent Infection
ilevel: 385, weapon: { 630 - 854, 3 }, stats: { +329 Agi, +556 Sta, +158 Crit, +87 Mastery }, enchant: quick_navigation

Talents

Level
15 Killer Instinct (Beast Mastery Hunter) Animal Companion (Beast Mastery Hunter) Dire Beast (Beast Mastery Hunter)
30 Scent of Blood (Beast Mastery Hunter) One with the Pack (Beast Mastery Hunter) Chimaera Shot (Beast Mastery Hunter)
45 Trailblazer Natural Mending Camouflage
60 Venomous Bite (Beast Mastery Hunter) Thrill of the Hunt (Beast Mastery Hunter) A Murder of Crows (Beast Mastery Hunter)
75 Born To Be Wild Posthaste Binding Shot
90 Stomp (Beast Mastery Hunter) Barrage (Beast Mastery Hunter) Stampede (Beast Mastery Hunter)
100 Aspect of the Beast (Beast Mastery Hunter) Killer Cobra (Beast Mastery Hunter) Spitting Cobra (Beast Mastery Hunter)

Profile

hunter="T22_Hunter_Beast_Mastery"
spec=beast_mastery
level=120
race=orc
role=attack
position=ranged_back
talents=1303011

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/aspect_of_the_wild

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
actions+=/use_items
actions+=/berserking,if=cooldown.bestial_wrath.remains>30
actions+=/blood_fury,if=cooldown.bestial_wrath.remains>30
actions+=/ancestral_call,if=cooldown.bestial_wrath.remains>30
actions+=/fireblood,if=cooldown.bestial_wrath.remains>30
actions+=/lights_judgment
actions+=/potion,if=buff.bestial_wrath.up&buff.aspect_of_the_wild.up
actions+=/barbed_shot,if=pet.cat.buff.frenzy.up&pet.cat.buff.frenzy.remains<=gcd.max
actions+=/a_murder_of_crows
actions+=/spitting_cobra
actions+=/stampede,if=buff.bestial_wrath.up|cooldown.bestial_wrath.remains<gcd|target.time_to_die<15
actions+=/aspect_of_the_wild
actions+=/bestial_wrath,if=!buff.bestial_wrath.up
actions+=/multishot,if=spell_targets>2&(pet.cat.buff.beast_cleave.remains<gcd.max|pet.cat.buff.beast_cleave.down)
actions+=/chimaera_shot
actions+=/kill_command
actions+=/dire_beast
actions+=/barbed_shot,if=pet.cat.buff.frenzy.down&charges_fractional>1.4|full_recharge_time<gcd.max|target.time_to_die<9
actions+=/multishot,if=spell_targets>1&(pet.cat.buff.beast_cleave.remains<gcd.max|pet.cat.buff.beast_cleave.down)
actions+=/cobra_shot,if=(active_enemies<2|cooldown.kill_command.remains>focus.time_to_max)&(buff.bestial_wrath.up&active_enemies>1|cooldown.kill_command.remains>1+gcd&cooldown.bestial_wrath.remains>focus.time_to_max|focus-cost+focus.regen*(cooldown.kill_command.remains-1)>action.kill_command.cost)

head=crest_of_the_undying_visionary,id=160630,bonus_id=4824/1507/4775,azerite_powers=3/366/22/44/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=cannoneers_mantle,id=159393,bonus_id=1557/4819/4775/4786,azerite_powers=3/366/462/85/13
back=plasmaspattered_greatcloak,id=160644,bonus_id=4800/1507
chest=corrupted_hexxers_vestments,id=159370,bonus_id=1557/4819/4775/4786,azerite_powers=3/366/22/14/13
wrists=rubywrought_sparkguards,id=160629,bonus_id=4800/1507
hands=oblivion_crushers,id=160721,bonus_id=4800/1507
waist=titanspark_energy_girdle,id=160633,bonus_id=4800/1507
legs=legguards_of_coalescing_plasma,id=160631,bonus_id=4800/1507
feet=fused_monstrosity_stompers,id=160628,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=lustrous_golden_plumage,id=159617,bonus_id=1542/4779
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=bow_of_virulent_infection,id=160678,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=385.27
# gear_agility=4346
# gear_stamina=7207
# gear_crit_rating=1083
# gear_haste_rating=805
# gear_mastery_rating=1002
# gear_versatility_rating=115
# gear_armor=2738

T22_Hunter_Marksmanship : 16089 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16089.0 16089.0 12.7 / 0.079% 2192.0 / 13.6% 2401.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.7 6.5 Focus 0.00% 41.0 100.0% 100%
Talents
  • 15: Serpent Sting (Marksmanship Hunter)
  • 30: Careful Aim (Marksmanship Hunter)
  • 60: Hunter's Mark (Marksmanship Hunter)
  • 90: Lethal Shots (Marksmanship Hunter)
  • 100: Lock and Load (Marksmanship Hunter)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Hunter_Marksmanship 16089
Aimed Shot 5584 34.7% 35.1 8.43sec 47634 25762 Direct 36.1 31254 62454 46378 48.5%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.11 36.06 0.00 0.00 1.8490 0.0000 1672187.41 2390592.72 30.05 25762.42 25762.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 51.53% 31253.72 19595 75793 31288.69 23524 42248 580662 830126 30.05
crit 17.48 48.47% 62454.14 39190 151586 62510.77 47238 84103 1091525 1560467 30.05
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:true
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<3
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${{$s1=0}*$<mult>} Physical damage. Damage increased by {$s2=50}% against a target you have not yet damaged. $?!s19434&c1[ Replaces Cobra Shot.][]
 
Arcane Shot 2898 18.0% 54.8 5.42sec 15842 13531 Direct 54.7 13552 27111 15869 17.1%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.80 54.70 0.00 0.00 1.1708 0.0000 868120.59 868120.59 0.00 13531.40 13531.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.36 82.91% 13552.16 6496 15815 13553.69 12623 14022 614672 614672 0.00
crit 9.35 17.09% 27110.62 12992 31629 27113.40 21037 30053 253449 253449 0.00
 
 

Action details: arcane_shot

Static Values
  • id:185358
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:70.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.precise_shots.up&(cooldown.aimed_shot.full_recharge_time<gcd*buff.precise_shots.stack+action.aimed_shot.cast_time|buff.lethal_shots.up)
Spelldata
  • id:185358
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:A quick shot that causes ${$sw2*$<mult>} Arcane damage.
 
Auto Shot 1646 10.2% 106.2 2.84sec 4645 2005 Direct 105.9 3975 7949 4654 17.1%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.16 105.94 0.00 0.00 2.3167 0.0000 493060.60 704889.34 30.05 2004.86 2004.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.83 82.91% 3974.88 3887 4354 3975.92 3935 4029 349117 499105 30.05
crit 18.11 17.09% 7949.35 7774 8708 7951.82 7774 8428 143944 205785 30.05
 
 

Action details: auto_shot

Static Values
  • id:75
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:60.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Frenetic Blow (frentic_blow) 283 1.8% 3.3 77.88sec 25931 0 Direct 3.3 22092 44185 25932 17.4%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.27 3.27 0.00 0.00 0.0000 0.0000 84784.63 121209.81 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.70 82.63% 22092.50 22092 22092 21703.62 0 22092 59684 85326 29.52
crit 0.57 17.37% 44184.99 44185 44185 20044.98 0 44185 25100 35884 13.63
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Heed My Call 448 (639) 2.8% (4.0%) 7.1 38.56sec 27072 0 Direct 7.1 16174 32348 18964 17.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 7.07 0.00 0.00 0.0000 0.0000 134142.30 134142.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.85 82.75% 16174.12 16174 16174 16167.65 0 16174 94672 94672 0.00
crit 1.22 17.25% 32348.24 32348 32348 23047.96 0 32348 39470 39470 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:13860.00
  • base_dd_max:13860.00
 
    Heed My Call (_aoe) 191 1.2% 7.1 38.56sec 8107 0 Direct 7.1 6932 13864 8107 17.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 7.07 0.00 0.00 0.0000 0.0000 57348.13 57348.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.87 83.04% 6931.77 6932 6932 6931.77 6932 6932 40715 40715 0.00
crit 1.20 16.96% 13863.53 13864 13864 9757.53 0 13864 16633 16633 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5940.00
  • base_dd_max:5940.00
 
Kul Tiran Cannonball Runner 278 1.7% 51.9 5.18sec 1604 0 Direct 51.9 1370 2740 1604 17.1%  

Stats details: kul_tiran_cannonball_runner

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.92 51.92 0.00 0.00 0.0000 0.0000 83284.85 83284.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.04 82.91% 1370.02 1370 1370 1370.02 1370 1370 58968 58968 0.00
crit 8.87 17.09% 2740.03 2740 2740 2738.20 0 2740 24317 24317 0.00
 
 

Action details: kul_tiran_cannonball_runner

Static Values
  • id:271197
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271197
  • name:Kul Tiran Cannonball Runner
  • school:fire
  • tooltip:
  • description:{$@spelldesc271190=Your attacks have a chance to deploy a cannon battery at your side for {$271194d=10 seconds}, dealing ${{$s1=676}*5} total Fire damage divided evenly among enemies in a cone in front of it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1174.41
  • base_dd_max:1174.41
 
Light's Judgment 0 (311) 0.0% (1.9%) 2.5 150.51sec 37749 29688

Stats details: lights_judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.49 0.00 0.00 0.00 1.2717 0.0000 0.00 0.00 0.00 29687.79 29687.79
 
 

Action details: lights_judgment

Static Values
  • id:255647
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:150.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:255647
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing $<damage> Holy damage to enemies within $A1 yards after 3 sec.
 
    Light's Judgment (_damage) 311 1.9% 2.5 150.52sec 38106 0 Direct 2.5 32609 65227 38106 16.9%  

Stats details: lights_judgment_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.47 2.47 0.00 0.00 0.0000 0.0000 93991.56 93991.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.05 83.15% 32609.36 30830 34469 32085.19 0 34469 66880 66880 0.00
crit 0.42 16.85% 65227.04 61660 68939 23701.60 0 68939 27111 27111 0.00
 
 

Action details: lights_judgment_damage

Static Values
  • id:256893
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:150.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:256893
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing $<damage> Holy damage to enemies within $A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rapid Fire 1657 10.3% 14.9 20.66sec 33231 12307 Periodic 148.4 2593 5175 3349 29.3% 12.2%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.95 0.00 148.84 148.36 2.7002 0.2459 496786.63 710216.14 30.05 12306.75 12306.75
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.9 70.72% 2592.52 2461 2996 2593.39 2519 2721 272012 388874 30.05
crit 43.4 29.28% 5175.15 4922 5992 5178.25 4980 5615 224774 321342 30.05
 
 

Action details: rapid_fire

Static Values
  • id:257044
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.lethal_shots.enabled|buff.lethal_shots.up)&azerite.focused_fire.enabled|azerite.in_the_rhythm.enabled
Spelldata
  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:Shoot a stream of {$s1=10} shots at your target over {$d=3 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. Each shot generates {$263585s1=1} Focus. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: rapid_fire_damage

Static Values
  • id:257045
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:Shoot a stream of arrows at your target every, dealing {$s1=0} damage every $t sec.
 
Serpent Sting 1217 7.6% 25.3 11.95sec 14440 12137 Direct 25.2 2134 4267 2498 17.1%  
Periodic 123.2 2093 4184 2449 17.1% 94.7%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.26 25.19 123.24 123.24 1.1898 2.3063 364791.90 364791.90 0.00 1160.70 12136.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.88 82.90% 2133.71 2030 2471 2134.26 2078 2195 44555 44555 0.00
crit 4.31 17.10% 4267.36 4060 4942 4233.19 0 4942 18375 18375 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.2 82.95% 2092.79 1 2471 2093.34 1998 2156 213931 213931 0.00
crit 21.0 17.05% 4183.90 2 4942 4185.20 3368 4507 87930 87930 0.00
 
 

Action details: serpent_sting

Static Values
  • id:271788
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:refreshable
Spelldata
  • id:271788
  • name:Serpent Sting
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Fire a shot that poisons your target, causing them to take {$s1=0} Nature damage instantly and an additional $o2 Nature damage over {$d=12 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.150000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Steady Shot 1576 9.8% 68.0 4.26sec 6952 4992 Direct 67.8 5951 11905 6964 17.0%  

Stats details: steady_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.95 67.84 0.00 0.00 1.3924 0.0000 472381.91 675326.67 30.05 4992.46 4992.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.30 82.99% 5950.79 5680 6914 5952.23 5846 6094 335009 478935 30.05
crit 11.54 17.01% 11904.66 11359 13828 11908.45 11388 12906 137373 196392 30.05
 
 

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:75.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus+cast_regen<focus.max|(talent.lethal_shots.enabled&buff.lethal_shots.down)
Spelldata
  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving. |cFFFFFFFFGenerates {$s2=10} Focus.
 
Simple Action Stats Execute Interval
T22_Hunter_Marksmanship
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Marksmanship
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Marksmanship
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Marksmanship
  • harmful:false
  • if_expr:
 
Hunter's Mark 1.0 0.00sec

Stats details: hunters_mark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: hunters_mark

Static Values
  • id:257284
  • school:nature
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:257284
  • name:Hunter's Mark
  • school:nature
  • tooltip:Damage taken from the Hunter increased by {$s1=5}%. Can always be seen and tracked by the Hunter.
  • description:Apply Hunter's Mark to the target, increasing all damage you deal to the marked target by {$s1=5}%. If the target dies while affected by Hunter's Mark, you instantly gain {$259558s1=20} Focus. The target can always be seen and tracked by the Hunter. Only one Hunter's Mark can be applied at a time.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.0 185.30sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.1128 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.aimed_shot.charges<1|talent.barrage.enabled&cooldown.aimed_shot.charges_fractional<1.3
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=30}% for {$d=15 seconds}.
  • description:Immediately gain {$s2=1} charge of Aimed Shot, and gain {$s1=30}% Haste for {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Potion of Agility 2.0 0.0 269.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 4.9 11.3 65.4sec 18.3sec 75.61% 0.00% 0.0(0.0) 0.8

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:28.26%
  • frothing_rage_2:25.06%
  • frothing_rage_3:22.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
In The Rhythm 14.9 0.0 20.7sec 20.7sec 39.01% 0.00% 0.0(0.0) 14.4

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_in_the_rhythm
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • in_the_rhythm_1:39.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:272733
  • name:In The Rhythm
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc264198=When Rapid Fire finishes fully channeling, your Haste is increased by {$s1=0} for {$272733d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spell details

  • id:264198
  • name:In The Rhythm
  • tooltip:
  • description:When Rapid Fire finishes fully channeling, your Haste is increased by {$s1=0} for {$272733d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lethal Shots 16.0 1.1 17.7sec 16.5sec 13.43% 19.23% 1.1(1.1) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_lethal_shots
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lethal_shots_1:13.43%

Trigger Attempt Success

  • trigger_pct:25.10%

Spelldata details

  • id:260395
  • name:Lethal Shots
  • tooltip:Your next Aimed Shot will have {$s1=100}% increased critical strike chance, or your next Rapid Fire will deal a critical strike with each shot.
  • description:{$@spelldesc260393=Steady Shot has a {$h=25}% chance to cause your next Aimed Shot or Rapid Fire to be guaranteed critical strikes.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:260393
  • name:Lethal Shots
  • tooltip:
  • description:Steady Shot has a {$h=25}% chance to cause your next Aimed Shot or Rapid Fire to be guaranteed critical strikes.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
Lock and Load 5.1 0.2 48.1sec 45.9sec 6.13% 14.10% 0.2(0.2) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lock_and_load_1:6.13%

Trigger Attempt Success

  • trigger_pct:4.98%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=5}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=5}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Masterful Navigation 6.2 23.1 52.1sec 10.4sec 69.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_masterful_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:50.00

Stack Uptimes

  • masterful_navigation_1:18.03%
  • masterful_navigation_2:17.51%
  • masterful_navigation_3:17.00%
  • masterful_navigation_4:16.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268899
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Masterful Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.09% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_masterful_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:600.00

Stack Uptimes

  • masterful_navigation_final_1:18.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268898
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Precise Shots 36.1 0.0 8.4sec 8.4sec 23.26% 98.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • precise_shots_1:16.78%
  • precise_shots_2:6.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of Arcane Shot or Multi-Shot increased by {$s1=100}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} Arcane Shots or Multi-Shots to deal {$260242s1=100}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.0 0.0 185.4sec 185.4sec 10.14% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • trueshot_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=30}% for {$d=15 seconds}.
  • description:Immediately gain {$s2=1} charge of Aimed Shot, and gain {$s1=30}% Haste for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
lethal_shots_aimed 13.7 20.5sec
lethal_shots_rapid_fire 2.2 73.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Aimed Shot1.8410.00112.1579.4600.00038.231
Trueshot5.6830.00188.8585.3820.00088.858
Rapid Fire0.7590.0015.3779.2013.17220.977

Resources

Resource Usage Type Count Total Average RPE APR
T22_Hunter_Marksmanship
aimed_shot Focus 36.1 932.9 25.8 26.6 1792.4
arcane_shot Focus 54.8 822.0 15.0 15.0 1056.1
serpent_sting Focus 25.3 252.6 10.0 10.0 1444.0
Resource Gains Type Count Total Average Overflow
rapid_fire_damage Focus 148.84 147.95 (7.57%) 0.99 0.89 0.60%
steady_shot Focus 67.95 678.44 (34.73%) 9.98 1.09 0.16%
focus_regen Focus 617.44 1127.25 (57.70%) 1.83 6.52 0.58%
Resource RPS-Gain RPS-Loss
Focus 6.51 6.69
Combat End Resource Mean Min Max
Focus 46.24 0.02 100.00

Benefits & Uptimes

Benefits %
careful_aim 22.2%
Uptimes %
Focus Cap 0.4%

Statistics & Data Analysis

Fight Length
Sample Data T22_Hunter_Marksmanship Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Hunter_Marksmanship Damage Per Second
Count 7499
Mean 16089.04
Minimum 14367.80
Maximum 18289.27
Spread ( max - min ) 3921.47
Range [ ( max - min ) / 2 * 100% ] 12.19%
Standard Deviation 562.7885
5th Percentile 15200.98
95th Percentile 17046.04
( 95th Percentile - 5th Percentile ) 1845.06
Mean Distribution
Standard Deviation 6.4990
95.00% Confidence Intervall ( 16076.30 - 16101.78 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4701
0.1 Scale Factor Error with Delta=300 2704
0.05 Scale Factor Error with Delta=300 10816
0.01 Scale Factor Error with Delta=300 270380
Priority Target DPS
Sample Data T22_Hunter_Marksmanship Priority Target Damage Per Second
Count 7499
Mean 16089.04
Minimum 14367.80
Maximum 18289.27
Spread ( max - min ) 3921.47
Range [ ( max - min ) / 2 * 100% ] 12.19%
Standard Deviation 562.7885
5th Percentile 15200.98
95th Percentile 17046.04
( 95th Percentile - 5th Percentile ) 1845.06
Mean Distribution
Standard Deviation 6.4990
95.00% Confidence Intervall ( 16076.30 - 16101.78 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4701
0.1 Scale Factor Error with Delta=300 2704
0.05 Scale Factor Error with Delta=300 10816
0.01 Scale Factor Error with Delta=300 270380
DPS(e)
Sample Data T22_Hunter_Marksmanship Damage Per Second (Effective)
Count 7499
Mean 16089.04
Minimum 14367.80
Maximum 18289.27
Spread ( max - min ) 3921.47
Range [ ( max - min ) / 2 * 100% ] 12.19%
Damage
Sample Data T22_Hunter_Marksmanship Damage
Count 7499
Mean 4820880.51
Minimum 3624455.66
Maximum 6184105.39
Spread ( max - min ) 2559649.73
Range [ ( max - min ) / 2 * 100% ] 26.55%
DTPS
Sample Data T22_Hunter_Marksmanship Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Hunter_Marksmanship Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Hunter_Marksmanship Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Hunter_Marksmanship Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Hunter_Marksmanship Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Hunter_Marksmanship Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Hunter_MarksmanshipTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Hunter_Marksmanship Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 hunters_mark
6 0.00 double_tap,precast_time=5
7 0.00 aimed_shot,if=active_enemies<3
8 0.00 explosive_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 auto_shot
0.00 counter_shot,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
0.00 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 hunters_mark,if=debuff.hunters_mark.down
0.00 double_tap,if=cooldown.rapid_fire.remains<gcd
0.00 berserking,if=cooldown.trueshot.remains>30
0.00 blood_fury,if=cooldown.trueshot.remains>30
0.00 ancestral_call,if=cooldown.trueshot.remains>30
0.00 fireblood,if=cooldown.trueshot.remains>30
D 2.49 lights_judgment
E 1.00 potion,if=(buff.trueshot.react&buff.bloodlust.react)|((consumable.prolonged_power&target.time_to_die<62)|target.time_to_die<31)
F 2.00 trueshot,if=cooldown.aimed_shot.charges<1|talent.barrage.enabled&cooldown.aimed_shot.charges_fractional<1.3
actions.st
# count action,conditions
0.00 explosive_shot
0.00 barrage,if=active_enemies>1
G 5.67 arcane_shot,if=buff.precise_shots.up&(cooldown.aimed_shot.full_recharge_time<gcd*buff.precise_shots.stack+action.aimed_shot.cast_time|buff.lethal_shots.up)
H 14.95 rapid_fire,if=(!talent.lethal_shots.enabled|buff.lethal_shots.up)&azerite.focused_fire.enabled|azerite.in_the_rhythm.enabled
I 27.34 aimed_shot,if=buff.precise_shots.down&(buff.double_tap.down&full_recharge_time<cast_time+gcd|buff.lethal_shots.up)
0.00 rapid_fire,if=!talent.lethal_shots.enabled|buff.lethal_shots.up
0.00 piercing_shot
0.00 a_murder_of_crows
J 25.26 serpent_sting,if=refreshable
K 7.96 aimed_shot,if=buff.precise_shots.down&(!talent.steady_focus.enabled&focus>70|!talent.lethal_shots.enabled|buff.lethal_shots.up)
L 49.13 arcane_shot,if=buff.precise_shots.up|focus>60&(!talent.lethal_shots.enabled|buff.lethal_shots.up)
M 68.27 steady_shot,if=focus+cast_regen<focus.max|(talent.lethal_shots.enabled&buff.lethal_shots.down)
0.00 arcane_shot

Sample Sequence

0124579DHJLLILLMMMIFGGIJJLMHILMMMMILLMIJLMLMMMHIJLMMKLMJILHLMMJMMKLMMKHJLMKLLMJMILMHILJGILMKLMJMMHKLMJMILMMILKHJLDLMILLJMILLHMJMILMMMIJLLHMMIJGILLMIFGHGJMMILMMMMIJLLHMIJLMMILLMJMHMILLJMMMILLMHEJILMGMIJMLMLHMIJLMM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Hunter_Marksmanship 100.0/100: 100% focus
Pre precombat 1 augmentation T22_Hunter_Marksmanship 100.0/100: 100% focus
Pre precombat 2 food T22_Hunter_Marksmanship 100.0/100: 100% focus
Pre precombat 4 potion Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
Pre precombat 5 hunters_mark Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
0:00.000 precombat 7 aimed_shot Fluffy_Pillow 70.0/100: 70% focus precise_shots(2), masterful_navigation, battle_potion_of_agility
0:00.000 default 9 start_auto_shot Fluffy_Pillow 70.0/100: 70% focus precise_shots(2), masterful_navigation, resounding_protection, battle_potion_of_agility
0:00.000 cds D lights_judgment Fluffy_Pillow 70.0/100: 70% focus precise_shots(2), masterful_navigation, resounding_protection, battle_potion_of_agility
0:01.318 st H rapid_fire Fluffy_Pillow 74.8/100: 75% focus bloodlust, precise_shots(2), masterful_navigation, resounding_protection, battle_potion_of_agility
0:03.568 st J serpent_sting Fluffy_Pillow 94.9/100: 95% focus bloodlust, precise_shots(2), in_the_rhythm, masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:04.512 st L arcane_shot Fluffy_Pillow 89.4/100: 89% focus bloodlust, precise_shots(2), in_the_rhythm, masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:05.456 st L arcane_shot Fluffy_Pillow 79.0/100: 79% focus bloodlust, precise_shots, in_the_rhythm, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:06.398 st I aimed_shot Fluffy_Pillow 68.5/100: 68% focus bloodlust, in_the_rhythm, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:07.967 st L arcane_shot Fluffy_Pillow 46.0/100: 46% focus bloodlust, precise_shots(2), in_the_rhythm, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:08.911 st L arcane_shot Fluffy_Pillow 35.5/100: 36% focus bloodlust, precise_shots, in_the_rhythm, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:09.856 st M steady_shot Fluffy_Pillow 25.0/100: 25% focus bloodlust, in_the_rhythm, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:10.957 st M steady_shot Fluffy_Pillow 40.3/100: 40% focus bloodlust, in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:12.058 st M steady_shot Fluffy_Pillow 55.3/100: 55% focus bloodlust, frothing_rage, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:13.243 st I aimed_shot Fluffy_Pillow 70.6/100: 71% focus bloodlust, lethal_shots, frothing_rage, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:14.935 cds F trueshot Fluffy_Pillow 48.1/100: 48% focus bloodlust, precise_shots(2), frothing_rage, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:15.952 st G arcane_shot Fluffy_Pillow 54.0/100: 54% focus bloodlust, precise_shots(2), trueshot, lock_and_load, frothing_rage, masterful_navigation(3), resounding_protection, battle_potion_of_agility
0:16.736 st G arcane_shot Fluffy_Pillow 43.5/100: 44% focus bloodlust, precise_shots, trueshot, lock_and_load, frothing_rage, masterful_navigation(4), resounding_protection, battle_potion_of_agility
0:17.517 st I aimed_shot Fluffy_Pillow 33.0/100: 33% focus bloodlust, trueshot, lock_and_load, frothing_rage, masterful_navigation(4), resounding_protection, battle_potion_of_agility
0:18.301 st J serpent_sting Fluffy_Pillow 37.6/100: 38% focus bloodlust, precise_shots, trueshot, frothing_rage, masterful_navigation(4), resounding_protection, battle_potion_of_agility
0:19.084 st J serpent_sting Fluffy_Pillow 32.1/100: 32% focus bloodlust, precise_shots, trueshot, frothing_rage, masterful_navigation(4), resounding_protection, battle_potion_of_agility
0:19.865 st L arcane_shot Fluffy_Pillow 26.6/100: 27% focus bloodlust, precise_shots, trueshot, frothing_rage(2), masterful_navigation(4), resounding_protection, battle_potion_of_agility
0:20.648 st M steady_shot Fluffy_Pillow 16.1/100: 16% focus bloodlust, trueshot, frothing_rage(2), masterful_navigation(4), resounding_protection, battle_potion_of_agility
0:21.560 st H rapid_fire Fluffy_Pillow 31.4/100: 31% focus bloodlust, trueshot, lethal_shots, frothing_rage(3), masterful_navigation(4), resounding_protection, battle_potion_of_agility
0:23.353 st I aimed_shot Fluffy_Pillow 51.9/100: 52% focus bloodlust, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
0:24.562 st L arcane_shot Fluffy_Pillow 29.4/100: 29% focus bloodlust, precise_shots, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:25.316 st M steady_shot Fluffy_Pillow 19.1/100: 19% focus bloodlust, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:26.162 st M steady_shot Fluffy_Pillow 34.4/100: 34% focus bloodlust, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:27.010 st M steady_shot Fluffy_Pillow 49.7/100: 50% focus bloodlust, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:27.857 st M steady_shot Fluffy_Pillow 64.9/100: 65% focus bloodlust, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:28.705 st I aimed_shot Fluffy_Pillow 80.2/100: 80% focus bloodlust, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:29.913 st L arcane_shot Fluffy_Pillow 57.7/100: 58% focus bloodlust, precise_shots(2), trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:30.670 st L arcane_shot Fluffy_Pillow 46.4/100: 46% focus bloodlust, precise_shots, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:31.613 st M steady_shot Fluffy_Pillow 35.7/100: 36% focus bloodlust, frothing_rage(3), masterful_navigation_final, resounding_protection
0:32.798 st I aimed_shot Fluffy_Pillow 51.0/100: 51% focus bloodlust, lethal_shots, frothing_rage(3), masterful_navigation_final, resounding_protection
0:34.488 st J serpent_sting Fluffy_Pillow 28.5/100: 29% focus bloodlust, precise_shots(2), frothing_rage(3), resounding_protection
0:35.503 st L arcane_shot Fluffy_Pillow 23.0/100: 23% focus bloodlust, precise_shots(2), frothing_rage(3), resounding_protection
0:36.521 st M steady_shot Fluffy_Pillow 12.5/100: 13% focus bloodlust, precise_shots, frothing_rage(3), resounding_protection
0:37.706 st L arcane_shot Fluffy_Pillow 27.8/100: 28% focus bloodlust, precise_shots, frothing_rage(3), resounding_protection
0:38.723 st M steady_shot Fluffy_Pillow 17.3/100: 17% focus bloodlust, frothing_rage(3), resounding_protection
0:39.907 st M steady_shot Fluffy_Pillow 32.6/100: 33% focus bloodlust, frothing_rage(3), resounding_protection
0:41.092 st M steady_shot Fluffy_Pillow 47.8/100: 48% focus frothing_rage(3), resounding_protection
0:42.631 st H rapid_fire Fluffy_Pillow 63.0/100: 63% focus lethal_shots, frothing_rage(3), resounding_protection
0:45.564 st I aimed_shot Fluffy_Pillow 83.1/100: 83% focus in_the_rhythm, frothing_rage(3), resounding_protection
0:47.604 st J serpent_sting Fluffy_Pillow 60.7/100: 61% focus precise_shots, in_the_rhythm, masterful_navigation, resounding_protection
0:48.831 st L arcane_shot Fluffy_Pillow 55.2/100: 55% focus precise_shots, in_the_rhythm, masterful_navigation, resounding_protection
0:50.058 st M steady_shot Fluffy_Pillow 44.7/100: 45% focus in_the_rhythm, masterful_navigation, resounding_protection
0:51.486 st M steady_shot Fluffy_Pillow 60.0/100: 60% focus in_the_rhythm, masterful_navigation, resounding_protection
0:52.915 st K aimed_shot Fluffy_Pillow 75.2/100: 75% focus in_the_rhythm, masterful_navigation, resounding_protection
0:54.954 st L arcane_shot Fluffy_Pillow 52.3/100: 52% focus precise_shots, masterful_navigation, resounding_protection
0:56.272 st M steady_shot Fluffy_Pillow 41.8/100: 42% focus masterful_navigation, resounding_protection
0:57.811 st J serpent_sting Fluffy_Pillow 57.1/100: 57% focus lethal_shots, masterful_navigation, resounding_protection
0:59.130 st I aimed_shot Fluffy_Pillow 51.6/100: 52% focus lethal_shots, masterful_navigation(2), resounding_protection
1:01.327 st L arcane_shot Fluffy_Pillow 29.1/100: 29% focus precise_shots(2), masterful_navigation(2), resounding_protection
1:02.646 st H rapid_fire Fluffy_Pillow 18.6/100: 19% focus precise_shots, masterful_navigation(2), resounding_protection
1:05.574 st L arcane_shot Fluffy_Pillow 38.7/100: 39% focus precise_shots, in_the_rhythm, masterful_navigation(2), resounding_protection
1:06.800 st M steady_shot Fluffy_Pillow 28.2/100: 28% focus in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
1:08.229 st M steady_shot Fluffy_Pillow 43.5/100: 43% focus in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:09.659 st J serpent_sting Fluffy_Pillow 58.7/100: 59% focus in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:10.886 st M steady_shot Fluffy_Pillow 53.3/100: 53% focus in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:12.315 st M steady_shot Fluffy_Pillow 68.5/100: 69% focus in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:13.745 st K aimed_shot Fluffy_Pillow 83.7/100: 84% focus frothing_rage, masterful_navigation(3), resounding_protection
1:15.941 st L arcane_shot Fluffy_Pillow 61.2/100: 61% focus precise_shots, frothing_rage, masterful_navigation(3), resounding_protection
1:17.260 st M steady_shot Fluffy_Pillow 50.7/100: 51% focus frothing_rage, masterful_navigation(3), resounding_protection
1:18.798 st M steady_shot Fluffy_Pillow 65.9/100: 66% focus frothing_rage, masterful_navigation(3), resounding_protection
1:20.337 st K aimed_shot Fluffy_Pillow 81.2/100: 81% focus frothing_rage, masterful_navigation(3), resounding_protection
1:22.534 st H rapid_fire Fluffy_Pillow 58.7/100: 59% focus precise_shots, frothing_rage, masterful_navigation(3), resounding_protection
1:25.574 st J serpent_sting Fluffy_Pillow 79.2/100: 79% focus precise_shots, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
1:26.799 st L arcane_shot Fluffy_Pillow 73.7/100: 74% focus precise_shots, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
1:28.024 st M steady_shot Fluffy_Pillow 63.2/100: 63% focus in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
1:29.453 st K aimed_shot Fluffy_Pillow 78.5/100: 78% focus in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
1:31.492 st L arcane_shot Fluffy_Pillow 56.0/100: 56% focus precise_shots(2), in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
1:32.719 st L arcane_shot Fluffy_Pillow 45.5/100: 46% focus precise_shots, in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
1:33.945 st M steady_shot Fluffy_Pillow 34.9/100: 35% focus frothing_rage(3), masterful_navigation(4), resounding_protection
1:35.484 st J serpent_sting Fluffy_Pillow 50.1/100: 50% focus frothing_rage(3), masterful_navigation(4), resounding_protection
1:36.804 st M steady_shot Fluffy_Pillow 44.6/100: 45% focus lock_and_load, frothing_rage(3), masterful_navigation_final, resounding_protection
1:38.342 st I aimed_shot Fluffy_Pillow 59.9/100: 60% focus lock_and_load, lethal_shots, frothing_rage(3), masterful_navigation_final, resounding_protection
1:39.663 st L arcane_shot Fluffy_Pillow 64.4/100: 64% focus precise_shots, frothing_rage(3), masterful_navigation_final, resounding_protection
1:40.983 st M steady_shot Fluffy_Pillow 53.9/100: 54% focus frothing_rage(3), masterful_navigation_final, resounding_protection
1:42.523 st H rapid_fire Fluffy_Pillow 69.2/100: 69% focus lock_and_load, frothing_rage(3), masterful_navigation_final, resounding_protection
1:45.469 st I aimed_shot Fluffy_Pillow 89.3/100: 89% focus lock_and_load, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
1:46.694 st L arcane_shot Fluffy_Pillow 93.8/100: 94% focus precise_shots(2), in_the_rhythm, frothing_rage(3), resounding_protection
1:47.918 st J serpent_sting Fluffy_Pillow 83.3/100: 83% focus precise_shots, in_the_rhythm, frothing_rage(3), resounding_protection
1:49.144 st G arcane_shot Fluffy_Pillow 77.9/100: 78% focus precise_shots, lock_and_load, in_the_rhythm, frothing_rage(3), resounding_protection
1:50.371 st I aimed_shot Fluffy_Pillow 67.4/100: 67% focus lock_and_load, in_the_rhythm, frothing_rage(3), resounding_protection
1:51.597 st L arcane_shot Fluffy_Pillow 71.9/100: 72% focus precise_shots, in_the_rhythm, frothing_rage(3), resounding_protection
1:52.823 st M steady_shot Fluffy_Pillow 61.4/100: 61% focus in_the_rhythm, frothing_rage(3), resounding_protection
1:54.253 st K aimed_shot Fluffy_Pillow 76.4/100: 76% focus frothing_rage(3), resounding_protection
1:56.452 st L arcane_shot Fluffy_Pillow 53.9/100: 54% focus precise_shots, frothing_rage(3), resounding_protection
1:57.772 st M steady_shot Fluffy_Pillow 43.4/100: 43% focus frothing_rage(3), resounding_protection
1:59.311 st J serpent_sting Fluffy_Pillow 58.7/100: 59% focus frothing_rage(3), resounding_protection
2:00.630 st M steady_shot Fluffy_Pillow 53.2/100: 53% focus frothing_rage(3), resounding_protection
2:02.169 st M steady_shot Fluffy_Pillow 68.5/100: 68% focus frothing_rage(3), masterful_navigation, resounding_protection
2:03.708 st H rapid_fire Fluffy_Pillow 83.7/100: 84% focus lethal_shots, frothing_rage(3), masterful_navigation, resounding_protection
2:06.402 st K aimed_shot Fluffy_Pillow 100.0/100: 100% focus in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection
2:08.440 st L arcane_shot Fluffy_Pillow 70.0/100: 70% focus precise_shots, in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection
2:09.665 st M steady_shot Fluffy_Pillow 59.5/100: 60% focus in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection
2:11.094 st J serpent_sting Fluffy_Pillow 74.8/100: 75% focus in_the_rhythm, frothing_rage(3), masterful_navigation(2), resounding_protection
2:12.319 st M steady_shot Fluffy_Pillow 69.3/100: 69% focus in_the_rhythm, masterful_navigation(2), resounding_protection
2:13.747 st I aimed_shot Fluffy_Pillow 84.6/100: 85% focus lethal_shots, in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
2:15.787 st L arcane_shot Fluffy_Pillow 61.7/100: 62% focus precise_shots, frothing_rage, masterful_navigation(2), resounding_protection
2:17.107 st M steady_shot Fluffy_Pillow 51.2/100: 51% focus frothing_rage, masterful_navigation(2), resounding_protection
2:18.647 st M steady_shot Fluffy_Pillow 66.5/100: 66% focus frothing_rage, masterful_navigation(2), resounding_protection
2:20.187 st I aimed_shot Fluffy_Pillow 81.7/100: 82% focus lock_and_load, lethal_shots, frothing_rage(2), masterful_navigation(2), resounding_protection
2:21.507 st L arcane_shot Fluffy_Pillow 86.2/100: 86% focus precise_shots, frothing_rage(2), masterful_navigation(2), resounding_protection
2:22.827 st K aimed_shot Fluffy_Pillow 75.8/100: 76% focus frothing_rage(2), masterful_navigation(2), resounding_protection
2:25.024 st H rapid_fire Fluffy_Pillow 53.3/100: 53% focus precise_shots(2), lock_and_load, frothing_rage(3), masterful_navigation(2), resounding_protection
2:27.757 st J serpent_sting Fluffy_Pillow 72.7/100: 73% focus precise_shots(2), lock_and_load, in_the_rhythm, frothing_rage(3), masterful_navigation(2), resounding_protection
2:28.983 st L arcane_shot Fluffy_Pillow 67.2/100: 67% focus precise_shots(2), lock_and_load, in_the_rhythm, frothing_rage(3), masterful_navigation(2), resounding_protection
2:30.208 cds D lights_judgment Fluffy_Pillow 56.7/100: 57% focus precise_shots, lock_and_load, in_the_rhythm, frothing_rage(3), masterful_navigation(3), resounding_protection
2:31.433 st L arcane_shot Fluffy_Pillow 61.2/100: 61% focus precise_shots, lock_and_load, in_the_rhythm, frothing_rage(3), masterful_navigation(3), resounding_protection
2:32.659 st M steady_shot Fluffy_Pillow 50.7/100: 51% focus lock_and_load, in_the_rhythm, frothing_rage(3), masterful_navigation(3), resounding_protection
2:34.087 st I aimed_shot Fluffy_Pillow 66.0/100: 66% focus lock_and_load, in_the_rhythm, frothing_rage(3), masterful_navigation(3), resounding_protection
2:35.312 st L arcane_shot Fluffy_Pillow 70.5/100: 70% focus precise_shots(2), in_the_rhythm, frothing_rage(3), masterful_navigation(3), resounding_protection
2:36.537 st L arcane_shot Fluffy_Pillow 59.8/100: 60% focus precise_shots, frothing_rage(3), masterful_navigation(3), resounding_protection
2:37.858 st J serpent_sting Fluffy_Pillow 49.3/100: 49% focus masterful_navigation(4), resounding_protection
2:39.175 st M steady_shot Fluffy_Pillow 43.8/100: 44% focus masterful_navigation(4), resounding_protection
2:40.715 st I aimed_shot Fluffy_Pillow 59.0/100: 59% focus lethal_shots, masterful_navigation(4), resounding_protection
2:42.914 st L arcane_shot Fluffy_Pillow 36.6/100: 37% focus precise_shots(2), masterful_navigation(4), resounding_protection
2:44.231 st L arcane_shot Fluffy_Pillow 26.1/100: 26% focus precise_shots, masterful_navigation(4), resounding_protection
2:45.550 st H rapid_fire Fluffy_Pillow 15.6/100: 16% focus masterful_navigation(4), resounding_protection
2:48.443 st M steady_shot Fluffy_Pillow 35.6/100: 36% focus in_the_rhythm, masterful_navigation_final, resounding_protection
2:49.873 st J serpent_sting Fluffy_Pillow 50.8/100: 51% focus in_the_rhythm, masterful_navigation_final, resounding_protection
2:51.098 st M steady_shot Fluffy_Pillow 45.3/100: 45% focus in_the_rhythm, masterful_navigation_final, resounding_protection
2:52.526 st I aimed_shot Fluffy_Pillow 60.6/100: 61% focus in_the_rhythm, masterful_navigation_final, resounding_protection
2:54.565 st L arcane_shot Fluffy_Pillow 38.1/100: 38% focus precise_shots, in_the_rhythm, masterful_navigation_final, resounding_protection
2:55.791 st M steady_shot Fluffy_Pillow 27.6/100: 28% focus in_the_rhythm, masterful_navigation_final, resounding_protection
2:57.221 st M steady_shot Fluffy_Pillow 42.6/100: 43% focus resounding_protection
2:58.758 st M steady_shot Fluffy_Pillow 57.9/100: 58% focus resounding_protection
3:00.298 st I aimed_shot Fluffy_Pillow 73.1/100: 73% focus lethal_shots, masterful_navigation, resounding_protection
3:02.497 st J serpent_sting Fluffy_Pillow 50.7/100: 51% focus precise_shots(2), masterful_navigation(2), resounding_protection
3:03.816 st L arcane_shot Fluffy_Pillow 45.2/100: 45% focus precise_shots(2), masterful_navigation(2), resounding_protection
3:05.134 st L arcane_shot Fluffy_Pillow 34.7/100: 35% focus precise_shots, masterful_navigation(2), resounding_protection
3:06.454 st H rapid_fire Fluffy_Pillow 24.2/100: 24% focus masterful_navigation(2), resounding_protection
3:09.338 st M steady_shot Fluffy_Pillow 44.1/100: 44% focus in_the_rhythm, masterful_navigation(2), resounding_protection
3:10.766 st M steady_shot Fluffy_Pillow 59.4/100: 59% focus in_the_rhythm, masterful_navigation(2), resounding_protection
3:12.194 st I aimed_shot Fluffy_Pillow 74.6/100: 75% focus in_the_rhythm, masterful_navigation(2), resounding_protection
3:14.231 st J serpent_sting Fluffy_Pillow 52.1/100: 52% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
3:15.456 st G arcane_shot Fluffy_Pillow 46.7/100: 47% focus precise_shots, lock_and_load, in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
3:16.682 st I aimed_shot Fluffy_Pillow 36.2/100: 36% focus lock_and_load, in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
3:17.908 st L arcane_shot Fluffy_Pillow 40.5/100: 40% focus precise_shots(2), frothing_rage, masterful_navigation(2), resounding_protection
3:19.229 st L arcane_shot Fluffy_Pillow 30.0/100: 30% focus precise_shots, frothing_rage(2), masterful_navigation(2), resounding_protection
3:20.547 st M steady_shot Fluffy_Pillow 19.5/100: 19% focus frothing_rage(2), masterful_navigation(2), resounding_protection
3:22.087 st I aimed_shot Fluffy_Pillow 34.8/100: 35% focus lethal_shots, frothing_rage(2), masterful_navigation(3), resounding_protection
3:24.285 cds F trueshot Fluffy_Pillow 12.3/100: 12% focus precise_shots(2), frothing_rage(2), masterful_navigation(3), resounding_protection
3:25.605 st G arcane_shot Fluffy_Pillow 18.1/100: 18% focus precise_shots(2), trueshot, frothing_rage(2), masterful_navigation(3), resounding_protection
3:26.621 st H rapid_fire Fluffy_Pillow 7.7/100: 8% focus precise_shots, trueshot, frothing_rage(2), masterful_navigation(3), resounding_protection
3:28.964 st G arcane_shot Fluffy_Pillow 28.2/100: 28% focus precise_shots, trueshot, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
3:29.908 st J serpent_sting Fluffy_Pillow 17.7/100: 18% focus trueshot, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
3:30.852 st M steady_shot Fluffy_Pillow 12.2/100: 12% focus trueshot, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
3:31.952 st M steady_shot Fluffy_Pillow 27.5/100: 28% focus trueshot, lethal_shots, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
3:33.052 st I aimed_shot Fluffy_Pillow 42.8/100: 43% focus trueshot, lethal_shots, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
3:34.621 st L arcane_shot Fluffy_Pillow 20.3/100: 20% focus precise_shots, trueshot, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
3:35.563 st M steady_shot Fluffy_Pillow 9.8/100: 10% focus trueshot, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
3:36.665 st M steady_shot Fluffy_Pillow 25.1/100: 25% focus trueshot, frothing_rage(2), masterful_navigation(3), resounding_protection
3:37.850 st M steady_shot Fluffy_Pillow 40.3/100: 40% focus trueshot, frothing_rage(2), masterful_navigation(3), resounding_protection
3:39.036 st M steady_shot Fluffy_Pillow 55.6/100: 56% focus trueshot, frothing_rage(2), masterful_navigation(3), resounding_protection
3:40.222 st I aimed_shot Fluffy_Pillow 69.9/100: 70% focus frothing_rage(2), masterful_navigation(4), resounding_protection
3:42.420 st J serpent_sting Fluffy_Pillow 47.4/100: 47% focus precise_shots(2), frothing_rage(2), masterful_navigation(4), resounding_protection
3:43.741 st L arcane_shot Fluffy_Pillow 41.9/100: 42% focus precise_shots(2), frothing_rage(2), masterful_navigation(4), resounding_protection
3:45.060 st L arcane_shot Fluffy_Pillow 31.5/100: 31% focus precise_shots, frothing_rage(2), masterful_navigation(4), resounding_protection
3:46.380 st H rapid_fire Fluffy_Pillow 21.0/100: 21% focus frothing_rage(3), masterful_navigation(4), resounding_protection
3:49.518 st M steady_shot Fluffy_Pillow 41.8/100: 42% focus in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
3:50.947 st I aimed_shot Fluffy_Pillow 57.0/100: 57% focus in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
3:52.986 st J serpent_sting Fluffy_Pillow 34.6/100: 35% focus precise_shots, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
3:54.211 st L arcane_shot Fluffy_Pillow 29.1/100: 29% focus precise_shots, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
3:55.437 st M steady_shot Fluffy_Pillow 18.6/100: 19% focus in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
3:56.865 st M steady_shot Fluffy_Pillow 33.8/100: 34% focus in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
3:58.294 st I aimed_shot Fluffy_Pillow 48.8/100: 49% focus lethal_shots, frothing_rage(3), masterful_navigation, resounding_protection
4:00.492 st L arcane_shot Fluffy_Pillow 26.3/100: 26% focus precise_shots(2), frothing_rage(3), masterful_navigation, resounding_protection
4:01.811 st L arcane_shot Fluffy_Pillow 15.9/100: 16% focus precise_shots, frothing_rage(3), masterful_navigation, resounding_protection
4:03.129 st M steady_shot Fluffy_Pillow 5.4/100: 5% focus frothing_rage(3), masterful_navigation, resounding_protection
4:04.668 st J serpent_sting Fluffy_Pillow 20.6/100: 21% focus frothing_rage(3), masterful_navigation, resounding_protection
4:05.988 st M steady_shot Fluffy_Pillow 15.1/100: 15% focus frothing_rage(3), masterful_navigation, resounding_protection
4:07.528 st H rapid_fire Fluffy_Pillow 30.4/100: 30% focus lethal_shots, frothing_rage(3), masterful_navigation, resounding_protection
4:10.284 st M steady_shot Fluffy_Pillow 49.9/100: 50% focus in_the_rhythm, frothing_rage(3), masterful_navigation(3), resounding_protection
4:11.711 st I aimed_shot Fluffy_Pillow 65.1/100: 65% focus in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
4:13.750 st L arcane_shot Fluffy_Pillow 42.6/100: 43% focus precise_shots(2), in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
4:14.976 st L arcane_shot Fluffy_Pillow 32.2/100: 32% focus precise_shots, in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
4:16.201 st J serpent_sting Fluffy_Pillow 21.7/100: 22% focus in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
4:17.428 st M steady_shot Fluffy_Pillow 16.2/100: 16% focus in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
4:18.855 st M steady_shot Fluffy_Pillow 31.3/100: 31% focus frothing_rage(3), masterful_navigation_final, resounding_protection
4:20.394 st M steady_shot Fluffy_Pillow 46.5/100: 47% focus frothing_rage(3), masterful_navigation_final, resounding_protection
4:21.934 st I aimed_shot Fluffy_Pillow 61.8/100: 62% focus lethal_shots, frothing_rage(3), masterful_navigation_final, resounding_protection
4:24.131 st L arcane_shot Fluffy_Pillow 39.3/100: 39% focus precise_shots(2), frothing_rage(3), masterful_navigation_final, resounding_protection
4:25.450 st L arcane_shot Fluffy_Pillow 28.8/100: 29% focus precise_shots, frothing_rage(3), resounding_protection
4:26.771 st M steady_shot Fluffy_Pillow 18.3/100: 18% focus frothing_rage(3), resounding_protection
4:28.311 st H rapid_fire Fluffy_Pillow 33.6/100: 34% focus lethal_shots, frothing_rage(3), resounding_protection
4:31.166 cds E potion Fluffy_Pillow 53.4/100: 53% focus in_the_rhythm, frothing_rage, resounding_protection
4:31.166 st J serpent_sting Fluffy_Pillow 53.4/100: 53% focus in_the_rhythm, frothing_rage, resounding_protection, battle_potion_of_agility
4:32.391 st I aimed_shot Fluffy_Pillow 47.9/100: 48% focus in_the_rhythm, frothing_rage, resounding_protection, battle_potion_of_agility
4:34.431 st L arcane_shot Fluffy_Pillow 25.5/100: 25% focus precise_shots(2), in_the_rhythm, frothing_rage, resounding_protection, battle_potion_of_agility
4:35.657 st M steady_shot Fluffy_Pillow 15.0/100: 15% focus precise_shots, in_the_rhythm, frothing_rage, resounding_protection, battle_potion_of_agility
4:37.085 st G arcane_shot Fluffy_Pillow 30.2/100: 30% focus precise_shots, lethal_shots, in_the_rhythm, frothing_rage, resounding_protection, battle_potion_of_agility
4:38.310 st M steady_shot Fluffy_Pillow 19.7/100: 20% focus lethal_shots, in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection, battle_potion_of_agility
4:39.740 st I aimed_shot Fluffy_Pillow 34.8/100: 35% focus lethal_shots, frothing_rage, masterful_navigation, resounding_protection, battle_potion_of_agility
4:41.937 st J serpent_sting Fluffy_Pillow 12.3/100: 12% focus precise_shots(2), frothing_rage(2), masterful_navigation, resounding_protection, battle_potion_of_agility
4:43.257 st M steady_shot Fluffy_Pillow 6.8/100: 7% focus precise_shots(2), frothing_rage(2), masterful_navigation, resounding_protection, battle_potion_of_agility
4:44.797 st L arcane_shot Fluffy_Pillow 22.1/100: 22% focus precise_shots(2), frothing_rage(2), masterful_navigation, resounding_protection, battle_potion_of_agility
4:46.116 st M steady_shot Fluffy_Pillow 11.6/100: 12% focus precise_shots, frothing_rage(2), masterful_navigation(2), resounding_protection, battle_potion_of_agility
4:47.655 st L arcane_shot Fluffy_Pillow 26.9/100: 27% focus precise_shots, frothing_rage(2), masterful_navigation(2), resounding_protection, battle_potion_of_agility
4:48.975 st H rapid_fire Fluffy_Pillow 16.4/100: 16% focus frothing_rage(2), masterful_navigation(2), resounding_protection, battle_potion_of_agility
4:51.781 st M steady_shot Fluffy_Pillow 36.0/100: 36% focus in_the_rhythm, frothing_rage(2), masterful_navigation(2), resounding_protection, battle_potion_of_agility
4:53.210 st I aimed_shot Fluffy_Pillow 51.3/100: 51% focus in_the_rhythm, frothing_rage(2), masterful_navigation(2), resounding_protection, battle_potion_of_agility
4:55.249 st J serpent_sting Fluffy_Pillow 28.8/100: 29% focus precise_shots, in_the_rhythm, frothing_rage(2), masterful_navigation(2), resounding_protection, battle_potion_of_agility
4:56.476 st L arcane_shot Fluffy_Pillow 23.3/100: 23% focus precise_shots, in_the_rhythm, frothing_rage(2), masterful_navigation(2), resounding_protection
4:57.700 st M steady_shot Fluffy_Pillow 12.8/100: 13% focus lock_and_load, in_the_rhythm, frothing_rage(2), masterful_navigation(2), resounding_protection
4:59.128 st M steady_shot Fluffy_Pillow 28.1/100: 28% focus lock_and_load, in_the_rhythm, frothing_rage(3), masterful_navigation(3), resounding_protection

Stats

Level Bonus (120) Race Bonus (lightforged_draenei) Raid-Buffed Unbuffed Gear Amount
Strength 1467 -2 1525 1465 0
Agility 1467 1 6522 6104 4346 (3433)
Stamina 1001 -1 9027 8207 7207
Intellect 1467 2 1681 1469 0
Spirit 0 0 0 0 0
Health 180540 164140 0
Focus 100 100 0
Crit 17.08% 17.08% 510
Haste 13.99% 13.99% 951
Damage / Heal Versatility 5.85% 5.85% 497
Attack Power 7174 6104 0
Mastery 14.09% 14.09% 1047
Armor 2738 2738 2738
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Soulscarred Headgear
ilevel: 390, stats: { 381 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { In The Rhythm, Heed My Call, Longstrider, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Crashguard Spaulders
ilevel: 390, stats: { 352 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Steady Aim, Heed My Call, Resounding Protection, Azerite Empowered }
Local Chest Chainvest of Assured Quality
ilevel: 390, stats: { 469 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Steady Aim, Heed My Call, Resounding Protection, Azerite Empowered }
Local Waist Cincture of Profane Deeds
ilevel: 385, stats: { 255 Armor, +247 AgiInt, +417 Sta, +104 Mastery, +80 Vers }
Local Legs Blighted Anima Greaves
ilevel: 385, stats: { 397 Armor, +329 AgiInt, +556 Sta, +149 Haste, +96 Vers }
Local Feet Fused Monstrosity Stompers
ilevel: 385, stats: { 312 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Wrists Rubywrought Sparkguards
ilevel: 385, stats: { 198 Armor, +185 AgiInt, +312 Sta, +78 Haste, +60 Mastery }
Local Hands Gloves of Involuntary Amputation
ilevel: 385, stats: { 283 Armor, +247 AgiInt, +417 Sta, +108 Vers, +76 Mastery }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Mastery }
Local Finger2 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Mastery }
Local Trinket1 Kul Tiran Cannonball Runner
ilevel: 370, stats: { +271 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Re-Origination Pulse Rifle
ilevel: 385, weapon: { 741 - 743, 3 }, stats: { +329 Agi, +556 Sta, +147 Haste, +98 Vers }, enchant: masterful_navigation

Talents

Level
15 Master Marksman (Marksmanship Hunter) Serpent Sting (Marksmanship Hunter) A Murder of Crows (Marksmanship Hunter)
30 Careful Aim (Marksmanship Hunter) Volley (Marksmanship Hunter) Explosive Shot (Marksmanship Hunter)
45 Trailblazer Natural Mending Camouflage
60 Steady Focus (Marksmanship Hunter) Streamline (Marksmanship Hunter) Hunter's Mark (Marksmanship Hunter)
75 Born To Be Wild Posthaste Binding Shot
90 Lethal Shots (Marksmanship Hunter) Barrage (Marksmanship Hunter) Double Tap (Marksmanship Hunter)
100 Calling the Shots (Marksmanship Hunter) Lock and Load (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter)

Profile

hunter="T22_Hunter_Marksmanship"
spec=marksmanship
level=120
race=lightforged_draenei
role=attack
position=ranged_back
talents=2103012

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/hunters_mark
actions.precombat+=/double_tap,precast_time=5
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/explosive_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=hunters_mark,if=debuff.hunters_mark.down
actions.cds+=/double_tap,if=cooldown.rapid_fire.remains<gcd
actions.cds+=/berserking,if=cooldown.trueshot.remains>30
actions.cds+=/blood_fury,if=cooldown.trueshot.remains>30
actions.cds+=/ancestral_call,if=cooldown.trueshot.remains>30
actions.cds+=/fireblood,if=cooldown.trueshot.remains>30
actions.cds+=/lights_judgment
actions.cds+=/potion,if=(buff.trueshot.react&buff.bloodlust.react)|((consumable.prolonged_power&target.time_to_die<62)|target.time_to_die<31)
actions.cds+=/trueshot,if=cooldown.aimed_shot.charges<1|talent.barrage.enabled&cooldown.aimed_shot.charges_fractional<1.3

actions.st=explosive_shot
actions.st+=/barrage,if=active_enemies>1
actions.st+=/arcane_shot,if=buff.precise_shots.up&(cooldown.aimed_shot.full_recharge_time<gcd*buff.precise_shots.stack+action.aimed_shot.cast_time|buff.lethal_shots.up)
actions.st+=/rapid_fire,if=(!talent.lethal_shots.enabled|buff.lethal_shots.up)&azerite.focused_fire.enabled|azerite.in_the_rhythm.enabled
actions.st+=/aimed_shot,if=buff.precise_shots.down&(buff.double_tap.down&full_recharge_time<cast_time+gcd|buff.lethal_shots.up)
actions.st+=/rapid_fire,if=!talent.lethal_shots.enabled|buff.lethal_shots.up
actions.st+=/piercing_shot
actions.st+=/a_murder_of_crows
actions.st+=/serpent_sting,if=refreshable
actions.st+=/aimed_shot,if=buff.precise_shots.down&(!talent.steady_focus.enabled&focus>70|!talent.lethal_shots.enabled|buff.lethal_shots.up)
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>60&(!talent.lethal_shots.enabled|buff.lethal_shots.up)
actions.st+=/steady_shot,if=focus+cast_regen<focus.max|(talent.lethal_shots.enabled&buff.lethal_shots.down)
actions.st+=/arcane_shot

actions.trickshots=barrage
actions.trickshots+=/explosive_shot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.up&!talent.barrage.enabled
actions.trickshots+=/aimed_shot,if=buff.trick_shots.up&buff.precise_shots.down&buff.double_tap.down&(!talent.lethal_shots.enabled|buff.lethal_shots.up|focus>60)
actions.trickshots+=/rapid_fire,if=buff.trick_shots.up
actions.trickshots+=/multishot,if=buff.trick_shots.down|(buff.precise_shots.up|buff.lethal_shots.up)&(!talent.barrage.enabled&buff.steady_focus.down&focus>45|focus>70)
actions.trickshots+=/piercing_shot
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/serpent_sting,if=refreshable
actions.trickshots+=/steady_shot,if=focus+cast_regen<focus.max|(talent.lethal_shots.enabled&buff.lethal_shots.down)

head=soulscarred_headgear,id=159398,bonus_id=1557/4819/4775/4786,azerite_powers=3/36/22/14/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=crashguard_spaulders,id=159360,bonus_id=1557/4819/4775/4786,azerite_powers=3/368/22/15/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=chainvest_of_assured_quality,id=160627,bonus_id=4824/1507/4775,azerite_powers=3/368/22/15/13
wrists=rubywrought_sparkguards,id=160629,bonus_id=4800/1507
hands=gloves_of_involuntary_amputation,id=160626,bonus_id=4800/1507
waist=cincture_of_profane_deeds,id=160724,bonus_id=4800/1507
legs=blighted_anima_greaves,id=160716,bonus_id=4800/1507
feet=fused_monstrosity_stompers,id=160628,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_mastery
finger2=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_mastery
trinket1=kul_tiran_cannonball_runner,id=159628,bonus_id=1542/4779
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=reorigination_pulse_rifle,id=160694,bonus_id=4800/1507,enchant=masterful_navigation

# Gear Summary
# gear_ilvl=385.27
# gear_agility=4346
# gear_stamina=7207
# gear_crit_rating=510
# gear_haste_rating=951
# gear_mastery_rating=1047
# gear_versatility_rating=497
# gear_armor=2738

T22_Hunter_Survival : 17471 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17471.0 17471.0 8.1 / 0.046% 1396.7 / 8.0% 1175.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
11.1 10.9 Focus 2.66% 53.3 100.0% 100%
Talents
  • 15: Viper's Venom (Survival Hunter)
  • 30: Guerrilla Tactics (Survival Hunter)
  • 60: Bloodseeker (Survival Hunter)
  • 90: Flanking Strike (Survival Hunter)
  • 100: Birds of Prey (Survival Hunter)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Hunter_Survival 17471
auto_attack_mh 2205 12.6% 122.2 2.45sec 5406 2207 Direct 122.2 4453 8907 5406 21.4%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.20 122.20 0.00 0.00 2.4496 0.0000 660650.36 944479.03 30.05 2207.12 2207.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.04 78.60% 4453.11 4025 5402 4455.99 4306 4597 427678 611417 30.05
crit 26.16 21.40% 8907.10 8049 10804 8913.12 8169 9981 232972 333062 30.05
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Azerite Globules 144 0.8% 14.8 20.01sec 2920 0 Direct 14.8 2405 4811 2920 21.4%  

Stats details: azerite_globules

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.83 14.83 0.00 0.00 0.0000 0.0000 43310.48 43310.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.66 78.60% 2405.39 2405 2405 2405.39 2405 2405 28042 28042 0.00
crit 3.17 21.40% 4810.78 4811 4811 4644.62 0 4811 15269 15269 0.00
 
 

Action details: azerite_globules

Static Values
  • id:279958
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279958
  • name:Azerite Globules
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2200.00
  • base_dd_max:2200.00
 
Flanking Strike 0 (477) 0.0% (2.7%) 7.7 41.47sec 18605 16565

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.68 0.00 0.00 0.00 1.1232 0.0000 0.00 0.00 0.00 16564.51 16564.51
 
 

Action details: flanking_strike

Static Values
  • id:269751
  • school:physical
  • resource:none
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269751
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:You and your pet leap to the target and strike it as one, dealing a total of $<damage> Physical damage. |cFFFFFFFFGenerates {$269752s2=30} Focus for you and your pet.|r
 
    Flanking Strike (_damage) 262 1.5% 0.0 0.00sec 0 0 Direct 7.7 8404 16805 10221 21.6%  

Stats details: flanking_strike_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.68 0.00 0.00 0.0000 0.0000 78455.65 112161.78 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.02 78.38% 8403.89 7422 9944 8411.62 7422 9944 50562 72285 30.05
crit 1.66 21.62% 16805.24 14843 19888 14111.58 0 19888 27893 39877 25.23
 
 

Action details: flanking_strike_damage

Static Values
  • id:269752
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269752
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc269751=You and your pet leap to the target and strike it as one, dealing a total of $<damage> Physical damage. |cFFFFFFFFGenerates {$269752s2=30} Focus for you and your pet.|r}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Flanking Strike (cat) 215 1.2% 7.7 41.47sec 8385 0 Direct 7.7 6914 13839 8385 21.2%  

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.68 7.68 0.00 0.00 0.0000 0.0000 64363.58 92015.47 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.05 78.76% 6914.03 6064 8314 6922.22 6064 8314 41803 59762 30.05
crit 1.63 21.24% 13838.92 12127 16629 11634.53 0 16629 22561 32253 25.22
 
 

Action details: flanking_strike

Static Values
  • id:259516
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:259516
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc269751=You and your pet leap to the target and strike it as one, dealing a total of $<damage> Physical damage. |cFFFFFFFFGenerates {$269752s2=30} Focus for you and your pet.|r}
 
Frenetic Blow (frentic_blow) 311 1.8% 3.7 72.07sec 25229 0 Direct 3.7 20699 41398 25228 21.9%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.70 3.70 0.00 0.00 0.0000 0.0000 93387.18 133508.19 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.89 78.11% 20699.04 20699 20699 20411.97 0 20699 59850 85563 29.63
crit 0.81 21.89% 41398.07 41398 41398 24174.18 0 41398 33537 47945 17.55
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Kill Command 0 (1741) 0.0% (10.0%) 77.8 3.80sec 6704 5952

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.80 0.00 0.00 0.00 1.1264 0.0000 0.00 0.00 0.00 5951.75 5951.75
 
 

Action details: kill_command

Static Values
  • id:259489
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3&active_enemies<2
Spelldata
  • id:259489
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to the enemy.{$?s263186=true}[ Has a {$s2=25}% chance to immediately reset its cooldown.][] |cFFFFFFFFGenerates {$s3=15} Focus.|r
 
    Kill Command (cat) 1741 10.0% 77.8 3.80sec 6704 0 Direct 77.8 3471 6941 4212 21.3%  
Periodic 195.0 819 1638 994 21.4% 97.7%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.80 77.80 195.03 195.03 0.0000 1.5027 521617.75 662405.47 21.25 1779.87 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.19 78.65% 3470.94 3109 4264 3473.32 3321 3629 212400 303652 30.05
crit 16.61 21.35% 6941.43 6219 8527 6946.18 6219 8261 115303 164839 30.05
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.2 78.57% 818.83 0 1016 819.36 793 843 125470 125470 0.00
crit 41.8 21.43% 1637.64 5 2032 1638.70 1490 1791 68444 68444 0.00
 
 

Action details: kill_command

Static Values
  • id:259277
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:259277
  • name:Kill Command
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:{$@spelldesc259489=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to the enemy.{$?s263186=true}[ Has a {$s2=25}% chance to immediately reset its cooldown.][] |cFFFFFFFFGenerates {$s3=15} Focus.|r}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Raptor Strike 3765 21.6% 98.1 3.03sec 11505 10217 Direct 98.1 9469 18942 11505 21.5%  

Stats details: raptor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.07 98.07 0.00 0.00 1.1260 0.0000 1128313.53 1613059.69 30.05 10217.27 10217.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.00 78.51% 9469.03 8604 11420 9474.75 9144 9808 729075 1042301 30.05
crit 21.08 21.49% 18942.12 17209 22839 18954.39 17209 21102 399238 570759 30.05
 
 

Action details: raptor_strike

Static Values
  • id:186270
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:186270
  • name:Raptor Strike
  • school:physical
  • tooltip:
  • description:A vicious slash dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Serpent Sting 2623 (4099) 15.0% (23.5%) 41.4 7.29sec 29668 26459 Direct 41.4 6046 12070 7345 21.6%  
Periodic 133.3 2979 5961 3615 21.3% 97.5%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.40 41.39 133.31 133.31 1.1213 2.1949 785911.40 785911.40 0.00 3623.35 26459.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.46 78.43% 6045.64 2318 10873 6038.93 4364 7879 196258 196258 0.00
crit 8.93 21.57% 12070.20 4637 21745 12055.97 4637 21745 107791 107791 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.9 78.69% 2979.21 1 3633 2981.14 2865 3075 312500 312500 0.00
crit 28.4 21.31% 5960.70 3 7265 5963.94 5294 6687 169363 169363 0.00
 
 

Action details: serpent_sting

Static Values
  • id:259491
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:60.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(active_enemies<2&refreshable&(buff.mongoose_fury.down|(variable.can_gcd&!talent.vipers_venom.enabled)))|buff.vipers_venom.up
Spelldata
  • id:259491
  • name:Serpent Sting
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.$?a265428[ The Hunter's pet deals $w3% increased damage to you.][]
  • description:Fire a poison-tipped arrow at an enemy, dealing {$s1=0} Nature damage instantly and an additional $o2 damage over {$d=12 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.237510
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Latent Poison 1476 8.5% 87.6 3.40sec 5051 0 Direct 87.6 4160 8330 5051 21.4%  

Stats details: latent_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.61 87.61 0.00 0.00 0.0000 0.0000 442485.32 442485.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.88 78.63% 4159.66 2100 18900 4164.03 3559 4859 286535 286535 0.00
crit 18.72 21.37% 8329.61 4200 33600 8336.95 5133 12600 155951 155951 0.00
 
 

Action details: latent_poison

Static Values
  • id:273289
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:273289
  • name:Latent Poison
  • school:nature
  • tooltip:
  • description:{$@spelldesc273283=Serpent Sting damage applies Latent Poison, stacking up to {$273286u=10} times. Your {$?s259387=true}[Mongoose Bite][Raptor Strike] consumes all applications of Latent Poison to deal {$s1=501} Nature damage per stack.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6300.00
  • base_dd_max:6300.00
 
Wildfire Bomb 0 (2255) 0.0% (12.9%) 30.9 9.77sec 21830 19666

Stats details: wildfire_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.93 0.00 0.00 0.00 1.1100 0.0000 0.00 0.00 0.00 19666.01 19666.01
 
 

Action details: wildfire_bomb

Static Values
  • id:259495
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:18.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(focus+cast_regen<focus.max|active_enemies>1)&(dot.wildfire_bomb.refreshable&buff.mongoose_fury.down|full_recharge_time<gcd)
Spelldata
  • id:259495
  • name:Wildfire Bomb
  • school:physical
  • tooltip:
  • description:Hurl a bomb at the target, exploding for {$265157s1=0} Fire damage in a cone and coating enemies in wildfire, scorching them for $269747o1 Fire damage over {$269747d=6 seconds}.
 
    Wildfire Bomb (_impact) 1143 6.5% 0.0 0.00sec 0 0 Direct 30.9 9116 18235 11068 21.4%  

Stats details: wildfire_bomb_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 30.92 0.00 0.00 0.0000 0.0000 342218.64 342218.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.30 78.59% 9116.02 8162 10936 9122.23 8455 9817 221526 221526 0.00
crit 6.62 21.41% 18234.63 16323 21871 18239.25 0 21871 120693 120693 0.00
 
 

Action details: wildfire_bomb_impact

Static Values
  • id:265157
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:265157
  • name:Wildfire Bomb
  • school:fire
  • tooltip:
  • description:{$@spelldesc259495=Hurl a bomb at the target, exploding for {$265157s1=0} Fire damage in a cone and coating enemies in wildfire, scorching them for $269747o1 Fire damage over {$269747d=6 seconds}.}
 
    Wildfire Bomb (_dot) 1112 6.4% 0.0 0.00sec 0 0 Periodic 181.9 1508 3016 1831 21.4% 60.6%

Stats details: wildfire_bomb_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 181.91 181.91 0.0000 1.0000 333013.87 333013.87 0.00 1830.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.0 78.63% 1508.39 1360 1823 1509.38 1459 1550 215747 215747 0.00
crit 38.9 21.37% 3015.85 2721 3645 3017.62 2811 3271 117267 117267 0.00
 
 

Action details: wildfire_bomb_dot

Static Values
  • id:269747
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269747
  • name:Wildfire Bomb
  • school:fire
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc259495=Hurl a bomb at the target, exploding for {$265157s1=0} Fire damage in a cone and coating enemies in wildfire, scorching them for $269747o1 Fire damage over {$269747d=6 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.150000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - cat 4431 / 4431
Claw 1098 6.3% 83.7 3.60sec 3928 3910 Direct 83.7 3232 6472 3928 21.5%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.72 83.72 0.00 0.00 1.0045 0.0000 328821.19 470089.39 30.05 3910.26 3910.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.73 78.51% 3231.55 2174 5963 3236.41 2866 3607 212400 303651 30.05
crit 17.99 21.49% 6471.86 4349 11926 6479.83 4465 8854 116421 166438 30.05
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 1377 7.9% 242.1 1.24sec 1704 1378 Direct 242.1 1404 2807 1704 21.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 242.12 242.12 0.00 0.00 1.2372 0.0000 412687.88 589986.88 30.05 1377.72 1377.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 190.25 78.58% 1403.82 1269 1700 1404.73 1367 1445 267073 381812 30.05
crit 51.87 21.42% 2807.25 2537 3400 2808.97 2637 2997 145615 208175 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
T22_Hunter_Survival
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Survival
  • harmful:false
  • if_expr:
 
Coordinated Assault 3.0 120.35sec

Stats details: coordinated_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 1.1139 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: coordinated_assault

Static Values
  • id:266779
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:266779
  • name:Coordinated Assault
  • school:physical
  • tooltip:Damage dealt increased by {$s1=20}%.{$?s263186=true}[ Kill Command's chance to reset increased by {$s4=25}%.][]
  • description:You and your pet attack as one, increasing all damage you both deal by {$s1=20}% for {$d=20 seconds}.{$?s263186=true}[ While Coordinated Assault is active, Kill Command's chance to reset is increased by {$s4=25}%.][]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Survival
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Survival
  • harmful:false
  • if_expr:
 
Harpoon 1.0 0.00sec

Stats details: harpoon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: harpoon

Static Values
  • id:190925
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:70.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190925
  • name:Harpoon
  • school:physical
  • tooltip:
  • description:Hurls a harpoon at an enemy, rooting them in place for {$190927d=3 seconds} and pulling you to them.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Potion of Agility 2.0 0.0 121.5sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:200.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Coordinated Assault 3.0 0.0 120.4sec 120.4sec 38.21% 0.00% 0.0(0.0) 2.7

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_coordinated_assault
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • coordinated_assault_1:38.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:266779
  • name:Coordinated Assault
  • tooltip:Damage dealt increased by {$s1=20}%.{$?s263186=true}[ Kill Command's chance to reset increased by {$s4=25}%.][]
  • description:You and your pet attack as one, increasing all damage you both deal by {$s1=20}% for {$d=20 seconds}.{$?s263186=true}[ While Coordinated Assault is active, Kill Command's chance to reset is increased by {$s4=25}%.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 5.0 12.4 64.1sec 17.1sec 75.95% 0.00% 0.0(0.0) 0.5

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:27.51%
  • frothing_rage_2:25.29%
  • frothing_rage_3:23.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Galecaller's Boon 5.5 0.0 60.4sec 60.4sec 18.01% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_galecallers_boon
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Galecaller's Boon

Stat Buff details

  • stat:haste_rating
  • amount:1239.29
  • stat:speed_rating
  • amount:1239.29

Stack Uptimes

  • galecallers_boon_1:18.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268311
  • name:Galecaller's Boon
  • tooltip:Haste increased by $w1. Speed increased by $w2.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 5.0 0.0 59.5sec 36.9sec 38.14% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.50%
  • overwhelming_power_2:1.50%
  • overwhelming_power_3:1.51%
  • overwhelming_power_4:1.51%
  • overwhelming_power_5:1.51%
  • overwhelming_power_6:1.52%
  • overwhelming_power_7:1.53%
  • overwhelming_power_8:1.53%
  • overwhelming_power_9:1.53%
  • overwhelming_power_10:1.54%
  • overwhelming_power_11:1.54%
  • overwhelming_power_12:1.55%
  • overwhelming_power_13:1.55%
  • overwhelming_power_14:1.56%
  • overwhelming_power_15:1.56%
  • overwhelming_power_16:1.57%
  • overwhelming_power_17:1.57%
  • overwhelming_power_18:1.58%
  • overwhelming_power_19:1.58%
  • overwhelming_power_20:1.59%
  • overwhelming_power_21:1.59%
  • overwhelming_power_22:1.60%
  • overwhelming_power_23:1.61%
  • overwhelming_power_24:1.64%
  • overwhelming_power_25:0.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Predator 1.0 0.0 0.0sec 0.0sec 99.66% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_predator
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • predator_1:99.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:260249
  • name:Predator
  • tooltip:Attack speed increased by {$s1=10}%.
  • description:{$@spelldesc260248=Kill Command causes the target to bleed for ${$RAP*({$s1=10}/100)*({$259277d=8 seconds}/$259277t2)} damage over {$259277d=8 seconds}. You and your pet gain {$260249s1=10}% attack speed for every bleeding enemy within {$s2=12} yds.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation 6.2 23.1 52.1sec 10.3sec 68.72% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.78%
  • quick_navigation_2:17.50%
  • quick_navigation_3:16.93%
  • quick_navigation_4:16.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.03% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Viper's Venom 22.5 0.0 13.3sec 13.3sec 14.11% 53.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_vipers_venom
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:2.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

RPPM Buff details

  • scaling:haste
  • frequency:3.00
  • modifier:1.00

Stack Uptimes

  • vipers_venom_1:14.11%

Trigger Attempt Success

  • trigger_pct:22.93%

Spelldata details

  • id:268552
  • name:Viper's Venom
  • tooltip:Your next Serpent Sting costs no Focus, and will deal {$s1=250}% increased initial damage.
  • description:{$@spelldesc268501={$?s259387=true}[Mongoose Bite][Raptor Strike] has a chance to make your next Serpent Sting cost no Focus and deal an additional {$268552s1=250}% initial damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spell details

  • id:268501
  • name:Viper's Venom
  • tooltip:
  • description:{$?s259387=true}[Mongoose Bite][Raptor Strike] has a chance to make your next Serpent Sting cost no Focus and deal an additional {$268552s1=250}% initial damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
cat: Predator 1.0 0.0 0.0sec 0.0sec 99.66% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival_cat
  • cooldown name:buff_predator
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • predator_1:99.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:260249
  • name:Predator
  • tooltip:Attack speed increased by {$s1=10}%.
  • description:{$@spelldesc260248=Kill Command causes the target to bleed for ${$RAP*({$s1=10}/100)*({$259277d=8 seconds}/$259277t2)} damage over {$259277d=8 seconds}. You and your pet gain {$260249s1=10}% attack speed for every bleeding enemy within {$s2=12} yds.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
flankers_advantage 27.8 10.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Coordinated Assault0.4800.0011.2300.6980.0002.049
Kill Command1.0230.00112.20368.12622.130140.896
Wildfire Bomb1.4070.0018.8820.1150.0008.882
Flanking Strike1.6750.0017.9699.8260.27924.761

Resources

Resource Usage Type Count Total Average RPE APR
T22_Hunter_Survival
raptor_strike Focus 98.1 2942.2 30.0 30.0 383.5
serpent_sting Focus 41.4 381.3 9.2 9.2 3221.4
pet - cat
claw Focus 83.7 2789.6 33.3 33.3 117.9
Resource Gains Type Count Total Average Overflow
kill_command Focus 77.80 1167.06 (35.64%) 15.00 0.00 0.00%
flanking_strike_damage Focus 7.68 152.65 (4.66%) 19.89 77.64 33.71%
focus_regen Focus 659.70 1954.46 (59.69%) 2.96 49.41 2.47%
pet - cat
flanking_strike Focus 7.68 218.66 (8.05%) 28.48 11.63 5.05%
focus_regen Focus 493.51 2497.03 (91.95%) 5.06 9.85 0.39%
Resource RPS-Gain RPS-Loss
Focus 10.91 11.08
Combat End Resource Mean Min Max
Focus 50.11 0.00 100.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 33.4%
Uptimes %
Focus Cap 1.7%
cat-Focus Cap 0.3%

Statistics & Data Analysis

Fight Length
Sample Data T22_Hunter_Survival Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Hunter_Survival Damage Per Second
Count 7499
Mean 17470.97
Minimum 16256.72
Maximum 18807.21
Spread ( max - min ) 2550.48
Range [ ( max - min ) / 2 * 100% ] 7.30%
Standard Deviation 357.9105
5th Percentile 16899.05
95th Percentile 18077.45
( 95th Percentile - 5th Percentile ) 1178.40
Mean Distribution
Standard Deviation 4.1331
95.00% Confidence Intervall ( 17462.87 - 17479.07 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1613
0.1 Scale Factor Error with Delta=300 1094
0.05 Scale Factor Error with Delta=300 4375
0.01 Scale Factor Error with Delta=300 109354
Priority Target DPS
Sample Data T22_Hunter_Survival Priority Target Damage Per Second
Count 7499
Mean 17470.97
Minimum 16256.72
Maximum 18807.21
Spread ( max - min ) 2550.48
Range [ ( max - min ) / 2 * 100% ] 7.30%
Standard Deviation 357.9105
5th Percentile 16899.05
95th Percentile 18077.45
( 95th Percentile - 5th Percentile ) 1178.40
Mean Distribution
Standard Deviation 4.1331
95.00% Confidence Intervall ( 17462.87 - 17479.07 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1613
0.1 Scale Factor Error with Delta=300 1094
0.05 Scale Factor Error with Delta=300 4375
0.01 Scale Factor Error with Delta=300 109354
DPS(e)
Sample Data T22_Hunter_Survival Damage Per Second (Effective)
Count 7499
Mean 17470.97
Minimum 16256.72
Maximum 18807.21
Spread ( max - min ) 2550.48
Range [ ( max - min ) / 2 * 100% ] 7.30%
Damage
Sample Data T22_Hunter_Survival Damage
Count 7499
Mean 3907746.43
Minimum 2984403.47
Maximum 4857149.91
Spread ( max - min ) 1872746.44
Range [ ( max - min ) / 2 * 100% ] 23.96%
DTPS
Sample Data T22_Hunter_Survival Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Hunter_Survival Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Hunter_Survival Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Hunter_Survival Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Hunter_Survival Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Hunter_Survival Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Hunter_SurvivalTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Hunter_Survival Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 summon_pet
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion
6 0.00 steel_trap
7 0.00 harpoon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_attack
0.00 muzzle,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
9 5.47 use_items
0.00 berserking,if=cooldown.coordinated_assault.remains>30
0.00 blood_fury,if=cooldown.coordinated_assault.remains>30
0.00 ancestral_call,if=cooldown.coordinated_assault.remains>30
0.00 fireblood,if=cooldown.coordinated_assault.remains>30
0.00 lights_judgment
0.00 arcane_torrent,if=cooldown.kill_command.remains>gcd.max&focus<=30
A 1.00 potion,if=buff.coordinated_assault.up&(buff.berserking.up|buff.blood_fury.up|!race.troll&!race.orc)
0.00 variable,name=can_gcd,value=!talent.mongoose_bite.enabled|buff.mongoose_fury.down|(buff.mongoose_fury.remains-(((buff.mongoose_fury.remains*focus.regen+focus)%action.mongoose_bite.cost)*gcd.max)>gcd.max)
0.00 steel_trap
0.00 a_murder_of_crows
B 2.99 coordinated_assault
0.00 chakrams,if=active_enemies>1
C 77.81 kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3&active_enemies<2
D 30.93 wildfire_bomb,if=(focus+cast_regen<focus.max|active_enemies>1)&(dot.wildfire_bomb.refreshable&buff.mongoose_fury.down|full_recharge_time<gcd)
0.00 kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3
0.00 butchery,if=(!talent.wildfire_infusion.enabled|full_recharge_time<gcd)&active_enemies>3|(dot.shrapnel_bomb.ticking&dot.internal_bleeding.stack<3)
E 41.41 serpent_sting,if=(active_enemies<2&refreshable&(buff.mongoose_fury.down|(variable.can_gcd&!talent.vipers_venom.enabled)))|buff.vipers_venom.up
0.00 carve,if=active_enemies>2&(active_enemies<6&active_enemies+gcd<cooldown.wildfire_bomb.remains|5+gcd<cooldown.wildfire_bomb.remains)
0.00 harpoon,if=talent.terms_of_engagement.enabled
F 7.68 flanking_strike
0.00 chakrams
0.00 serpent_sting,target_if=min:remains,if=refreshable&buff.mongoose_fury.down|buff.vipers_venom.up
0.00 aspect_of_the_eagle,if=target.distance>=6
0.00 mongoose_bite_eagle,target_if=min:dot.internal_bleeding.stack,if=buff.mongoose_fury.up|focus>60
0.00 mongoose_bite,target_if=min:dot.internal_bleeding.stack,if=buff.mongoose_fury.up|focus>60
0.00 raptor_strike_eagle,target_if=min:dot.internal_bleeding.stack
G 98.07 raptor_strike,target_if=min:dot.internal_bleeding.stack

Sample Sequence

01235789BEDFGEGCDEGEGCDGGCEGDCCGGGCDEGCEGECGDECGGCCGDECFGEGCGCDEGGC9GGGCDGECGCDEGCEGGCGDFCEGGCGDGCEGCEGDCCCEGCEGGB9ACDGCEGFGCGDGCEGGCCGCEDGCGCDEGGCGGGCDEGCFGGCDEGCGGC9CDEGCEGECCDGGCGEGCCDGGCCEFGCDEGGCGCGGDCCEGGCCCGDEBC9GCEGDEGCEFGCGDGCEGCGCGDECGEGCCGGDCGEGCCGCDFEGCGC

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Hunter_Survival 100.0/100: 100% focus
Pre precombat 1 augmentation T22_Hunter_Survival 100.0/100: 100% focus
Pre precombat 2 food T22_Hunter_Survival 100.0/100: 100% focus
Pre precombat 3 summon_pet Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
Pre precombat 7 harpoon Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
0:00.000 default B coordinated_assault Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility, galecallers_boon
0:01.098 default E serpent_sting Fluffy_Pillow 100.0/100: 100% focus bloodlust, coordinated_assault, predator, battle_potion_of_agility, galecallers_boon
0:01.945 default D wildfire_bomb Fluffy_Pillow 87.6/100: 88% focus bloodlust, coordinated_assault, predator, quick_navigation, battle_potion_of_agility, galecallers_boon
0:02.787 default F flanking_strike Fluffy_Pillow 95.1/100: 95% focus bloodlust, coordinated_assault, predator, quick_navigation, battle_potion_of_agility, galecallers_boon
0:03.629 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus bloodlust, coordinated_assault, predator, quick_navigation, battle_potion_of_agility, galecallers_boon
0:04.469 default E serpent_sting Fluffy_Pillow 77.5/100: 78% focus bloodlust, coordinated_assault, vipers_venom, predator, quick_navigation, battle_potion_of_agility, galecallers_boon
0:05.310 default G raptor_strike Fluffy_Pillow 85.1/100: 85% focus bloodlust, coordinated_assault, predator, quick_navigation, battle_potion_of_agility, galecallers_boon
0:06.152 default C kill_command Fluffy_Pillow 62.6/100: 63% focus bloodlust, coordinated_assault, vipers_venom, predator, quick_navigation, battle_potion_of_agility, galecallers_boon
0:06.994 default D wildfire_bomb Fluffy_Pillow 85.1/100: 85% focus bloodlust, coordinated_assault, vipers_venom, predator, quick_navigation, battle_potion_of_agility, galecallers_boon
0:07.835 default E serpent_sting Fluffy_Pillow 92.7/100: 93% focus bloodlust, coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:08.676 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:09.518 default E serpent_sting Fluffy_Pillow 77.5/100: 78% focus bloodlust, coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:10.359 default G raptor_strike Fluffy_Pillow 84.6/100: 85% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:11.329 default C kill_command Fluffy_Pillow 62.2/100: 62% focus bloodlust, coordinated_assault, predator, frothing_rage(2), quick_navigation, battle_potion_of_agility
0:12.299 default D wildfire_bomb Fluffy_Pillow 84.7/100: 85% focus bloodlust, coordinated_assault, predator, frothing_rage(2), quick_navigation, battle_potion_of_agility
0:13.269 default G raptor_strike Fluffy_Pillow 92.3/100: 92% focus bloodlust, coordinated_assault, predator, frothing_rage(2), quick_navigation, battle_potion_of_agility
0:14.239 default G raptor_strike Fluffy_Pillow 69.8/100: 70% focus bloodlust, coordinated_assault, predator, frothing_rage(2), quick_navigation(2), battle_potion_of_agility
0:15.201 default C kill_command Fluffy_Pillow 47.4/100: 47% focus bloodlust, coordinated_assault, predator, frothing_rage(2), quick_navigation(3), battle_potion_of_agility
0:16.159 default E serpent_sting Fluffy_Pillow 69.9/100: 70% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(3), battle_potion_of_agility
0:17.115 default G raptor_strike Fluffy_Pillow 57.4/100: 57% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(3), battle_potion_of_agility
0:18.073 default D wildfire_bomb Fluffy_Pillow 35.0/100: 35% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(3), battle_potion_of_agility
0:19.030 default C kill_command Fluffy_Pillow 42.5/100: 42% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(3), battle_potion_of_agility
0:19.987 default C kill_command Fluffy_Pillow 65.0/100: 65% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(3), battle_potion_of_agility
0:20.943 default G raptor_strike Fluffy_Pillow 87.5/100: 88% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(3), battle_potion_of_agility
0:21.901 default G raptor_strike Fluffy_Pillow 65.1/100: 65% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(4), battle_potion_of_agility
0:22.851 default G raptor_strike Fluffy_Pillow 42.6/100: 43% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(4), battle_potion_of_agility
0:23.803 default C kill_command Fluffy_Pillow 20.1/100: 20% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(4)
0:24.753 default D wildfire_bomb Fluffy_Pillow 42.7/100: 43% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation(4)
0:25.729 default E serpent_sting Fluffy_Pillow 50.7/100: 51% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation_final
0:26.635 default G raptor_strike Fluffy_Pillow 38.3/100: 38% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation_final
0:27.543 default C kill_command Fluffy_Pillow 15.8/100: 16% focus bloodlust, coordinated_assault, vipers_venom, predator, frothing_rage(3), quick_navigation_final
0:28.451 default E serpent_sting Fluffy_Pillow 38.3/100: 38% focus bloodlust, coordinated_assault, vipers_venom, predator, frothing_rage(3), quick_navigation_final
0:29.359 default G raptor_strike Fluffy_Pillow 45.9/100: 46% focus bloodlust, coordinated_assault, predator, frothing_rage(3), quick_navigation_final
0:30.265 default E serpent_sting Fluffy_Pillow 23.4/100: 23% focus bloodlust, coordinated_assault, vipers_venom, predator, quick_navigation_final
0:31.173 default C kill_command Fluffy_Pillow 30.9/100: 31% focus bloodlust, coordinated_assault, predator, quick_navigation_final
0:32.079 default G raptor_strike Fluffy_Pillow 53.4/100: 53% focus bloodlust, coordinated_assault, predator, quick_navigation_final
0:32.987 default D wildfire_bomb Fluffy_Pillow 31.0/100: 31% focus bloodlust, coordinated_assault, vipers_venom, predator, quick_navigation_final
0:33.894 default E serpent_sting Fluffy_Pillow 38.5/100: 38% focus bloodlust, coordinated_assault, vipers_venom, predator, quick_navigation_final
0:34.803 default C kill_command Fluffy_Pillow 46.0/100: 46% focus bloodlust, coordinated_assault, predator
0:35.780 default G raptor_strike Fluffy_Pillow 68.6/100: 69% focus bloodlust, coordinated_assault, predator
0:36.755 default G raptor_strike Fluffy_Pillow 46.1/100: 46% focus bloodlust, coordinated_assault, predator, quick_navigation
0:37.725 Waiting     0.700 sec 23.6/100: 24% focus bloodlust, coordinated_assault, predator, quick_navigation
0:38.425 default C kill_command Fluffy_Pillow 29.1/100: 29% focus bloodlust, coordinated_assault, predator, quick_navigation
0:39.643 default C kill_command Fluffy_Pillow 53.5/100: 54% focus bloodlust, coordinated_assault, predator, quick_navigation
0:40.611 default G raptor_strike Fluffy_Pillow 76.1/100: 76% focus bloodlust, coordinated_assault, predator, quick_navigation
0:41.580 default D wildfire_bomb Fluffy_Pillow 52.6/100: 53% focus coordinated_assault, vipers_venom, predator, quick_navigation
0:42.836 default E serpent_sting Fluffy_Pillow 60.1/100: 60% focus coordinated_assault, vipers_venom, predator, quick_navigation
0:44.095 default C kill_command Fluffy_Pillow 67.6/100: 68% focus predator, quick_navigation
0:45.513 default F flanking_strike Fluffy_Pillow 91.1/100: 91% focus predator, frothing_rage, quick_navigation
0:46.772 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus predator, frothing_rage, quick_navigation
0:48.029 default E serpent_sting Fluffy_Pillow 77.5/100: 78% focus vipers_venom, predator, frothing_rage, quick_navigation
0:49.288 default G raptor_strike Fluffy_Pillow 85.0/100: 85% focus predator, frothing_rage, quick_navigation
0:50.548 default C kill_command Fluffy_Pillow 62.6/100: 63% focus predator, frothing_rage, quick_navigation
0:51.807 default G raptor_strike Fluffy_Pillow 85.1/100: 85% focus predator, frothing_rage, quick_navigation
0:53.066 default C kill_command Fluffy_Pillow 62.6/100: 63% focus vipers_venom, predator, frothing_rage, quick_navigation
0:54.325 default D wildfire_bomb Fluffy_Pillow 85.2/100: 85% focus vipers_venom, predator, frothing_rage, quick_navigation
0:55.585 default E serpent_sting Fluffy_Pillow 92.7/100: 93% focus vipers_venom, predator, frothing_rage, quick_navigation
0:56.845 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus predator, frothing_rage, quick_navigation
0:58.103 default G raptor_strike Fluffy_Pillow 77.6/100: 78% focus predator, frothing_rage, quick_navigation(2)
0:59.355 default C kill_command Fluffy_Pillow 55.1/100: 55% focus predator, frothing_rage, quick_navigation(2)
1:00.607 default 9 use_items Fluffy_Pillow 77.6/100: 78% focus predator, frothing_rage, quick_navigation(2)
1:00.607 default G raptor_strike Fluffy_Pillow 77.6/100: 78% focus predator, frothing_rage, quick_navigation(2), galecallers_boon
1:01.692 default G raptor_strike Fluffy_Pillow 55.1/100: 55% focus predator, frothing_rage, quick_navigation(3), galecallers_boon
1:02.773 default G raptor_strike Fluffy_Pillow 32.7/100: 33% focus predator, frothing_rage, quick_navigation(3), galecallers_boon
1:03.854 default C kill_command Fluffy_Pillow 10.2/100: 10% focus predator, frothing_rage, quick_navigation(3), galecallers_boon
1:04.935 default D wildfire_bomb Fluffy_Pillow 32.7/100: 33% focus predator, frothing_rage, quick_navigation(3), galecallers_boon
1:06.018 default G raptor_strike Fluffy_Pillow 40.3/100: 40% focus predator, frothing_rage, quick_navigation(3), galecallers_boon
1:07.101 Waiting     0.400 sec 17.8/100: 18% focus predator, frothing_rage, quick_navigation(3), galecallers_boon
1:07.501 default E serpent_sting Fluffy_Pillow 20.6/100: 21% focus predator, frothing_rage, quick_navigation(3), galecallers_boon
1:08.583 default C kill_command Fluffy_Pillow 8.1/100: 8% focus predator, frothing_rage, quick_navigation(3), galecallers_boon
1:09.664 default G raptor_strike Fluffy_Pillow 30.6/100: 31% focus predator, frothing_rage, quick_navigation(3), galecallers_boon
1:10.746 Waiting     2.300 sec 8.0/100: 8% focus predator, frothing_rage, quick_navigation(3)
1:13.046 default C kill_command Fluffy_Pillow 22.0/100: 22% focus predator, frothing_rage, quick_navigation(4)
1:14.454 default D wildfire_bomb Fluffy_Pillow 45.6/100: 46% focus predator, frothing_rage, quick_navigation(4)
1:15.689 default E serpent_sting Fluffy_Pillow 53.2/100: 53% focus predator, frothing_rage, quick_navigation_final
1:16.869 default G raptor_strike Fluffy_Pillow 40.7/100: 41% focus predator, frothing_rage(2), quick_navigation_final
1:18.050 default C kill_command Fluffy_Pillow 18.2/100: 18% focus vipers_venom, predator, frothing_rage(2), quick_navigation_final
1:19.228 default E serpent_sting Fluffy_Pillow 40.7/100: 41% focus vipers_venom, predator, frothing_rage(3), quick_navigation_final
1:20.408 default G raptor_strike Fluffy_Pillow 48.3/100: 48% focus predator, frothing_rage(3), quick_navigation_final
1:21.587 Waiting     0.700 sec 25.8/100: 26% focus predator, frothing_rage(3), quick_navigation_final
1:22.287 default G raptor_strike Fluffy_Pillow 30.3/100: 30% focus predator, frothing_rage(3), quick_navigation_final
1:23.465 default C kill_command Fluffy_Pillow 7.8/100: 8% focus predator, frothing_rage(3), quick_navigation_final
1:24.645 default G raptor_strike Fluffy_Pillow 30.3/100: 30% focus predator, frothing_rage(3), quick_navigation_final
1:25.823 default D wildfire_bomb Fluffy_Pillow 7.7/100: 8% focus predator, frothing_rage(3)
1:27.090 default F flanking_strike Fluffy_Pillow 15.3/100: 15% focus predator, frothing_rage(3)
1:28.357 default C kill_command Fluffy_Pillow 52.8/100: 53% focus predator, frothing_rage(3)
1:29.624 default E serpent_sting Fluffy_Pillow 75.3/100: 75% focus predator, frothing_rage(3)
1:30.893 default G raptor_strike Fluffy_Pillow 62.9/100: 63% focus predator, frothing_rage(3)
1:32.160 default G raptor_strike Fluffy_Pillow 40.4/100: 40% focus predator, frothing_rage(3)
1:33.426 default C kill_command Fluffy_Pillow 17.9/100: 18% focus predator, frothing_rage(3)
1:34.692 default G raptor_strike Fluffy_Pillow 40.4/100: 40% focus predator, frothing_rage(3)
1:35.958 default D wildfire_bomb Fluffy_Pillow 18.0/100: 18% focus predator, frothing_rage(3)
1:37.225 Waiting     0.800 sec 25.5/100: 25% focus predator, frothing_rage(3)
1:38.025 default G raptor_strike Fluffy_Pillow 30.2/100: 30% focus predator, frothing_rage(3)
1:39.292 default C kill_command Fluffy_Pillow 7.8/100: 8% focus predator, frothing_rage(3)
1:40.558 default E serpent_sting Fluffy_Pillow 30.3/100: 30% focus predator, frothing_rage(3)
1:41.824 Waiting     2.100 sec 17.8/100: 18% focus predator, frothing_rage(3), quick_navigation
1:43.924 default G raptor_strike Fluffy_Pillow 30.4/100: 30% focus predator, frothing_rage(3), quick_navigation
1:45.181 default C kill_command Fluffy_Pillow 7.9/100: 8% focus vipers_venom, predator, frothing_rage(3), quick_navigation
1:46.439 default E serpent_sting Fluffy_Pillow 30.4/100: 30% focus vipers_venom, predator, frothing_rage(3), quick_navigation
1:47.698 default G raptor_strike Fluffy_Pillow 37.9/100: 38% focus predator, frothing_rage(3), quick_navigation
1:48.955 default D wildfire_bomb Fluffy_Pillow 15.5/100: 15% focus vipers_venom, predator, frothing_rage(3), quick_navigation
1:50.215 default C kill_command Fluffy_Pillow 23.1/100: 23% focus vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(25)
1:51.308 default C kill_command Fluffy_Pillow 45.7/100: 46% focus vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(24)
1:52.407 default C kill_command Fluffy_Pillow 68.2/100: 68% focus vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(22)
1:53.517 default E serpent_sting Fluffy_Pillow 90.7/100: 91% focus vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(21)
1:54.632 default G raptor_strike Fluffy_Pillow 98.2/100: 98% focus predator, frothing_rage(3), quick_navigation, overwhelming_power(20)
1:55.754 default C kill_command Fluffy_Pillow 75.7/100: 76% focus vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(19)
1:56.881 default E serpent_sting Fluffy_Pillow 98.2/100: 98% focus vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(18)
1:58.014 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus predator, frothing_rage(3), quick_navigation, overwhelming_power(16)
1:59.161 default G raptor_strike Fluffy_Pillow 77.5/100: 78% focus predator, frothing_rage(3), quick_navigation(2), overwhelming_power(15)
2:00.307 default B coordinated_assault Fluffy_Pillow 55.1/100: 55% focus predator, frothing_rage(3), quick_navigation(2), overwhelming_power(14)
2:01.460 default 9 use_items Fluffy_Pillow 62.6/100: 63% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(2), overwhelming_power(13)
2:01.460 default A potion Fluffy_Pillow 62.6/100: 63% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(2), overwhelming_power(13), galecallers_boon
2:01.460 default C kill_command Fluffy_Pillow 62.6/100: 63% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(2), overwhelming_power(13), battle_potion_of_agility, galecallers_boon
2:02.478 default D wildfire_bomb Fluffy_Pillow 85.1/100: 85% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(2), overwhelming_power(12), battle_potion_of_agility, galecallers_boon
2:03.501 default G raptor_strike Fluffy_Pillow 92.6/100: 93% focus coordinated_assault, predator, quick_navigation(2), overwhelming_power(11), battle_potion_of_agility, galecallers_boon
2:04.527 default C kill_command Fluffy_Pillow 70.1/100: 70% focus coordinated_assault, vipers_venom, predator, quick_navigation(2), overwhelming_power(10), battle_potion_of_agility, galecallers_boon
2:05.560 default E serpent_sting Fluffy_Pillow 92.6/100: 93% focus coordinated_assault, vipers_venom, predator, quick_navigation(2), overwhelming_power(9), battle_potion_of_agility, galecallers_boon
2:06.598 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, quick_navigation(2), overwhelming_power(8), battle_potion_of_agility, galecallers_boon
2:07.641 default F flanking_strike Fluffy_Pillow 77.5/100: 78% focus coordinated_assault, predator, quick_navigation(2), overwhelming_power(7), battle_potion_of_agility, galecallers_boon
2:08.690 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, quick_navigation(3), overwhelming_power(6), battle_potion_of_agility, galecallers_boon
2:09.738 default C kill_command Fluffy_Pillow 77.5/100: 77% focus coordinated_assault, predator, quick_navigation(3), overwhelming_power(4), battle_potion_of_agility, galecallers_boon
2:10.797 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, quick_navigation(3), overwhelming_power(3), battle_potion_of_agility, galecallers_boon
2:11.862 default D wildfire_bomb Fluffy_Pillow 77.1/100: 77% focus coordinated_assault, predator, quick_navigation(3), overwhelming_power(2), battle_potion_of_agility
2:13.089 default G raptor_strike Fluffy_Pillow 84.6/100: 85% focus coordinated_assault, predator, quick_navigation(3), battle_potion_of_agility
2:14.331 default C kill_command Fluffy_Pillow 62.1/100: 62% focus coordinated_assault, vipers_venom, predator, quick_navigation(4), battle_potion_of_agility
2:15.623 default E serpent_sting Fluffy_Pillow 85.0/100: 85% focus coordinated_assault, vipers_venom, predator, quick_navigation(4), battle_potion_of_agility
2:16.859 default G raptor_strike Fluffy_Pillow 92.5/100: 92% focus coordinated_assault, predator, quick_navigation(4), battle_potion_of_agility
2:18.093 default G raptor_strike Fluffy_Pillow 70.3/100: 70% focus coordinated_assault, predator, quick_navigation_final, battle_potion_of_agility
2:19.273 default C kill_command Fluffy_Pillow 47.9/100: 48% focus coordinated_assault, predator, quick_navigation_final, battle_potion_of_agility
2:20.454 default C kill_command Fluffy_Pillow 70.4/100: 70% focus coordinated_assault, predator, frothing_rage, quick_navigation_final, battle_potion_of_agility
2:21.635 default G raptor_strike Fluffy_Pillow 92.9/100: 93% focus coordinated_assault, predator, frothing_rage, quick_navigation_final, battle_potion_of_agility
2:22.814 default C kill_command Fluffy_Pillow 70.5/100: 70% focus coordinated_assault, predator, frothing_rage, quick_navigation_final, battle_potion_of_agility
2:23.992 default E serpent_sting Fluffy_Pillow 93.0/100: 93% focus coordinated_assault, predator, frothing_rage, quick_navigation_final, battle_potion_of_agility
2:25.172 default D wildfire_bomb Fluffy_Pillow 80.5/100: 81% focus coordinated_assault, predator, frothing_rage, quick_navigation_final, battle_potion_of_agility
2:26.352 default G raptor_strike Fluffy_Pillow 88.0/100: 88% focus coordinated_assault, predator, frothing_rage, quick_navigation_final, battle_potion_of_agility
2:27.531 default C kill_command Fluffy_Pillow 65.3/100: 65% focus coordinated_assault, predator, frothing_rage
2:28.818 default G raptor_strike Fluffy_Pillow 88.0/100: 88% focus coordinated_assault, predator, frothing_rage
2:30.083 default C kill_command Fluffy_Pillow 65.5/100: 66% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation
2:31.342 default D wildfire_bomb Fluffy_Pillow 88.1/100: 88% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation
2:32.599 default E serpent_sting Fluffy_Pillow 95.6/100: 96% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation
2:33.859 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, frothing_rage, quick_navigation
2:35.119 default G raptor_strike Fluffy_Pillow 77.5/100: 78% focus coordinated_assault, predator, frothing_rage, quick_navigation
2:36.377 default C kill_command Fluffy_Pillow 55.1/100: 55% focus coordinated_assault, predator, frothing_rage, quick_navigation
2:37.636 default G raptor_strike Fluffy_Pillow 77.6/100: 78% focus coordinated_assault, predator, frothing_rage, quick_navigation
2:38.893 default G raptor_strike Fluffy_Pillow 55.1/100: 55% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2)
2:40.143 default G raptor_strike Fluffy_Pillow 32.6/100: 33% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(2)
2:41.394 default C kill_command Fluffy_Pillow 10.1/100: 10% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(2)
2:42.643 default D wildfire_bomb Fluffy_Pillow 32.6/100: 33% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(2)
2:43.895 default E serpent_sting Fluffy_Pillow 40.2/100: 40% focus predator, frothing_rage(3), quick_navigation(2)
2:45.147 Waiting     0.400 sec 27.7/100: 28% focus predator, frothing_rage(3), quick_navigation(2)
2:45.547 default G raptor_strike Fluffy_Pillow 30.1/100: 30% focus predator, frothing_rage(3), quick_navigation(2)
2:46.796 default C kill_command Fluffy_Pillow 7.6/100: 8% focus predator, frothing_rage(3), quick_navigation(3)
2:48.039 default F flanking_strike Fluffy_Pillow 30.2/100: 30% focus predator, frothing_rage(3), quick_navigation(3)
2:49.284 default G raptor_strike Fluffy_Pillow 67.7/100: 68% focus predator, frothing_rage(3), quick_navigation(3)
2:50.525 default G raptor_strike Fluffy_Pillow 46.3/100: 46% focus predator, frothing_rage(3), quick_navigation(3), overwhelming_power(24)
2:51.611 default C kill_command Fluffy_Pillow 23.8/100: 24% focus predator, frothing_rage(3), quick_navigation(3), overwhelming_power(23)
2:52.704 default D wildfire_bomb Fluffy_Pillow 46.3/100: 46% focus predator, quick_navigation(3), overwhelming_power(22)
2:53.801 default E serpent_sting Fluffy_Pillow 53.8/100: 54% focus predator, quick_navigation(3), overwhelming_power(21)
2:54.903 default G raptor_strike Fluffy_Pillow 41.3/100: 41% focus predator, quick_navigation(3), overwhelming_power(20)
2:56.014 default C kill_command Fluffy_Pillow 18.8/100: 19% focus predator, quick_navigation(4), overwhelming_power(18)
2:57.129 default G raptor_strike Fluffy_Pillow 41.3/100: 41% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(17)
2:58.250 Waiting     1.700 sec 18.9/100: 19% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(16)
2:59.950 default G raptor_strike Fluffy_Pillow 30.2/100: 30% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(15)
3:01.083 default C kill_command Fluffy_Pillow 7.7/100: 8% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(13)
3:02.229 default 9 use_items Fluffy_Pillow 30.2/100: 30% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(12)
3:02.229 default C kill_command Fluffy_Pillow 30.2/100: 30% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(12), galecallers_boon
3:03.242 default D wildfire_bomb Fluffy_Pillow 52.7/100: 53% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(11), galecallers_boon
3:04.259 default E serpent_sting Fluffy_Pillow 60.2/100: 60% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(9), galecallers_boon
3:05.285 default G raptor_strike Fluffy_Pillow 47.7/100: 48% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(7), galecallers_boon
3:06.323 default C kill_command Fluffy_Pillow 25.2/100: 25% focus vipers_venom, predator, frothing_rage, quick_navigation(4), overwhelming_power(6), galecallers_boon
3:07.365 default E serpent_sting Fluffy_Pillow 47.7/100: 48% focus vipers_venom, predator, frothing_rage, quick_navigation(4), overwhelming_power(5), galecallers_boon
3:08.414 default G raptor_strike Fluffy_Pillow 55.2/100: 55% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(4), galecallers_boon
3:09.468 default E serpent_sting Fluffy_Pillow 32.7/100: 33% focus vipers_venom, predator, frothing_rage, quick_navigation(4), overwhelming_power(3), galecallers_boon
3:10.526 default C kill_command Fluffy_Pillow 40.2/100: 40% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(2), galecallers_boon
3:11.591 default C kill_command Fluffy_Pillow 62.7/100: 63% focus predator, frothing_rage, quick_navigation(4), overwhelming_power, galecallers_boon
3:12.662 default D wildfire_bomb Fluffy_Pillow 84.9/100: 85% focus predator, frothing_rage, quick_navigation(4)
3:13.898 default G raptor_strike Fluffy_Pillow 92.4/100: 92% focus predator, frothing_rage, quick_navigation(4)
3:15.134 default G raptor_strike Fluffy_Pillow 70.0/100: 70% focus predator, frothing_rage, quick_navigation_final
3:16.314 default C kill_command Fluffy_Pillow 47.5/100: 48% focus predator, frothing_rage, quick_navigation_final
3:17.522 default G raptor_strike Fluffy_Pillow 70.2/100: 70% focus predator, frothing_rage, quick_navigation_final
3:18.700 default E serpent_sting Fluffy_Pillow 47.8/100: 48% focus predator, frothing_rage, quick_navigation_final
3:19.881 default G raptor_strike Fluffy_Pillow 35.3/100: 35% focus predator, frothing_rage, quick_navigation_final
3:21.063 default C kill_command Fluffy_Pillow 12.8/100: 13% focus predator, frothing_rage(2), quick_navigation_final
3:22.242 default C kill_command Fluffy_Pillow 35.4/100: 35% focus predator, frothing_rage(2), quick_navigation_final
3:23.423 default D wildfire_bomb Fluffy_Pillow 57.9/100: 58% focus predator, frothing_rage(2), quick_navigation_final
3:24.604 default G raptor_strike Fluffy_Pillow 65.4/100: 65% focus predator, frothing_rage(2), quick_navigation_final
3:25.784 default G raptor_strike Fluffy_Pillow 42.5/100: 43% focus predator, frothing_rage(2)
3:27.050 default C kill_command Fluffy_Pillow 20.1/100: 20% focus predator, frothing_rage(2)
3:28.365 default C kill_command Fluffy_Pillow 42.9/100: 43% focus predator, frothing_rage(2)
3:29.632 default E serpent_sting Fluffy_Pillow 65.4/100: 65% focus predator, frothing_rage(2)
3:30.899 default F flanking_strike Fluffy_Pillow 52.9/100: 53% focus predator, frothing_rage(2)
3:32.166 default G raptor_strike Fluffy_Pillow 90.5/100: 90% focus predator, frothing_rage(2)
3:33.432 default C kill_command Fluffy_Pillow 68.0/100: 68% focus vipers_venom, predator, frothing_rage(2)
3:34.698 default D wildfire_bomb Fluffy_Pillow 90.5/100: 91% focus vipers_venom, predator, frothing_rage(2)
3:35.964 default E serpent_sting Fluffy_Pillow 98.0/100: 98% focus vipers_venom, predator, frothing_rage(2)
3:37.230 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus predator, frothing_rage(2)
3:38.496 default G raptor_strike Fluffy_Pillow 77.5/100: 78% focus predator, frothing_rage(2)
3:39.762 default C kill_command Fluffy_Pillow 55.0/100: 55% focus predator, frothing_rage(2)
3:41.028 default G raptor_strike Fluffy_Pillow 77.6/100: 78% focus predator, frothing_rage(3), quick_navigation
3:42.288 default C kill_command Fluffy_Pillow 55.1/100: 55% focus predator, frothing_rage(3), quick_navigation
3:43.548 default G raptor_strike Fluffy_Pillow 77.7/100: 78% focus predator, frothing_rage(3), quick_navigation
3:44.805 default G raptor_strike Fluffy_Pillow 55.2/100: 55% focus predator, frothing_rage(3), quick_navigation
3:46.063 default D wildfire_bomb Fluffy_Pillow 32.7/100: 33% focus predator, frothing_rage(3), quick_navigation
3:47.322 default C kill_command Fluffy_Pillow 40.2/100: 40% focus predator, frothing_rage(3), quick_navigation
3:48.580 default C kill_command Fluffy_Pillow 62.8/100: 63% focus predator, frothing_rage(3), quick_navigation
3:49.839 default E serpent_sting Fluffy_Pillow 85.3/100: 85% focus predator, frothing_rage(3), quick_navigation
3:51.097 default G raptor_strike Fluffy_Pillow 72.8/100: 73% focus predator, frothing_rage(3), quick_navigation
3:52.356 default G raptor_strike Fluffy_Pillow 50.3/100: 50% focus predator, frothing_rage(3), quick_navigation
3:53.615 default C kill_command Fluffy_Pillow 27.9/100: 28% focus predator, frothing_rage(3), quick_navigation
3:54.874 default C kill_command Fluffy_Pillow 50.4/100: 50% focus predator, frothing_rage(3), quick_navigation
3:56.130 default C kill_command Fluffy_Pillow 73.9/100: 74% focus predator, frothing_rage(3), quick_navigation, overwhelming_power(23)
3:57.234 default G raptor_strike Fluffy_Pillow 96.5/100: 96% focus predator, frothing_rage(3), quick_navigation(2), overwhelming_power(22)
3:58.339 default D wildfire_bomb Fluffy_Pillow 74.0/100: 74% focus predator, frothing_rage(3), quick_navigation(2), overwhelming_power(21)
3:59.447 default E serpent_sting Fluffy_Pillow 81.6/100: 82% focus predator, frothing_rage(3), quick_navigation(3), overwhelming_power(20)
4:00.554 default B coordinated_assault Fluffy_Pillow 69.0/100: 69% focus predator, frothing_rage(3), quick_navigation(3), overwhelming_power(19)
4:01.670 default C kill_command Fluffy_Pillow 76.6/100: 77% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3), overwhelming_power(18)
4:02.792 default 9 use_items Fluffy_Pillow 99.1/100: 99% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3), overwhelming_power(17)
4:02.792 default G raptor_strike Fluffy_Pillow 99.1/100: 99% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3), overwhelming_power(17), galecallers_boon
4:03.785 default C kill_command Fluffy_Pillow 76.6/100: 77% focus coordinated_assault, vipers_venom, predator, quick_navigation(4), overwhelming_power(16), galecallers_boon
4:04.777 default E serpent_sting Fluffy_Pillow 99.1/100: 99% focus coordinated_assault, vipers_venom, predator, quick_navigation(4), overwhelming_power(15), galecallers_boon
4:05.774 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, quick_navigation(4), overwhelming_power(14), galecallers_boon
4:06.776 default D wildfire_bomb Fluffy_Pillow 77.5/100: 78% focus coordinated_assault, vipers_venom, predator, quick_navigation(4), overwhelming_power(13), galecallers_boon
4:07.782 default E serpent_sting Fluffy_Pillow 85.0/100: 85% focus coordinated_assault, vipers_venom, predator, quick_navigation(4), overwhelming_power(12), galecallers_boon
4:08.795 default G raptor_strike Fluffy_Pillow 92.5/100: 93% focus coordinated_assault, predator, quick_navigation(4), overwhelming_power(11), galecallers_boon
4:09.812 default C kill_command Fluffy_Pillow 70.0/100: 70% focus coordinated_assault, vipers_venom, predator, quick_navigation(4), overwhelming_power(10), galecallers_boon
4:10.836 default E serpent_sting Fluffy_Pillow 92.5/100: 93% focus coordinated_assault, vipers_venom, predator, quick_navigation(4), overwhelming_power(8), galecallers_boon
4:11.868 default F flanking_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, quick_navigation(4), overwhelming_power(7), galecallers_boon
4:12.905 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, quick_navigation(4), overwhelming_power(6)
4:14.097 default C kill_command Fluffy_Pillow 77.5/100: 77% focus coordinated_assault, predator, quick_navigation(4), overwhelming_power(4)
4:15.321 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, quick_navigation_final, overwhelming_power(3)
4:16.481 default D wildfire_bomb Fluffy_Pillow 77.5/100: 78% focus coordinated_assault, predator, quick_navigation_final, overwhelming_power(2)
4:17.714 default G raptor_strike Fluffy_Pillow 85.4/100: 85% focus coordinated_assault, predator, quick_navigation_final, overwhelming_power
4:18.884 default C kill_command Fluffy_Pillow 62.9/100: 63% focus coordinated_assault, vipers_venom, predator, quick_navigation_final
4:20.064 default E serpent_sting Fluffy_Pillow 85.5/100: 85% focus coordinated_assault, vipers_venom, predator, quick_navigation_final
4:21.243 default G raptor_strike Fluffy_Pillow 93.0/100: 93% focus coordinated_assault, predator, quick_navigation_final
4:22.421 default C kill_command Fluffy_Pillow 70.5/100: 70% focus coordinated_assault, predator, quick_navigation_final
4:23.599 default G raptor_strike Fluffy_Pillow 93.0/100: 93% focus coordinated_assault, predator, quick_navigation_final
4:24.778 default C kill_command Fluffy_Pillow 70.5/100: 70% focus coordinated_assault, predator
4:26.045 default G raptor_strike Fluffy_Pillow 93.0/100: 93% focus coordinated_assault, predator, frothing_rage
4:27.313 default D wildfire_bomb Fluffy_Pillow 70.6/100: 71% focus coordinated_assault, predator, frothing_rage
4:28.581 default E serpent_sting Fluffy_Pillow 78.1/100: 78% focus coordinated_assault, predator, frothing_rage(2)
4:29.849 default C kill_command Fluffy_Pillow 65.6/100: 66% focus coordinated_assault, predator, frothing_rage(2)
4:31.115 default G raptor_strike Fluffy_Pillow 88.1/100: 88% focus coordinated_assault, predator, frothing_rage(2)
4:32.381 default E serpent_sting Fluffy_Pillow 65.7/100: 66% focus coordinated_assault, vipers_venom, predator, frothing_rage(2)
4:33.648 default G raptor_strike Fluffy_Pillow 73.2/100: 73% focus coordinated_assault, predator, frothing_rage(2)
4:34.915 default C kill_command Fluffy_Pillow 50.7/100: 51% focus coordinated_assault, predator, frothing_rage(2)
4:36.180 default C kill_command Fluffy_Pillow 73.2/100: 73% focus coordinated_assault, predator, frothing_rage(2)
4:37.446 default G raptor_strike Fluffy_Pillow 95.8/100: 96% focus predator, frothing_rage(2)
4:38.711 default G raptor_strike Fluffy_Pillow 73.3/100: 73% focus predator, frothing_rage(2), quick_navigation
4:39.972 default D wildfire_bomb Fluffy_Pillow 50.9/100: 51% focus predator, frothing_rage(2), quick_navigation
4:41.230 default C kill_command Fluffy_Pillow 58.4/100: 58% focus predator, frothing_rage(2), quick_navigation
4:42.488 default G raptor_strike Fluffy_Pillow 80.9/100: 81% focus predator, frothing_rage(2), quick_navigation
4:43.747 default E serpent_sting Fluffy_Pillow 58.4/100: 58% focus vipers_venom, predator, frothing_rage(2), quick_navigation
4:45.005 default G raptor_strike Fluffy_Pillow 65.9/100: 66% focus predator, frothing_rage(2), quick_navigation
4:46.265 default C kill_command Fluffy_Pillow 43.5/100: 43% focus predator, frothing_rage(2), quick_navigation
4:47.523 default C kill_command Fluffy_Pillow 66.0/100: 66% focus predator, frothing_rage(3), quick_navigation
4:48.781 default G raptor_strike Fluffy_Pillow 88.5/100: 89% focus predator, frothing_rage(3), quick_navigation
4:50.038 default C kill_command Fluffy_Pillow 66.0/100: 66% focus predator, frothing_rage(3), quick_navigation
4:51.296 default D wildfire_bomb Fluffy_Pillow 88.5/100: 89% focus predator, frothing_rage(3), quick_navigation
4:52.555 default F flanking_strike Fluffy_Pillow 96.1/100: 96% focus predator, frothing_rage(3), quick_navigation
4:53.813 default E serpent_sting Fluffy_Pillow 100.0/100: 100% focus predator, frothing_rage(3), quick_navigation(2)
4:55.062 default G raptor_strike Fluffy_Pillow 87.5/100: 88% focus predator, frothing_rage(3), quick_navigation(2)
4:56.313 default C kill_command Fluffy_Pillow 65.0/100: 65% focus predator, frothing_rage(3), quick_navigation(2)
4:57.563 default G raptor_strike Fluffy_Pillow 87.6/100: 88% focus predator, frothing_rage(3), quick_navigation(2)
4:58.814 default C kill_command Fluffy_Pillow 65.1/100: 65% focus predator, frothing_rage(3), quick_navigation(3)

Stats

Level Bonus (120) Race Bonus (pandaren) Raid-Buffed Unbuffed Gear Amount
Strength 1467 0 1527 1467 0
Agility 1467 -2 6624 6101 4346 (3433)
Stamina 1001 2 9031 8210 7207
Intellect 1467 0 1679 1467 0
Spirit 0 0 0 0 0
Health 180620 164200 0
Focus 100 100 0
Crit 21.39% 21.39% 820
Haste 18.82% 18.82% 1280
Damage / Heal Versatility 4.13% 4.13% 351
Attack Power 7286 6101 0
Mastery 25.87% 25.87% 553
Armor 2738 2738 2738
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Coif of the Court Spider
ilevel: 390, stats: { 381 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Latent Poison, Overwhelming Power, Gemhide, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amalgamated Abomination Spaulders
ilevel: 390, stats: { 352 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Wilderness Survival, Overwhelming Power, Bulwark of the Masses, Azerite Empowered }
Local Chest C'thraxxi General's Hauberk
ilevel: 390, stats: { 469 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Latent Poison, Azerite Globules, Gemhide, Azerite Empowered }
Local Waist Titanspark Energy Girdle
ilevel: 385, stats: { 255 Armor, +247 AgiInt, +417 Sta, +96 Haste, +88 Crit }
Local Legs Blighted Anima Greaves
ilevel: 385, stats: { 397 Armor, +329 AgiInt, +556 Sta, +149 Haste, +96 Vers }
Local Feet Fused Monstrosity Stompers
ilevel: 385, stats: { 312 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Wrists Rubywrought Sparkguards
ilevel: 385, stats: { 198 Armor, +185 AgiInt, +312 Sta, +78 Haste, +60 Mastery }
Local Hands Oblivion Crushers
ilevel: 385, stats: { 283 Armor, +247 AgiInt, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Galecaller's Boon
ilevel: 370, stats: { +271 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Void-Binder
ilevel: 385, weapon: { 623 - 1158, 3.6 }, stats: { +329 Agi, +556 Sta, +140 Vers, +105 Haste }, enchant: quick_navigation

Talents

Level
15 Viper's Venom (Survival Hunter) Terms of Engagement (Survival Hunter) Alpha Predator (Survival Hunter)
30 Guerrilla Tactics (Survival Hunter) Hydra's Bite (Survival Hunter) Butchery (Survival Hunter)
45 Trailblazer Natural Mending Camouflage
60 Bloodseeker (Survival Hunter) Steel Trap (Survival Hunter) A Murder of Crows (Survival Hunter)
75 Born To Be Wild Posthaste Binding Shot
90 Tip of the Spear (Survival Hunter) Mongoose Bite (Survival Hunter) Flanking Strike (Survival Hunter)
100 Birds of Prey (Survival Hunter) Wildfire Infusion (Survival Hunter) Chakrams (Survival Hunter)

Profile

hunter="T22_Hunter_Survival"
spec=survival
level=120
race=pandaren
role=attack
position=back
talents=1101031

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/steel_trap
actions.precombat+=/harpoon

# Executed every time the actor is available.
actions=auto_attack
actions+=/muzzle,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
actions+=/use_items
actions+=/berserking,if=cooldown.coordinated_assault.remains>30
actions+=/blood_fury,if=cooldown.coordinated_assault.remains>30
actions+=/ancestral_call,if=cooldown.coordinated_assault.remains>30
actions+=/fireblood,if=cooldown.coordinated_assault.remains>30
actions+=/lights_judgment
actions+=/arcane_torrent,if=cooldown.kill_command.remains>gcd.max&focus<=30
actions+=/potion,if=buff.coordinated_assault.up&(buff.berserking.up|buff.blood_fury.up|!race.troll&!race.orc)
actions+=/variable,name=can_gcd,value=!talent.mongoose_bite.enabled|buff.mongoose_fury.down|(buff.mongoose_fury.remains-(((buff.mongoose_fury.remains*focus.regen+focus)%action.mongoose_bite.cost)*gcd.max)>gcd.max)
actions+=/steel_trap
actions+=/a_murder_of_crows
actions+=/coordinated_assault
actions+=/chakrams,if=active_enemies>1
actions+=/kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3&active_enemies<2
actions+=/wildfire_bomb,if=(focus+cast_regen<focus.max|active_enemies>1)&(dot.wildfire_bomb.refreshable&buff.mongoose_fury.down|full_recharge_time<gcd)
actions+=/kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3
actions+=/butchery,if=(!talent.wildfire_infusion.enabled|full_recharge_time<gcd)&active_enemies>3|(dot.shrapnel_bomb.ticking&dot.internal_bleeding.stack<3)
actions+=/serpent_sting,if=(active_enemies<2&refreshable&(buff.mongoose_fury.down|(variable.can_gcd&!talent.vipers_venom.enabled)))|buff.vipers_venom.up
actions+=/carve,if=active_enemies>2&(active_enemies<6&active_enemies+gcd<cooldown.wildfire_bomb.remains|5+gcd<cooldown.wildfire_bomb.remains)
actions+=/harpoon,if=talent.terms_of_engagement.enabled
actions+=/flanking_strike
actions+=/chakrams
actions+=/serpent_sting,target_if=min:remains,if=refreshable&buff.mongoose_fury.down|buff.vipers_venom.up
actions+=/aspect_of_the_eagle,if=target.distance>=6
actions+=/mongoose_bite_eagle,target_if=min:dot.internal_bleeding.stack,if=buff.mongoose_fury.up|focus>60
actions+=/mongoose_bite,target_if=min:dot.internal_bleeding.stack,if=buff.mongoose_fury.up|focus>60
actions+=/raptor_strike_eagle,target_if=min:dot.internal_bleeding.stack
actions+=/raptor_strike,target_if=min:dot.internal_bleeding.stack

head=coif_of_the_court_spider,id=159358,bonus_id=1557/4819/4775/4786,azerite_powers=3/163/30/85/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=amalgamated_abomination_spaulders,id=159385,bonus_id=1557/4819/4775/4786,azerite_powers=3/372/30/84/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=cthraxxi_generals_hauberk,id=160725,bonus_id=4824/1507/4775,azerite_powers=3/163/462/85/13
wrists=rubywrought_sparkguards,id=160629,bonus_id=4800/1507
hands=oblivion_crushers,id=160721,bonus_id=4800/1507
waist=titanspark_energy_girdle,id=160633,bonus_id=4800/1507
legs=blighted_anima_greaves,id=160716,bonus_id=4800/1507
feet=fused_monstrosity_stompers,id=160628,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=galecallers_boon,id=159614,bonus_id=1542/4779
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=voidbinder,id=160688,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=385.27
# gear_agility=4346
# gear_stamina=7207
# gear_crit_rating=820
# gear_haste_rating=1280
# gear_mastery_rating=553
# gear_versatility_rating=351
# gear_armor=2738

T22_Paladin_Retribution : 18048 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
18048.3 18048.3 12.7 / 0.071% 2194.6 / 12.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 8.66% 52.1 100.0% 100%
Talents
  • 15: Righteous Verdict (Retribution Paladin)
  • 30: Hammer of Wrath (Retribution Paladin)
  • 60: Wake of Ashes (Retribution Paladin)
  • 100: Inquisition (Retribution Paladin)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Paladin_Retribution 18048
Blade of Justice 1582 8.8% 45.2 6.67sec 10487 9887 Direct 45.2 8154 17065 10487 26.2%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.20 45.20 0.00 0.00 1.0607 0.0000 474024.10 677674.38 30.05 9887.24 9887.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.37 73.82% 8154.11 7203 10475 8155.85 7796 8606 272088 388983 30.05
crit 11.83 26.18% 17065.28 14405 20950 17091.25 15474 19752 201936 288691 30.05
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power=3&(cooldown.hammer_of_wrath.remains>gcd*2|variable.HoW))
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Pierces an enemy with a blade of light, dealing ${{$s2=0}*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Crusader Strike 1124 6.2% 61.8 4.66sec 5454 5029 Direct 61.8 4263 8881 5454 25.8%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.76 61.76 0.00 0.00 1.0845 0.0000 336788.21 481479.19 30.05 5028.72 5028.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.84 74.22% 4263.46 3800 5526 4264.19 4102 4426 195428 279388 30.05
crit 15.92 25.78% 8880.74 7600 11053 8890.63 8169 10160 141360 202091 30.05
 
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2&cooldown.consecration.remains>gcd*2)
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:Strike the target for {$s1=0} Physical damage.{$?s137027=false}[ |cFFFFFFFFGenerates {$s2=0} Holy Power.][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Hammer of Wrath 869 4.8% 18.0 17.01sec 14492 13524 Direct 18.0 10566 22329 14508 33.5%  

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.99 17.97 0.00 0.00 1.0717 0.0000 260681.52 260681.52 0.00 13523.63 13523.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.95 66.49% 10566.17 8563 12454 10578.96 9236 12155 126250 126250 0.00
crit 6.02 33.51% 22328.92 17126 24907 22383.61 0 24907 134431 134431 0.00
 
 

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:7.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=4
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$s1=0} Holy damage. Only usable on enemies that have less than 20% health, or while you are empowered by {$?s231895=false}[Crusade][Avenging Wrath]. |cFFFFFFFFGenerates {$s2=1} Holy Power.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Heed My Call 167 (239) 0.9% (1.3%) 7.8 35.49sec 9144 0 Direct 7.8 5060 10121 6396 26.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.83 7.83 0.00 0.00 0.0000 0.0000 50112.55 50112.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.77 73.60% 5060.45 5060 5060 5056.40 0 5060 29182 29182 0.00
crit 2.07 26.40% 10120.90 10121 10121 8906.23 0 10121 20930 20930 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 72 0.4% 7.8 35.49sec 2747 0 Direct 7.8 2169 4338 2747 26.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.83 7.83 0.00 0.00 0.0000 0.0000 21525.68 21525.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.74 73.32% 2168.76 2169 2169 2167.03 0 2169 12458 12458 0.00
crit 2.09 26.68% 4337.53 4338 4338 3833.15 0 4338 9068 9068 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Judgment 1368 7.6% 33.3 9.08sec 12321 11708 Direct 33.3 9596 20044 12325 26.1%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.26 33.25 0.00 0.00 1.0524 0.0000 409832.86 409832.86 0.00 11707.84 11707.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.57 73.88% 9595.61 8489 12345 9596.58 9119 10192 235717 235717 0.00
crit 8.69 26.12% 20043.68 16978 24691 20078.60 17996 24623 174116 174116 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=4&(cooldown.blade_of_justice.remains>gcd*2|variable.HoW))
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target, dealing {$s1=0} Holy damage{$?s231663=true}[, and causing them to take {$197277s1=25}% increased damage from your next ability that costs Holy Power.][]{$?s137027=false}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Laser Matrix 1376 7.6% 15.8 18.68sec 26189 0 Direct 15.8 20702 41404 26189 26.5%  

Stats details: laser_matrix

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.76 15.76 0.00 0.00 0.0000 0.0000 412609.50 412609.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.58 73.50% 20701.84 20702 20702 20701.84 20702 20702 239712 239712 0.00
crit 4.18 26.50% 41403.67 41404 41404 40906.76 0 41404 172897 172897 0.00
 
 

Action details: laser_matrix

Static Values
  • id:280705
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:280705
  • name:Laser Matrix
  • school:arcane
  • tooltip:
  • description:{$@spelldesc280559=Your spells and abilities have a chance to release a barrage of lasers, dealing {$s1=4508} Arcane damage split among all enemies and restoring {$s2=5635} health split among injured allies. Enables $@spellname280573 within Uldir.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18900.00
  • base_dd_max:18900.00
 
melee 2013 11.2% 115.5 2.59sec 5226 2017 Direct 115.5 4113 8325 5226 26.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.45 115.45 0.00 0.00 2.5908 0.0000 603310.05 862504.17 30.05 2017.04 2017.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.97 73.59% 4113.47 4015 4556 4114.28 4072 4161 349504 499657 30.05
crit 30.49 26.41% 8325.24 8029 9112 8328.99 8126 8614 253806 362847 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
shield_of_vengeance_proc 467 2.6% 3.0 119.82sec 46556 0 Direct 2.9 48574 0 48574 0.0%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.87 0.00 0.00 0.0000 0.0000 139418.84 139418.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.87 100.00% 48573.65 46323 52468 48609.44 48130 49757 139419 139419 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47046.01
  • base_dd_max:47046.01
 
Templar's Verdict 7866 43.6% 70.2 4.21sec 33577 30991 Direct 70.2 25852 54282 33577 27.2%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.20 70.20 0.00 0.00 1.0834 0.0000 2357058.56 2357058.56 0.00 30991.09 30991.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.13 72.83% 25851.89 19321 37750 25862.65 24275 27311 1321697 1321697 0.00
crit 19.07 27.17% 54282.10 38642 75501 54354.03 48234 62241 1035361 1035361 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.divine_purpose.react&(!talent.execution_sentence.enabled|cooldown.execution_sentence.remains>gcd)
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:Unleashes a powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage to an enemy target.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Voided Sectors 387 2.1% 9.8 29.00sec 11816 0 Direct 9.8 9354 18708 11815 26.3%  

Stats details: voided_sectors

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.82 9.82 0.00 0.00 0.0000 0.0000 115973.41 115973.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.23 73.69% 9354.16 9354 9354 9354.16 9354 9354 67655 67655 0.00
crit 2.58 26.31% 18708.33 18708 18708 17411.04 0 18708 48319 48319 0.00
 
 

Action details: voided_sectors

Static Values
  • id:278153
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278153
  • name:Voided Sectors
  • school:shadow
  • tooltip:
  • description:{$@spelldesc278152=Your attacks have a chance to cause a Void Sector, instantly dealing {$278153s1=4256} Shadow damage split among all targets in a cone in front of you.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8539.61
  • base_dd_max:8539.61
 
Wake of Ashes 653 3.6% 6.7 47.79sec 29222 30469 Direct 6.7 22583 47244 29222 26.9%  

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.69 6.69 0.00 0.00 0.9591 0.0000 195491.10 195491.10 0.00 30469.31 30469.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.89 73.08% 22582.55 20915 28427 22556.20 0 28349 110405 110405 0.00
crit 1.80 26.92% 47243.56 41829 56854 41685.19 0 56854 85086 85086 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:255937
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!raid_event.adds.exists|raid_event.adds.in>20)&(holy_power<=0|holy_power=1&cooldown.blade_of_justice.remains>gcd)
Spelldata
  • id:255937
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Lash out at your enemies, dealing $sw1 Radiant damage to all enemies within $a1 yd in front of you and reducing their movement speed by {$s2=50}% for {$d=5 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s3=5} Holy Power.
 
Wasting Infection 105 0.6% 7.8 35.23sec 4022 0 Periodic 43.2 577 1155 729 26.4% 28.5%

Stats details: wasting_infection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.83 0.00 43.19 43.19 0.0000 1.9768 31508.60 31508.60 0.00 369.03 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.8 73.61% 577.09 0 584 577.56 530 584 18349 18349 0.00
crit 11.4 26.39% 1154.67 2 1168 1154.99 0 1168 13159 13159 0.00
 
 

Action details: wasting_infection

Static Values
  • id:278110
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278110
  • name:Wasting Infection
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. The caster's attacks will grant them Critical Strike.
  • description:
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:533.46
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
T22_Paladin_Retribution
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:
 
Avenging Wrath 3.0 120.33sec

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.7462 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.inquisition.up|!talent.inquisition.enabled
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:Damage, healing, and critical strike chance increased by $w1%.
  • description:Call upon the Light to become an avatar of retribution, increasing your damage, healing, and critical strike chance by {$s1=20}% for {$d=20 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:
 
Inquisition 7.3 43.88sec

Stats details: inquisition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 7.25 0.00 13.92 0.00 0.9719 7.5199 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:buff.inquisition.down|buff.inquisition.remains<5&holy_power>=3|talent.execution_sentence.enabled&cooldown.execution_sentence.remains<10&buff.inquisition.remains<15|cooldown.avenging_wrath.remains<15&buff.inquisition.remains<20&holy_power>=3
Spelldata
  • id:84963
  • name:Inquisition
  • school:holy
  • tooltip:Damage done increased by $w1%. Haste increased by $w3%.
  • description:Consumes up to 3 Holy Power to increase your damage done and Haste by {$s1=7}%. Lasts {$d=15 seconds} per Holy Power consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rebuke 10.4 30.01sec

Stats details: rebuke

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rebuke

Static Values
  • id:96231
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96231
  • name:Rebuke
  • school:physical
  • tooltip:
  • description:Interrupts spellcasting and prevents any spell in that school from being cast for {$d=4 seconds}.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Shield of Vengeance 3.0 120.32sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 2.99 2.99 0.00 0.00 0.7496 0.0000 0.00 145227.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.99 100.00% 0.00 0 0 0.00 0 0 0 145228 100.00
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs ${{$s2=30}/100*$MHP} damage for {$d=15 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avenging Wrath 3.0 0.0 120.3sec 120.3sec 19.28% 13.27% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • avenging_wrath_1:19.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:Damage, healing, and critical strike chance increased by $w1%.
  • description:Call upon the Light to become an avatar of retribution, increasing your damage, healing, and critical strike chance by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Battle Potion of Strength 2.0 0.0 125.7sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_battle_potion_of_strength
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:900.00

Stack Uptimes

  • battle_potion_of_strength_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279153
  • name:Battle Potion of Strength
  • tooltip:Strength increased by $w1.
  • description:Increases your Strength by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259456
  • name:Well Fed
  • tooltip:Strength increased by $w1.
  • description:Strength increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Critical Prowess 1.0 149.3 0.0sec 2.0sec 99.57% 0.00% 145.3(145.3) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_critical_prowess
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Syringe of Bloodborne Infirmity

Stat Buff details

  • stat:crit_rating
  • amount:101.29

Stack Uptimes

  • critical_prowess_1:0.43%
  • critical_prowess_2:0.74%
  • critical_prowess_3:0.42%
  • critical_prowess_4:0.61%
  • critical_prowess_5:97.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278108
  • name:Critical Prowess
  • tooltip:Increases your Critical Strike by $w1.
  • description:
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Earthlink 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_earthlink
  • max_stacks:6
  • duration:900.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:strength
  • amount:24.00

Stack Uptimes

  • earthlink_1:16.67%
  • earthlink_2:16.67%
  • earthlink_3:16.67%
  • earthlink_4:16.67%
  • earthlink_5:16.67%
  • earthlink_6:16.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279928
  • name:Earthlink
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by $w1.
  • description:{$@spelldesc279926=Azerite energy courses through you, reaching ${{$s1=11}*6} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] and then diminishing down to {$s1=11} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat], cycling every 6 sec.}
  • max_stacks:6
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of the Undertow 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_flask_of_the_undertow
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:238.00

Stack Uptimes

  • flask_of_the_undertow_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251839
  • name:Flask of the Undertow
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inquisition 1.6 5.7 119.3sec 43.9sec 98.76% 99.06% 14.4(14.4) 0.6

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_inquisition
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:15.00

Stack Uptimes

  • inquisition_1:98.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84963
  • name:Inquisition
  • tooltip:Damage done increased by $w1%. Haste increased by $w3%.
  • description:Consumes up to 3 Holy Power to increase your damage done and Haste by {$s1=7}%. Lasts {$d=15 seconds} per Holy Power consumed.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 5.1 0.0 57.6sec 35.6sec 39.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.54%
  • overwhelming_power_2:1.54%
  • overwhelming_power_3:1.55%
  • overwhelming_power_4:1.55%
  • overwhelming_power_5:1.56%
  • overwhelming_power_6:1.56%
  • overwhelming_power_7:1.57%
  • overwhelming_power_8:1.57%
  • overwhelming_power_9:1.58%
  • overwhelming_power_10:1.59%
  • overwhelming_power_11:1.59%
  • overwhelming_power_12:1.60%
  • overwhelming_power_13:1.60%
  • overwhelming_power_14:1.61%
  • overwhelming_power_15:1.61%
  • overwhelming_power_16:1.61%
  • overwhelming_power_17:1.62%
  • overwhelming_power_18:1.63%
  • overwhelming_power_19:1.63%
  • overwhelming_power_20:1.64%
  • overwhelming_power_21:1.64%
  • overwhelming_power_22:1.65%
  • overwhelming_power_23:1.66%
  • overwhelming_power_24:1.68%
  • overwhelming_power_25:0.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.0 52.3sec 10.3sec 68.84% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.09%
  • quick_navigation_2:17.41%
  • quick_navigation_3:16.90%
  • quick_navigation_4:16.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.3sec 52.3sec 17.97% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Relentless Inquisitor 3.4 66.8 71.2sec 4.2sec 96.76% 0.00% 49.8(143.1) 2.4

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_relentless_inquisitor
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:14.00

Stack Uptimes

  • relentless_inquisitor_3:3.70%
  • relentless_inquisitor_6:3.63%
  • relentless_inquisitor_9:4.14%
  • relentless_inquisitor_12:4.21%
  • relentless_inquisitor_15:3.69%
  • relentless_inquisitor_18:4.34%
  • relentless_inquisitor_20:73.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279204
  • name:Relentless Inquisitor
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc278617=Spending Holy Power grants you {$s1=0} haste for {$279204d=10 seconds} per Holy Power spent, stacking up to {$279204u=20} times. }
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Righteous Verdict 70.2 0.0 4.2sec 4.2sec 88.99% 83.60% 0.0(0.0) 10.5

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_righteous_verdict
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • righteous_verdict_1:88.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267611
  • name:Righteous Verdict
  • tooltip:Damage done by Templar's Verdict increased by {$s1=15}%.
  • description:{$@spelldesc267610=Templar's Verdict increases the damage of your next Templar's Verdict by {$267611s1=15}% for {$267611d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shield of Vengeance 3.0 0.0 120.3sec 120.3sec 14.79% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shield_of_vengeance_1:14.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs ${{$s2=30}/100*$MHP} damage for {$d=15 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
art_of_war 15.8 18.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Rebuke15.4420.00134.057145.571103.964206.526
Shield of Vengeance0.4590.0011.1550.6280.0002.036
Avenging Wrath0.4250.0011.1710.6520.0001.945
Wake of Ashes3.0580.00122.44816.0670.97142.547
Blade of Justice0.6200.0016.51320.4285.57239.979
Judgment0.6400.00110.51114.8763.17731.285
Hammer of Wrath0.7440.0019.33410.6161.29925.442
Crusader Strike2.2230.00126.18422.4862.22854.023

Resources

Resource Usage Type Count Total Average RPE APR
T22_Paladin_Retribution
inquisition Holy Power 7.3 21.7 3.0 3.0 0.0
templars_verdict Holy Power 70.2 210.6 3.0 3.0 11192.2
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 6.69 31.22 (13.31%) 4.67 2.23 6.67%
blade_of_justice Holy Power 45.20 90.40 (38.53%) 2.00 0.00 0.00%
judgment Holy Power 33.25 33.25 (14.17%) 1.00 0.00 0.00%
hammer_of_wrath Holy Power 17.99 17.99 (7.67%) 1.00 0.00 0.00%
crusader_strike Holy Power 61.76 61.76 (26.32%) 1.00 0.00 0.00%
mana_regen Mana 660.45 0.00 (0.00%) 0.00 89856.39 100.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.78 0.77
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Holy Power 2.33 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T22_Paladin_Retribution Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Paladin_Retribution Damage Per Second
Count 7499
Mean 18048.26
Minimum 16212.44
Maximum 20337.50
Spread ( max - min ) 4125.06
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 562.4673
5th Percentile 17161.42
95th Percentile 19013.76
( 95th Percentile - 5th Percentile ) 1852.34
Mean Distribution
Standard Deviation 6.4952
95.00% Confidence Intervall ( 18035.53 - 18060.99 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3731
0.1 Scale Factor Error with Delta=300 2701
0.05 Scale Factor Error with Delta=300 10803
0.01 Scale Factor Error with Delta=300 270072
Priority Target DPS
Sample Data T22_Paladin_Retribution Priority Target Damage Per Second
Count 7499
Mean 18048.26
Minimum 16212.44
Maximum 20337.50
Spread ( max - min ) 4125.06
Range [ ( max - min ) / 2 * 100% ] 11.43%
Standard Deviation 562.4673
5th Percentile 17161.42
95th Percentile 19013.76
( 95th Percentile - 5th Percentile ) 1852.34
Mean Distribution
Standard Deviation 6.4952
95.00% Confidence Intervall ( 18035.53 - 18060.99 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3731
0.1 Scale Factor Error with Delta=300 2701
0.05 Scale Factor Error with Delta=300 10803
0.01 Scale Factor Error with Delta=300 270072
DPS(e)
Sample Data T22_Paladin_Retribution Damage Per Second (Effective)
Count 7499
Mean 18048.26
Minimum 16212.44
Maximum 20337.50
Spread ( max - min ) 4125.06
Range [ ( max - min ) / 2 * 100% ] 11.43%
Damage
Sample Data T22_Paladin_Retribution Damage
Count 7499
Mean 5408335.00
Minimum 4051771.33
Maximum 6892009.23
Spread ( max - min ) 2840237.90
Range [ ( max - min ) / 2 * 100% ] 26.26%
DTPS
Sample Data T22_Paladin_Retribution Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Paladin_Retribution Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Paladin_Retribution Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Paladin_Retribution Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Paladin_Retribution Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Paladin_Retribution Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Paladin_RetributionTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Paladin_Retribution Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 10.39 rebuke
7 0.00 call_action_list,name=opener
8 0.00 call_action_list,name=cooldowns
9 0.00 call_action_list,name=generators
actions.cooldowns
# count action,conditions
A 1.00 potion,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up&buff.crusade.remains<25|target.time_to_die<=40)
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|(!raid_event.adds.exists|raid_event.adds.in>75)
B 2.00 shield_of_vengeance
C 1.96 avenging_wrath,if=buff.inquisition.up|!talent.inquisition.enabled
0.00 crusade,if=holy_power>=4
actions.finishers
# count action,conditions
0.00 variable,name=ds_castable,value=spell_targets.divine_storm>=3|!talent.righteous_verdict.enabled&talent.divine_judgment.enabled&spell_targets.divine_storm>=2|azerite.divine_right.enabled&target.health.pct<=20&buff.divine_right.down
D 6.25 inquisition,if=buff.inquisition.down|buff.inquisition.remains<5&holy_power>=3|talent.execution_sentence.enabled&cooldown.execution_sentence.remains<10&buff.inquisition.remains<15|cooldown.avenging_wrath.remains<15&buff.inquisition.remains<20&holy_power>=3
0.00 execution_sentence,if=spell_targets.divine_storm<=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 divine_storm,if=variable.ds_castable&buff.divine_purpose.react
0.00 divine_storm,if=variable.ds_castable&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 templars_verdict,if=buff.divine_purpose.react&(!talent.execution_sentence.enabled|cooldown.execution_sentence.remains>gcd)
E 70.20 templars_verdict,if=(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)&(!talent.execution_sentence.enabled|buff.crusade.up&buff.crusade.stack<10|cooldown.execution_sentence.remains>gcd*2)
actions.generators
# count action,conditions
0.00 variable,name=HoW,value=(!talent.hammer_of_wrath.enabled|target.health.pct>=20&(buff.avenging_wrath.down|buff.crusade.down))
F 0.00 call_action_list,name=finishers,if=holy_power>=5
G 5.69 wake_of_ashes,if=(!raid_event.adds.exists|raid_event.adds.in>20)&(holy_power<=0|holy_power=1&cooldown.blade_of_justice.remains>gcd)
H 44.20 blade_of_justice,if=holy_power<=2|(holy_power=3&(cooldown.hammer_of_wrath.remains>gcd*2|variable.HoW))
I 32.26 judgment,if=holy_power<=2|(holy_power<=4&(cooldown.blade_of_justice.remains>gcd*2|variable.HoW))
J 17.99 hammer_of_wrath,if=holy_power<=4
0.00 consecration,if=holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2
K 0.00 call_action_list,name=finishers,if=talent.hammer_of_wrath.enabled&(target.health.pct<=20|buff.avenging_wrath.up|buff.crusade.up)&(buff.divine_purpose.up|buff.crusade.stack<10)
L 14.29 crusader_strike,if=cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2&cooldown.consecration.remains>gcd*2)
M 0.00 call_action_list,name=finishers
N 47.47 crusader_strike,if=holy_power<=4
0.00 arcane_torrent,if=(debuff.execution_sentence.up|(talent.hammer_of_wrath.enabled&(target.health.pct>=20|buff.avenging_wrath.down|buff.crusade.down))|!talent.execution_sentence.enabled|!talent.hammer_of_wrath.enabled)&holy_power<=4
actions.opener
# count action,conditions
0.00 sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&talent.execution_sentence.enabled&!talent.hammer_of_wrath.enabled,name=wake_opener_ES_CS:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:crusader_strike:execution_sentence
0.00 sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&!talent.execution_sentence.enabled&!talent.hammer_of_wrath.enabled,name=wake_opener_CS:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:crusader_strike:templars_verdict
0.00 sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&talent.execution_sentence.enabled&talent.hammer_of_wrath.enabled,name=wake_opener_ES_HoW:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:hammer_of_wrath:execution_sentence
0.00 sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&!talent.execution_sentence.enabled&talent.hammer_of_wrath.enabled,name=wake_opener_HoW:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:hammer_of_wrath:templars_verdict
O 6.00 sequence,if=talent.wake_of_ashes.enabled&talent.inquisition.enabled,name=wake_opener_Inq:shield_of_vengeance:blade_of_justice:judgment:inquisition:avenging_wrath:wake_of_ashes

Sample Sequence

01245OO6OOOOEJHEIEJLNHEJIEHEJLNEIHENNHIENENHEIN6NHDNIEHEGENEIHLENNHEIENHEH6ILENNHEIENHDNINHENEGEHIEHEHL6ENIENBHDNCAIJEHNEJNIEHJELNIHENEGEN6HEHIELENHEINNEHNEINHDNIENHE6NIHEGELEHILEN6NHEIENHENINDH6NEHIENNHEIBJEGCEH6IEHJELENIHJEH6ELJIDLHJELEIJHELNJEHIEJL6EGEHIEJELN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Paladin_Retribution 20000.0/20000: 100% mana | 0.0/5: 0% holy_power
Pre precombat 1 food T22_Paladin_Retribution 20000.0/20000: 100% mana | 0.0/5: 0% holy_power
Pre precombat 2 augmentation T22_Paladin_Retribution 20000.0/20000: 100% mana | 0.0/5: 0% holy_power
Pre precombat 4 potion Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power battle_potion_of_strength
0:00.000 default 5 auto_attack Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power battle_potion_of_strength
0:00.000 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power battle_potion_of_strength
0:01.285 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, shield_of_vengeance, battle_potion_of_strength
0:02.274 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, shield_of_vengeance, quick_navigation, critical_prowess, battle_potion_of_strength
0:02.274 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, shield_of_vengeance, quick_navigation, critical_prowess, battle_potion_of_strength
0:03.256 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, shield_of_vengeance, quick_navigation, critical_prowess(2), battle_potion_of_strength
0:04.238 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, inquisition, shield_of_vengeance, quick_navigation, critical_prowess(2), battle_potion_of_strength
0:05.156 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, inquisition, shield_of_vengeance, avenging_wrath, quick_navigation, critical_prowess(3), battle_potion_of_strength
0:06.074 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power bloodlust, inquisition, shield_of_vengeance, avenging_wrath, quick_navigation, critical_prowess(3), battle_potion_of_strength
0:06.999 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation, critical_prowess(4), battle_potion_of_strength
0:07.916 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation, critical_prowess(4), battle_potion_of_strength
0:08.834 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:09.752 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:10.665 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:11.577 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(9), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:12.484 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(9), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:13.391 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(9), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:14.298 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(9), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:15.205 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(9), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:16.113 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:17.017 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:17.921 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:18.824 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(15), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:19.724 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(15), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:20.623 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(18), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:21.516 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(18), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:22.409 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(18), avenging_wrath, quick_navigation, critical_prowess(5), battle_potion_of_strength
0:23.304 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(18), avenging_wrath, quick_navigation, critical_prowess(5)
0:24.197 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
0:25.082 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
0:25.967 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
0:26.853 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
0:27.737 Waiting     0.600 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
0:28.337 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
0:29.469 Waiting     1.600 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
0:31.069 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:32.127 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power bloodlust, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:33.008 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power bloodlust, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:33.887 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:34.766 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:35.643 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:36.523 Waiting     0.700 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:37.223 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:38.256 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:39.136 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:40.015 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:40.895 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:40.895 Waiting     2.000 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:42.895 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:44.233 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:45.375 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 5.0/5: 100% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:46.517 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:47.417 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
0:48.789 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, quick_navigation(3), critical_prowess(5)
0:49.973 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power inquisition, quick_navigation(4), critical_prowess(5)
0:51.149 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(4), critical_prowess(5)
0:52.319 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(4), critical_prowess(5)
0:53.486 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(4), critical_prowess(5)
0:54.650 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(4), critical_prowess(5)
0:55.815 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation(4), critical_prowess(5)
0:56.972 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation(4), critical_prowess(5)
0:58.130 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation(4), critical_prowess(5)
0:59.282 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation(4), critical_prowess(5)
1:00.435 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation(4), critical_prowess(5)
1:01.586 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation(4), critical_prowess(5)
1:02.738 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation(4), critical_prowess(5)
1:03.882 Waiting     2.000 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation(4), critical_prowess(5)
1:05.882 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation(4), critical_prowess(5)
1:07.170 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, critical_prowess(5)
1:08.264 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power inquisition, relentless_inquisitor(15), quick_navigation_final, critical_prowess(5)
1:09.356 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5)
1:10.442 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5)
1:11.528 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(24), critical_prowess(5)
1:12.541 Waiting     1.700 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(23), critical_prowess(5)
1:14.241 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(21), critical_prowess(5)
1:15.494 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(19), critical_prowess(5)
1:16.520 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), overwhelming_power(18), critical_prowess(5)
1:17.623 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), overwhelming_power(17), critical_prowess(5)
1:17.623 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), overwhelming_power(17), critical_prowess(5)
1:18.774 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), overwhelming_power(16), critical_prowess(5)
1:19.883 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), overwhelming_power(14), critical_prowess(5)
1:20.999 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), overwhelming_power(13), critical_prowess(5)
1:22.118 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), overwhelming_power(11), critical_prowess(5)
1:23.018 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), overwhelming_power(10), critical_prowess(5)
1:24.367 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(9), critical_prowess(5)
1:25.494 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(8), critical_prowess(5)
1:26.623 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(7), critical_prowess(5)
1:27.756 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(6), critical_prowess(5)
1:28.893 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(5), critical_prowess(5)
1:30.030 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(2), critical_prowess(5)
1:31.180 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power, critical_prowess(5)
1:32.333 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:33.490 Waiting     2.100 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:35.590 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:36.936 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:38.093 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, quick_navigation(2), critical_prowess(5)
1:39.282 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power inquisition, quick_navigation(2), critical_prowess(5)
1:40.474 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(2), critical_prowess(5)
1:41.374 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(2), critical_prowess(5)
1:42.804 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(2), critical_prowess(5)
1:43.989 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(2), critical_prowess(5)
1:45.165 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(2), critical_prowess(5)
1:46.342 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation(2), critical_prowess(5)
1:47.515 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation(2), critical_prowess(5)
1:48.686 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation(2), critical_prowess(5)
1:49.859 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation(2), critical_prowess(5)
1:51.024 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation(2), critical_prowess(5)
1:52.190 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation(2), critical_prowess(5)
1:53.351 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation(2), critical_prowess(5)
1:54.511 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation(2), critical_prowess(5)
1:54.511 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation(2), critical_prowess(5)
1:55.670 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation(2), critical_prowess(5)
1:56.824 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation(3), critical_prowess(5)
1:57.970 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation(3), critical_prowess(5)
1:59.117 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
2:00.259 cooldowns B shield_of_vengeance T22_Paladin_Retribution 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
2:01.400 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
2:02.543 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
2:03.684 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
2:04.827 cooldowns C avenging_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
2:05.962 cooldowns A potion Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation(4), critical_prowess(5)
2:05.962 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:07.097 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:08.232 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, shield_of_vengeance, avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:09.406 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:10.576 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:11.748 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:12.917 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:14.080 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:15.243 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:16.406 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:17.569 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:18.727 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:19.884 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:21.040 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:22.138 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:23.235 Waiting     0.800 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:24.035 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:25.332 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:26.438 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power inquisition, relentless_inquisitor(12), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:27.534 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:28.627 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:29.720 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:30.805 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), critical_prowess(5), battle_potion_of_strength
2:31.973 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
2:33.137 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:33.137 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:34.310 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:35.466 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:36.621 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:37.779 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:38.937 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:40.096 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:41.253 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:42.411 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:43.311 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:44.691 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:45.847 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:47.003 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:48.159 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:49.373 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:50.528 Waiting     0.900 sec 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:51.428 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:52.761 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:53.969 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:55.117 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:56.265 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:57.165 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:58.553 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:59.453 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:00.772 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 4.0/5: 80% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(24), critical_prowess(5)
3:01.839 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(23), critical_prowess(5)
3:02.908 Waiting     0.800 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(22), critical_prowess(5)
3:03.708 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(21), critical_prowess(5)
3:05.024 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, quick_navigation(4), overwhelming_power(19), critical_prowess(5)
3:06.133 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(4), overwhelming_power(18), critical_prowess(5)
3:07.252 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(4), overwhelming_power(17), critical_prowess(5)
3:08.363 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(4), overwhelming_power(16), critical_prowess(5)
3:09.476 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(4), overwhelming_power(15), critical_prowess(5)
3:09.476 Waiting     0.900 sec 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(4), overwhelming_power(15), critical_prowess(5)
3:10.376 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(4), overwhelming_power(14), critical_prowess(5)
3:11.686 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(4), overwhelming_power(13), critical_prowess(5)
3:12.586 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(4), overwhelming_power(12), critical_prowess(5)
3:13.928 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(4), overwhelming_power(10), critical_prowess(5)
3:14.828 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(6), quick_navigation(4), overwhelming_power(9), critical_prowess(5)
3:16.187 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power inquisition, relentless_inquisitor(6), quick_navigation(4), overwhelming_power(7), critical_prowess(5)
3:17.327 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation(4), overwhelming_power(6), critical_prowess(5)
3:18.464 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation(4), overwhelming_power(5), critical_prowess(5)
3:19.602 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation(4), overwhelming_power(4), critical_prowess(5)
3:20.739 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation(4), overwhelming_power(3), critical_prowess(5)
3:21.881 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, overwhelming_power(2), critical_prowess(5)
3:22.967 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, overwhelming_power, critical_prowess(5)
3:24.056 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, critical_prowess(5)
3:25.148 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, critical_prowess(5)
3:26.239 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5)
3:27.327 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5)
3:27.327 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5)
3:28.227 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5)
3:29.481 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5)
3:30.568 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5)
3:31.656 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:32.867 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:34.032 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:35.196 Waiting     2.100 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:37.296 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:38.664 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:39.820 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:40.969 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:42.120 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:43.270 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:44.421 Waiting     0.900 sec 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:45.321 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:46.684 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:46.684 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:47.832 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:48.982 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:50.130 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:51.285 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:52.433 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:53.581 Waiting     2.000 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
3:55.581 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:56.943 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
3:58.026 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
3:59.111 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:00.196 cooldowns B shield_of_vengeance T22_Paladin_Retribution 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:01.341 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:02.425 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:03.508 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:04.592 cooldowns C avenging_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:05.911 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation_final, critical_prowess(5)
4:06.994 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, critical_prowess(5)
4:08.156 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:08.156 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:09.311 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:10.468 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:11.623 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:12.781 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:13.936 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:15.094 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:16.244 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:17.393 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:18.543 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), critical_prowess(5)
4:19.686 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), critical_prowess(5)
4:20.829 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), critical_prowess(5)
4:21.970 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), critical_prowess(5)
4:23.113 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), critical_prowess(5)
4:23.156 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), critical_prowess(5)
4:24.299 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), critical_prowess(5)
4:25.442 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
4:26.587 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
4:27.729 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(24), critical_prowess(5)
4:28.793 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(23), critical_prowess(5)
4:29.861 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(22), critical_prowess(5)
4:30.933 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(21), critical_prowess(5)
4:32.007 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(19), critical_prowess(5)
4:33.088 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(18), critical_prowess(5)
4:34.171 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(16), critical_prowess(5)
4:35.261 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(15), critical_prowess(5)
4:36.354 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(14), critical_prowess(5)
4:37.450 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(13), critical_prowess(5)
4:38.543 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(12), critical_prowess(5)
4:39.639 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(11), critical_prowess(5)
4:40.738 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(10), critical_prowess(5)
4:41.840 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(8), critical_prowess(5)
4:42.948 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(7), critical_prowess(5)
4:44.060 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(5), critical_prowess(5)
4:45.179 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(4), critical_prowess(5)
4:46.301 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(3), critical_prowess(5)
4:47.426 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(2), critical_prowess(5)
4:48.555 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power, critical_prowess(5)
4:49.688 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:49.688 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:50.823 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:51.957 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:53.094 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:54.230 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:55.366 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:56.449 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:57.531 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:58.613 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:59.697 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)

Stats

Level Bonus (120) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength 1467 0 6565 6147 4388 (3433)
Agility 1467 0 1467 1467 0
Stamina 1001 0 13091 11901 7207
Intellect 1467 0 1613 1467 0
Spirit 0 0 0 0 0
Health 261820 238020 0
Mana 20000 20000 0
Holy Power 5 5 0
Spell Power 8500 7326 0
Crit 15.32% 15.32% 743
Haste 16.65% 16.65% 1132
Damage / Heal Versatility 4.32% 4.32% 367
ManaReg per Second 300 300 0
Attack Power 7222 6147 0
Mastery 31.07% 31.07% 822
Armor 4055 4055 4055
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Helm of the Defiled Laboratorium
ilevel: 390, stats: { 571 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Laser Matrix, Heed My Call, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Pauldrons of the Horned Horror
ilevel: 390, stats: { 527 Armor, +491 StrInt, +892 Sta }
azerite powers: { Relentless Inquisitor, Overwhelming Power, Azerite Empowered }
Local Chest Chestplate of Apocalyptic Machinations
ilevel: 390, stats: { 702 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Laser Matrix, Earthlink, Azerite Empowered }
Local Waist Decontaminator's Greatbelt
ilevel: 385, stats: { 382 Armor, +247 StrInt, +417 Sta, +123 Mastery, +60 Crit }
Local Legs Greaves of Unending Vigil
ilevel: 385, stats: { 594 Armor, +329 StrInt, +556 Sta, +165 Haste, +81 Mastery }
Local Feet Warboots of Absolute Eradication
ilevel: 385, stats: { 467 Armor, +247 StrInt, +417 Sta, +111 Haste, +72 Vers }
Local Wrists Imperious Vambraces
ilevel: 385, stats: { 297 Armor, +185 StrInt, +312 Sta, +83 Vers, +54 Haste }
Local Hands Waste Disposal Crushers
ilevel: 385, stats: { 424 Armor, +247 StrInt, +417 Sta, +115 Crit, +68 Vers }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Syringe of Bloodborne Infirmity
ilevel: 385, stats: { +313 Str }
Local Trinket2 Disc of Systematic Regression
ilevel: 385, stats: { +313 Str }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Voror, Gleaming Blade of the Stalwart
ilevel: 385, weapon: { 667 - 1114, 3.6 }, stats: { +329 Str, +556 Sta, +137 Vers, +109 Mastery }, enchant: quick_navigation

Talents

Level
15 Zeal (Retribution Paladin) Righteous Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin)
30 Fires of Justice (Retribution Paladin) Blade of Wrath (Retribution Paladin) Hammer of Wrath (Retribution Paladin)
45 Fist of Justice (Retribution Paladin) Repentance Blinding Light
60 Divine Judgment (Retribution Paladin) Consecration (Retribution Paladin) Wake of Ashes (Retribution Paladin)
75 Unbreakable Spirit (Retribution Paladin) Cavalier (Retribution Paladin) Eye for an Eye (Retribution Paladin)
90 Selfless Healer (Retribution Paladin) Justicar's Vengeance (Retribution Paladin) Word of Glory (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Inquisition (Retribution Paladin)

Profile

paladin="T22_Paladin_Retribution"
spec=retribution
level=120
race=human
role=attack
position=back
talents=2303003

# Default consumables
potion=battle_potion_of_strength
flask=flask_of_the_undertow
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/call_action_list,name=opener
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=generators

actions.cooldowns=potion,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up&buff.crusade.remains<25|target.time_to_die<=40)
actions.cooldowns+=/lights_judgment,if=spell_targets.lights_judgment>=2|(!raid_event.adds.exists|raid_event.adds.in>75)
actions.cooldowns+=/shield_of_vengeance
actions.cooldowns+=/avenging_wrath,if=buff.inquisition.up|!talent.inquisition.enabled
actions.cooldowns+=/crusade,if=holy_power>=4

actions.finishers=variable,name=ds_castable,value=spell_targets.divine_storm>=3|!talent.righteous_verdict.enabled&talent.divine_judgment.enabled&spell_targets.divine_storm>=2|azerite.divine_right.enabled&target.health.pct<=20&buff.divine_right.down
actions.finishers+=/inquisition,if=buff.inquisition.down|buff.inquisition.remains<5&holy_power>=3|talent.execution_sentence.enabled&cooldown.execution_sentence.remains<10&buff.inquisition.remains<15|cooldown.avenging_wrath.remains<15&buff.inquisition.remains<20&holy_power>=3
actions.finishers+=/execution_sentence,if=spell_targets.divine_storm<=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions.finishers+=/divine_storm,if=variable.ds_castable&buff.divine_purpose.react
actions.finishers+=/divine_storm,if=variable.ds_castable&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions.finishers+=/templars_verdict,if=buff.divine_purpose.react&(!talent.execution_sentence.enabled|cooldown.execution_sentence.remains>gcd)
actions.finishers+=/templars_verdict,if=(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)&(!talent.execution_sentence.enabled|buff.crusade.up&buff.crusade.stack<10|cooldown.execution_sentence.remains>gcd*2)

actions.generators=variable,name=HoW,value=(!talent.hammer_of_wrath.enabled|target.health.pct>=20&(buff.avenging_wrath.down|buff.crusade.down))
actions.generators+=/call_action_list,name=finishers,if=holy_power>=5
actions.generators+=/wake_of_ashes,if=(!raid_event.adds.exists|raid_event.adds.in>20)&(holy_power<=0|holy_power=1&cooldown.blade_of_justice.remains>gcd)
actions.generators+=/blade_of_justice,if=holy_power<=2|(holy_power=3&(cooldown.hammer_of_wrath.remains>gcd*2|variable.HoW))
actions.generators+=/judgment,if=holy_power<=2|(holy_power<=4&(cooldown.blade_of_justice.remains>gcd*2|variable.HoW))
actions.generators+=/hammer_of_wrath,if=holy_power<=4
actions.generators+=/consecration,if=holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2
actions.generators+=/call_action_list,name=finishers,if=talent.hammer_of_wrath.enabled&(target.health.pct<=20|buff.avenging_wrath.up|buff.crusade.up)&(buff.divine_purpose.up|buff.crusade.stack<10)
actions.generators+=/crusader_strike,if=cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2&cooldown.consecration.remains>gcd*2)
actions.generators+=/call_action_list,name=finishers
actions.generators+=/crusader_strike,if=holy_power<=4
actions.generators+=/arcane_torrent,if=(debuff.execution_sentence.up|(talent.hammer_of_wrath.enabled&(target.health.pct>=20|buff.avenging_wrath.down|buff.crusade.down))|!talent.execution_sentence.enabled|!talent.hammer_of_wrath.enabled)&holy_power<=4

actions.opener=sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&talent.execution_sentence.enabled&!talent.hammer_of_wrath.enabled,name=wake_opener_ES_CS:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:crusader_strike:execution_sentence
actions.opener+=/sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&!talent.execution_sentence.enabled&!talent.hammer_of_wrath.enabled,name=wake_opener_CS:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:crusader_strike:templars_verdict
actions.opener+=/sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&talent.execution_sentence.enabled&talent.hammer_of_wrath.enabled,name=wake_opener_ES_HoW:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:hammer_of_wrath:execution_sentence
actions.opener+=/sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&!talent.execution_sentence.enabled&talent.hammer_of_wrath.enabled,name=wake_opener_HoW:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:hammer_of_wrath:templars_verdict
actions.opener+=/sequence,if=talent.wake_of_ashes.enabled&talent.inquisition.enabled,name=wake_opener_Inq:shield_of_vengeance:blade_of_justice:judgment:inquisition:avenging_wrath:wake_of_ashes

head=helm_of_the_defiled_laboratorium,id=160732,bonus_id=4824/1507/4775,azerite_powers=485/22/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=pauldrons_of_the_horned_horror,id=159455,bonus_id=1557/4819/4775/4786,azerite_powers=154/30/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=chestplate_of_apocalyptic_machinations,id=160722,bonus_id=4824/1507/4775,azerite_powers=485/461/13
wrists=imperious_vambraces,id=160723,bonus_id=4800/1507
hands=waste_disposal_crushers,id=160635,bonus_id=4800/1507
waist=decontaminators_greatbelt,id=160638,bonus_id=4800/1507
legs=greaves_of_unending_vigil,id=160639,bonus_id=4800/1507
feet=warboots_of_absolute_eradication,id=160640,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=syringe_of_bloodborne_infirmity,id=160655,bonus_id=4800/1507
trinket2=disc_of_systematic_regression,id=160650,bonus_id=4800/1507
main_hand=voror_gleaming_blade_of_the_stalwart,id=160686,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=386.27
# gear_strength=4388
# gear_stamina=7207
# gear_crit_rating=728
# gear_haste_rating=1110
# gear_mastery_rating=806
# gear_versatility_rating=360
# gear_armor=4055

T22_Priest_Shadow : 13999 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
13999.2 13999.2 8.2 / 0.058% 1420.4 / 10.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 43.4 100.0% 100%
Talents
  • 15: Shadow Word: Void (Shadow Priest)
  • 30: Body and Soul
  • 45: Twist of Fate (Shadow Priest)
  • 60: Last Word (Shadow Priest)
  • 75: Shadow Crash (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Dark Ascension (Shadow Priest)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Priest_Shadow 13999
Dark Ascension 0 (457) 0.0% (3.3%) 5.5 60.39sec 24940 20812

Stats details: dark_ascension

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1984 0.0000 0.00 0.00 0.00 20811.73 20811.73
 
 

Action details: dark_ascension

Static Values
  • id:280711
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.voidform.down
Spelldata
  • id:280711
  • name:Dark Ascension
  • school:shadow
  • tooltip:
  • description:Immediately activates a new Voidform, then releases an explosive blast of pure void energy, causing ${{$280800s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. |cFFFFFFFFGenerates ${{$s2=5000}/100} Insanity.|r
 
    Dark Ascension (_damage) 457 3.3% 5.5 60.39sec 24940 0 Direct 10.9 8602 25640 12512 22.9%  

Stats details: dark_ascension_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 10.90 0.00 0.00 0.0000 0.0000 136379.25 136379.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.40 77.05% 8601.79 7808 10815 8600.78 0 10660 72242 72242 0.00
crit 2.50 22.95% 25640.28 15616 43262 19340.69 0 32446 64137 64137 0.00
 
 

Action details: dark_ascension_damage

Static Values
  • id:280800
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:27.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:280800
  • name:Dark Ascension
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280711=Immediately activates a new Voidform, then releases an explosive blast of pure void energy, causing ${{$280800s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. |cFFFFFFFFGenerates ${{$s2=5000}/100} Insanity.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 144 (206) 1.0% (1.5%) 7.4 37.39sec 8395 0 Direct 7.4 4823 9650 5874 21.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.35 7.35 0.00 0.00 0.0000 0.0000 43187.99 43187.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.75 78.22% 4822.59 4714 5185 4819.95 0 5185 27734 27734 0.00
crit 1.60 21.78% 9649.78 9427 10370 7801.67 0 10370 15454 15454 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4422.00
  • base_dd_max:4422.00
 
    Heed My Call (_aoe) 62 0.4% 7.4 37.39sec 2521 0 Direct 7.4 2067 4134 2521 22.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.35 7.35 0.00 0.00 0.0000 0.0000 18535.95 18535.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.74 78.02% 2066.90 2020 2222 2066.16 0 2222 11857 11857 0.00
crit 1.62 21.98% 4133.67 4040 4444 3354.37 0 4444 6679 6679 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1895.00
  • base_dd_max:1895.00
 
Shadow Word: Void (mind_blast) 2561 18.3% 49.2 5.99sec 15584 13561 Direct 50.2 12481 24850 15273 22.6%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.23 50.23 0.00 0.00 1.1491 0.0000 767247.80 767247.80 0.00 13561.37 13561.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.90 77.43% 12481.36 11449 15725 12485.45 12099 13123 485466 485466 0.00
crit 11.34 22.57% 24850.21 22898 31450 24849.42 22967 29241 281782 281782 0.00
 
 

Action details: mind_blast

Static Values
  • id:205351
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • cooldown hasted:true
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205351
  • name:Shadow Word: Void
  • school:shadow
  • tooltip:
  • description:Blasts the target with a word of void for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 2453 17.5% 76.4 3.82sec 9625 6362 Periodic 198.4 3024 6012 3707 22.9% 37.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.40 0.00 198.37 198.37 1.5128 0.5714 735328.39 735328.39 0.00 6362.40 6362.40
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.0 77.15% 3023.84 2774 3842 3024.56 2946 3137 462772 462772 0.00
crit 45.3 22.85% 6012.36 5536 7685 6012.80 5714 6315 272556 272556 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=50}%.$?a185916[ |cFFFFFFFFGenerates ${{$s4=4}*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.337500
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Crash 0 (546) 0.0% (3.9%) 14.8 20.76sec 11060 9532

Stats details: shadow_crash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.81 0.00 0.00 0.00 1.1604 0.0000 0.00 0.00 0.00 9531.74 9531.74
 
 

Action details: shadow_crash

Static Values
  • id:205385
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:1.5000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:raid_event.adds.in>5&raid_event.adds.duration<20
Spelldata
  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within $205386A1 yards. |cFFFFFFFFGenerates {$/100;s2=20} Insanity.|r
 
    Shadow Crash (_damage) 546 3.9% 14.7 20.76sec 11113 0 Direct 14.7 9176 18280 11113 21.3%  

Stats details: shadow_crash_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.74 14.74 0.00 0.00 0.0000 0.0000 163755.26 163755.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.60 78.72% 9175.80 8423 11667 9177.73 8578 9863 106441 106441 0.00
crit 3.14 21.28% 18279.75 16846 23335 17631.48 0 23335 57314 57314 0.00
 
 

Action details: shadow_crash_damage

Static Values
  • id:205386
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within $205386A1 yards. |cFFFFFFFFGenerates {$/100;s2=20} Insanity.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Pain 1552 11.1% 7.5 41.41sec 71961 61515 Direct 7.5 1981 3953 2417 22.1%  
Periodic 192.5 1904 3794 2322 22.1% 98.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 7.53 192.50 192.50 1.1699 1.5303 465277.23 465277.23 0.00 1786.67 61515.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.87 77.88% 1980.54 1808 2505 1981.78 1811 2252 11619 11619 0.00
crit 1.67 22.12% 3952.61 3616 5009 3336.32 0 5009 6586 6586 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 149.9 77.87% 1904.39 1 2365 1904.84 1850 1982 285470 285470 0.00
crit 42.6 22.13% 3793.63 30 4730 3794.17 3570 3999 161602 161602 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=0} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=16 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.220000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Shadowy Apparitions 0 (256) 0.0% (1.8%) 42.6 6.80sec 1803 0

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
 
        Shadowy Apparition 256 1.8% 42.0 6.79sec 1827 0 Direct 42.0 1827 0 1827 0.0%  

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.02 42.02 0.00 0.00 0.0000 0.0000 76797.24 76797.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.02 100.00% 1827.44 1685 2333 1827.72 1743 1934 76797 76797 0.00
 
 

Action details: shadowy_apparition

Static Values
  • id:148859
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 1275 9.1% 5.8 54.20sec 65406 56859 Periodic 127.1 2465 4908 3007 22.2% 97.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.84 0.00 127.14 127.14 1.1504 2.3019 382264.72 382264.72 0.00 1276.86 56859.25
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.9 77.82% 2465.01 9 3131 2465.77 2406 2569 243899 243899 0.00
crit 28.2 22.18% 4907.58 152 6262 4908.95 4612 5219 138366 138366 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(target.time_to_die>6)
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=21 seconds}, and heals you for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.275000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 2778 19.8% 63.8 4.70sec 13042 11530 Direct 63.7 10822 21601 13069 20.8%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.79 63.66 0.00 0.00 1.1312 0.0000 832012.02 832012.02 0.00 11529.94 11529.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.39 79.15% 10822.21 9862 13662 10826.50 10481 11383 545349 545349 0.00
crit 13.27 20.85% 21601.39 19725 27323 21604.43 19886 23836 286663 286663 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dark_void.enabled&dot.shadow_word_pain.remains>travel_time
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=0} Shadow damage$?a231688[ and extending the duration of Shadow Word: Pain and Vampiric Touch on all nearby targets by ${{$231688s1=3000}/1000}.1 sec][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Void Eruption 0 (393) 0.0% (2.8%) 4.9 60.08sec 24321 12188

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.85 0.00 0.00 0.00 1.9955 0.0000 0.00 0.00 0.00 12188.18 12188.18
 
 

Action details: void_eruption

Static Values
  • id:228260
  • school:shadow
  • resource:insanity
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • cooldown hasted:true
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228260
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:Releases an explosive blast of pure void energy, activating Voidform and causing ${{$228360s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r
 
    Void Eruption (_damage) 393 2.8% 4.9 60.08sec 24321 0 Direct 9.7 8403 25130 12192 22.6%  

Stats details: void_eruption_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.85 9.68 0.00 0.00 0.0000 0.0000 118054.75 118054.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.49 77.35% 8403.42 7808 10815 8390.12 0 10054 62942 62942 0.00
crit 2.19 22.65% 25130.30 15616 43262 17713.17 0 32446 55113 55113 0.00
 
 

Action details: void_eruption_damage

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing ${{$228360s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 346 2.5% 7.4 37.43sec 14078 0 Direct 7.3 11645 23305 14198 21.9%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.37 7.31 0.00 0.00 0.0000 0.0000 103757.02 103757.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.71 78.11% 11645.27 11379 12517 11630.01 0 12517 66477 66477 0.00
crit 1.60 21.89% 23304.66 22758 25033 18843.17 0 25033 37280 37280 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=5320} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10674.86
  • base_dd_max:10674.86
 
pet - mindbender 4441 / 1176
melee 4441 8.4% 70.0 4.04sec 5028 4602 Direct 70.0 4179 8360 5028 20.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.95 69.95 0.00 0.00 1.0928 0.0000 351750.16 351750.16 0.00 4601.71 4601.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.74 79.69% 4179.40 3982 4558 4181.89 4061 4296 232975 232975 0.00
crit 14.21 20.31% 8359.61 7963 9116 8364.39 7984 8970 118776 118776 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Priest_Shadow
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Priest_Shadow
  • harmful:false
  • if_expr:
 
Berserking 2.0 0.00sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Priest_Shadow
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Priest_Shadow
  • harmful:false
  • if_expr:
 
Mindbender 5.4 60.69sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.42 0.00 0.00 0.00 1.1336 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates ${{$200010s1=600}/100} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Potion of Intellect 2.0 0.0 195.8sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 0.0sec 6.76% 7.06% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
chorus_of_insanity 9.6 0.0 30.0sec 30.0sec 22.64% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_chorus_of_insanity
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:crit_rating
  • amount:49.00

Stack Uptimes

  • chorus_of_insanity_1:0.90%
  • chorus_of_insanity_2:1.03%
  • chorus_of_insanity_3:0.90%
  • chorus_of_insanity_4:1.03%
  • chorus_of_insanity_5:0.92%
  • chorus_of_insanity_6:1.04%
  • chorus_of_insanity_7:0.87%
  • chorus_of_insanity_8:1.03%
  • chorus_of_insanity_9:0.94%
  • chorus_of_insanity_10:1.03%
  • chorus_of_insanity_11:0.88%
  • chorus_of_insanity_12:1.04%
  • chorus_of_insanity_13:0.91%
  • chorus_of_insanity_14:1.04%
  • chorus_of_insanity_15:0.90%
  • chorus_of_insanity_16:1.02%
  • chorus_of_insanity_17:0.91%
  • chorus_of_insanity_18:1.05%
  • chorus_of_insanity_19:0.88%
  • chorus_of_insanity_20:1.03%
  • chorus_of_insanity_21:0.76%
  • chorus_of_insanity_22:0.59%
  • chorus_of_insanity_23:0.58%
  • chorus_of_insanity_24:0.39%
  • chorus_of_insanity_25:0.34%
  • chorus_of_insanity_26:0.34%
  • chorus_of_insanity_27:0.27%
  • chorus_of_insanity_28:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Earthlink 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_earthlink
  • max_stacks:6
  • duration:900.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:23.00

Stack Uptimes

  • earthlink_1:16.67%
  • earthlink_2:16.67%
  • earthlink_3:16.67%
  • earthlink_4:16.67%
  • earthlink_5:16.67%
  • earthlink_6:16.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279928
  • name:Earthlink
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by $w1.
  • description:{$@spelldesc279926=Azerite energy courses through you, reaching ${{$s1=11}*6} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] and then diminishing down to {$s1=11} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat], cycling every 6 sec.}
  • max_stacks:6
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
insanity_drain_stacks 10.3 212.1 30.5sec 29.6sec 72.31% 0.00% 212.1(212.1) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • insanity_drain_stacks_1:72.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Overwhelming Power 4.8 0.0 60.3sec 38.1sec 37.35% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.46%
  • overwhelming_power_2:1.47%
  • overwhelming_power_3:1.47%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.48%
  • overwhelming_power_6:1.49%
  • overwhelming_power_7:1.49%
  • overwhelming_power_8:1.50%
  • overwhelming_power_9:1.50%
  • overwhelming_power_10:1.51%
  • overwhelming_power_11:1.51%
  • overwhelming_power_12:1.52%
  • overwhelming_power_13:1.52%
  • overwhelming_power_14:1.53%
  • overwhelming_power_15:1.53%
  • overwhelming_power_16:1.54%
  • overwhelming_power_17:1.54%
  • overwhelming_power_18:1.55%
  • overwhelming_power_19:1.55%
  • overwhelming_power_20:1.56%
  • overwhelming_power_21:1.56%
  • overwhelming_power_22:1.57%
  • overwhelming_power_23:1.57%
  • overwhelming_power_24:1.60%
  • overwhelming_power_25:0.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Shadowform 10.6 0.0 29.6sec 30.0sec 27.69% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shadowform_1:27.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.4 1.2 61.2sec 45.9sec 24.38% 0.00% 1.2(1.2) 4.2

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:24.38%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 1.0 137.7 0.0sec 0.7sec 34.70% 0.00% 137.7(137.7) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • twist_of_fate_1:34.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:123254
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$s1=10}%.
  • description:{$@spelldesc109142=After damaging a target below {$s1=35}% health, you gain {$123254s2=10}% increased damage and healing for {$123254d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging a target below {$s1=35}% health, you gain {$123254s2=10}% increased damage and healing for {$123254d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Voidform 10.3 0.0 30.5sec 29.6sec 72.31% 67.40% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stack Uptimes

  • voidform_1:3.44%
  • voidform_2:3.43%
  • voidform_3:3.42%
  • voidform_4:3.40%
  • voidform_5:3.39%
  • voidform_6:3.38%
  • voidform_7:3.37%
  • voidform_8:3.36%
  • voidform_9:3.35%
  • voidform_10:3.34%
  • voidform_11:3.32%
  • voidform_12:3.31%
  • voidform_13:3.30%
  • voidform_14:3.29%
  • voidform_15:3.28%
  • voidform_16:3.27%
  • voidform_17:3.26%
  • voidform_18:3.25%
  • voidform_19:3.22%
  • voidform_20:2.82%
  • voidform_21:1.94%
  • voidform_22:1.69%
  • voidform_23:1.19%
  • voidform_24:0.53%
  • voidform_25:0.36%
  • voidform_26:0.33%
  • voidform_27:0.08%
  • voidform_28:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:{$?s205351=false}[Shadow Word: Void][Mind Blast] cooldown reduced by ${$w6/1000}.1 sec. Spell damage dealt increased by $w1%. Haste increased by ${$W4}.1%. Losing ${$w3/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing spell damage you deal by {$194249s1=10}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000}.1 sec,][] and granting an additional ${{$s2=5}/10}.1% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Whispers of the Damned 1.0 62.8 0.0sec 4.7sec 99.63% 0.00% 62.8(62.8) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_whispers_of_the_damned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • whispers_of_the_damned_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:275725
  • name:Whispers of the Damned
  • tooltip:
  • description:{$@spelldesc275722=Void Bolt increases the damage of {$?s205351=false}[Shadow Word: Void][Mind Blast] by {$s1=375} for {$275726d=6 seconds}, stacking up to 6 times.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 42.6 6.8sec

Resources

Resource Usage Type Count Total Average RPE APR
T22_Priest_Shadow
Resource RPS-Gain RPS-Loss
Insanity 10.35 10.14
Combat End Resource Mean Min Max
Mana 19999.00 19999.00 19999.00
Insanity 63.22 0.05 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T22_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Priest_Shadow Damage Per Second
Count 7499
Mean 13999.24
Minimum 12822.87
Maximum 15487.17
Spread ( max - min ) 2664.29
Range [ ( max - min ) / 2 * 100% ] 9.52%
Standard Deviation 360.8139
5th Percentile 13437.35
95th Percentile 14633.98
( 95th Percentile - 5th Percentile ) 1196.62
Mean Distribution
Standard Deviation 4.1666
95.00% Confidence Intervall ( 13991.07 - 14007.41 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2552
0.1 Scale Factor Error with Delta=300 1112
0.05 Scale Factor Error with Delta=300 4446
0.01 Scale Factor Error with Delta=300 111135
Priority Target DPS
Sample Data T22_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 13999.24
Minimum 12822.87
Maximum 15487.17
Spread ( max - min ) 2664.29
Range [ ( max - min ) / 2 * 100% ] 9.52%
Standard Deviation 360.8139
5th Percentile 13437.35
95th Percentile 14633.98
( 95th Percentile - 5th Percentile ) 1196.62
Mean Distribution
Standard Deviation 4.1666
95.00% Confidence Intervall ( 13991.07 - 14007.41 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2552
0.1 Scale Factor Error with Delta=300 1112
0.05 Scale Factor Error with Delta=300 4446
0.01 Scale Factor Error with Delta=300 111135
DPS(e)
Sample Data T22_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 13999.24
Minimum 12822.87
Maximum 15487.17
Spread ( max - min ) 2664.29
Range [ ( max - min ) / 2 * 100% ] 9.52%
Damage
Sample Data T22_Priest_Shadow Damage
Count 7499
Mean 3842597.61
Minimum 2912373.20
Maximum 4818479.75
Spread ( max - min ) 1906106.55
Range [ ( max - min ) / 2 * 100% ] 24.80%
DTPS
Sample Data T22_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
7 0.00 shadow_word_void
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=80|target.health.pct<35
0.00 variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
9 2.00 berserking
A 0.00 run_action_list,name=aoe,if=spell_targets.mind_sear>(5+1*talent.misery.enabled)
B 0.00 run_action_list,name=cleave,if=active_enemies>1
C 0.00 run_action_list,name=single,if=active_enemies=1
actions.single
# count action,conditions
D 4.89 void_eruption
E 5.47 dark_ascension,if=buff.voidform.down
F 63.79 void_bolt
0.00 shadow_word_death,if=target.time_to_die<3|cooldown.shadow_word_death.charges=2|(cooldown.shadow_word_death.charges=1&cooldown.shadow_word_death.remains<gcd.max)
0.00 surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)&target.time_to_die>200|target.time_to_die<75
0.00 dark_void,if=raid_event.adds.in>10
G 5.42 mindbender
0.00 shadow_word_death,if=!buff.voidform.up|(cooldown.shadow_word_death.charges=2&buff.voidform.stack<15)
H 14.81 shadow_crash,if=raid_event.adds.in>5&raid_event.adds.duration<20
I 49.42 mind_blast,if=variable.dots_up
0.00 void_torrent,if=dot.shadow_word_pain.remains>4&dot.vampiric_touch.remains>4
J 7.53 shadow_word_pain,if=refreshable&target.time_to_die>4&!talent.misery.enabled&!talent.dark_void.enabled
K 5.84 vampiric_touch,if=refreshable&target.time_to_die>6|(talent.misery.enabled&dot.shadow_word_pain.refreshable)
L 57.04 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
0.00 shadow_word_pain

Sample Sequence

0124569EFGHFJKFIIFLFILFLFILFILFHLFILILIDFLFIHFLIFLFIJFLEFGIFHIFLFIKFLIFLILHLJIDFLFILFLIFHLFILFLILEFGKFILFHIFLFILFLIJLILHLDFILFLIFLFIKFHIJL9EFIGFLIFLFHI8FLIFLILJLIHKDFLIFLFILFLIFHLFILEFGIFLIFJLFHIFLFILFLILIKHLDFIJFLIFLFILFHI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Priest_Shadow 19999.0/19999: 100% mana | 0.0/100: 0% insanity
Pre precombat 1 food T22_Priest_Shadow 19999.0/19999: 100% mana | 0.0/100: 0% insanity
Pre precombat 2 augmentation T22_Priest_Shadow 19999.0/19999: 100% mana | 0.0/100: 0% insanity
Pre precombat 4 potion Fluffy_Pillow 19999.0/19999: 100% mana | 0.0/100: 0% insanity battle_potion_of_intellect
Pre precombat 5 shadowform Fluffy_Pillow 19999.0/19999: 100% mana | 0.0/100: 0% insanity battle_potion_of_intellect
0:00.000 precombat 6 mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 15.0/100: 15% insanity battle_potion_of_intellect
0:00.000 default 9 berserking Fluffy_Pillow 19999.0/19999: 100% mana | 15.0/100: 15% insanity battle_potion_of_intellect
0:00.000 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 15.0/100: 15% insanity berserking, battle_potion_of_intellect
0:01.112 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 58.2/100: 58% insanity bloodlust, berserking, battle_potion_of_intellect
0:01.955 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 68.5/100: 69% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:02.801 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 68.1/100: 68% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:03.644 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 87.2/100: 87% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:04.483 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 98.6/100: 99% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:05.318 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:06.148 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 100.0/100: 100% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:06.975 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 97.1/100: 97% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:07.800 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 100.0/100: 100% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:08.625 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:09.445 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 95.5/100: 95% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:11.591 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 92.4/100: 92% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:12.519 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 91.9/100: 92% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:13.440 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:14.359 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.8/100: 95% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:15.274 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 90.0/100: 90% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:17.390 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 74.5/100: 75% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:18.292 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 72.6/100: 73% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:19.189 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 69.2/100: 69% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:20.082 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 56.2/100: 56% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:20.971 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 52.6/100: 53% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:22.011 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 43.9/100: 44% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:22.892 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 29.1/100: 29% insanity bloodlust, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
0:23.773 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 23.7/100: 24% insanity bloodlust, whispers_of_the_damned, torrent_of_elements
0:24.652 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 21.7/100: 22% insanity bloodlust, whispers_of_the_damned, torrent_of_elements
0:25.524 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 5.4/100: 5% insanity bloodlust, whispers_of_the_damned, torrent_of_elements
0:26.395 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 3.6/100: 4% insanity bloodlust, shadowform, chorus_of_insanity(27), whispers_of_the_damned, torrent_of_elements
0:27.375 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 18.6/100: 19% insanity bloodlust, shadowform, chorus_of_insanity(26), whispers_of_the_damned, torrent_of_elements
0:30.314 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 36.6/100: 37% insanity bloodlust, shadowform, chorus_of_insanity(24), whispers_of_the_damned, torrent_of_elements
0:31.297 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 51.6/100: 52% insanity bloodlust, shadowform, chorus_of_insanity(23), whispers_of_the_damned, torrent_of_elements
0:36.190 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 81.6/100: 82% insanity bloodlust, shadowform, chorus_of_insanity(18), whispers_of_the_damned
0:37.172 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 96.6/100: 97% insanity bloodlust, shadowform, chorus_of_insanity(17), whispers_of_the_damned, overwhelming_power(24)
0:38.693 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 96.6/100: 97% insanity bloodlust, voidform, insanity_drain_stacks, chorus_of_insanity(15), whispers_of_the_damned, overwhelming_power(23)
0:39.605 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 94.5/100: 95% insanity bloodlust, voidform, insanity_drain_stacks, chorus_of_insanity(14), whispers_of_the_damned, overwhelming_power(22)
0:41.883 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 93.0/100: 93% insanity voidform(4), insanity_drain_stacks, chorus_of_insanity(12), whispers_of_the_damned, overwhelming_power(20)
0:43.060 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 89.8/100: 90% insanity voidform(5), insanity_drain_stacks, chorus_of_insanity(11), whispers_of_the_damned, overwhelming_power(18)
0:44.240 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 93.5/100: 94% insanity voidform(6), insanity_drain_stacks, chorus_of_insanity(10), whispers_of_the_damned, overwhelming_power(17)
0:45.418 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 87.6/100: 88% insanity voidform(7), insanity_drain_stacks, chorus_of_insanity(8), whispers_of_the_damned, overwhelming_power(16)
0:46.591 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 86.6/100: 87% insanity voidform(8), insanity_drain_stacks, chorus_of_insanity(7), whispers_of_the_damned, overwhelming_power(15)
0:47.764 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 78.1/100: 78% insanity voidform(10), insanity_drain_stacks, chorus_of_insanity(6), whispers_of_the_damned, overwhelming_power(14)
0:48.928 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 77.5/100: 78% insanity voidform(11), insanity_drain_stacks, chorus_of_insanity(5), whispers_of_the_damned, overwhelming_power(13)
0:50.090 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 76.9/100: 77% insanity voidform(12), insanity_drain_stacks, chorus_of_insanity(4), whispers_of_the_damned, overwhelming_power(11)
0:52.549 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 50.4/100: 50% insanity voidform(14), insanity_drain_stacks, chorus_of_insanity, whispers_of_the_damned, overwhelming_power(9)
0:53.707 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 46.5/100: 47% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(8)
0:54.860 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 40.7/100: 41% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(7)
0:56.011 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 22.8/100: 23% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(5)
0:57.164 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 15.8/100: 16% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(4)
1:00.148 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 19.1/100: 19% insanity shadowform, chorus_of_insanity(16), whispers_of_the_damned, overwhelming_power
1:01.421 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 61.2/100: 61% insanity voidform(2), insanity_drain_stacks, chorus_of_insanity(13), whispers_of_the_damned
1:02.685 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 68.2/100: 68% insanity voidform(3), insanity_drain_stacks, chorus_of_insanity(11), whispers_of_the_damned
1:03.943 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 64.0/100: 64% insanity voidform(4), insanity_drain_stacks, chorus_of_insanity(9), whispers_of_the_damned
1:05.193 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 73.6/100: 74% insanity voidform(6), insanity_drain_stacks, chorus_of_insanity(6), whispers_of_the_damned
1:06.432 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 83.0/100: 83% insanity voidform(7), insanity_drain_stacks, chorus_of_insanity(3), whispers_of_the_damned
1:07.665 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.3/100: 92% insanity voidform(8), insanity_drain_stacks, chorus_of_insanity, whispers_of_the_damned
1:08.892 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 98.4/100: 98% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned
1:10.114 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 90.1/100: 90% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned
1:12.795 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 74.7/100: 75% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
1:13.993 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 77.4/100: 77% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned
1:15.186 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 77.9/100: 78% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned
1:16.368 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 68.5/100: 68% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned
1:17.543 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 68.1/100: 68% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned
1:19.296 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 41.7/100: 42% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned
1:20.456 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 31.8/100: 32% insanity voidform(21), insanity_drain_stacks, whispers_of_the_damned
1:21.611 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 22.1/100: 22% insanity voidform(22), insanity_drain_stacks, whispers_of_the_damned
1:24.606 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 24.0/100: 24% insanity shadowform, chorus_of_insanity(18), whispers_of_the_damned
1:25.980 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 39.0/100: 39% insanity shadowform, chorus_of_insanity(14), whispers_of_the_damned
1:27.257 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 45.0/100: 45% insanity shadowform, chorus_of_insanity(10), whispers_of_the_damned
1:28.534 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 65.0/100: 65% insanity shadowform, chorus_of_insanity(6), whispers_of_the_damned
1:31.717 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 80.0/100: 80% insanity shadowform, whispers_of_the_damned
1:32.993 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 84.0/100: 84% insanity shadowform, whispers_of_the_damned, torrent_of_elements
1:34.269 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 99.0/100: 99% insanity shadowform, whispers_of_the_damned, torrent_of_elements
1:36.393 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 99.0/100: 99% insanity voidform, insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
1:37.665 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 92.1/100: 92% insanity voidform(2), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
1:40.809 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 82.4/100: 82% insanity voidform(5), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
1:42.055 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 86.4/100: 86% insanity voidform(6), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
1:43.295 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 88.2/100: 88% insanity voidform(7), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
1:44.527 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 79.9/100: 80% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
1:45.748 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 80.5/100: 80% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
1:46.963 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 70.0/100: 70% insanity voidform(11), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
1:48.172 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 67.4/100: 67% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned
1:49.377 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 64.8/100: 65% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
1:50.574 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 65.0/100: 65% insanity voidform(15), insanity_drain_stacks, whispers_of_the_damned
1:51.761 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 50.3/100: 50% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned
1:52.942 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 44.6/100: 45% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned
1:54.118 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 36.9/100: 37% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned
1:55.287 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 19.3/100: 19% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned
1:56.455 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 10.6/100: 11% insanity voidform(21), insanity_drain_stacks, whispers_of_the_damned
1:58.184 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 19.6/100: 20% insanity shadowform, chorus_of_insanity(16), whispers_of_the_damned
1:59.460 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 34.6/100: 35% insanity shadowform, chorus_of_insanity(11), whispers_of_the_damned, torrent_of_elements
2:00.738 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 40.6/100: 41% insanity shadowform, chorus_of_insanity(6), whispers_of_the_damned, torrent_of_elements
2:02.016 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 82.7/100: 83% insanity voidform(2), insanity_drain_stacks, chorus_of_insanity, whispers_of_the_damned, torrent_of_elements
2:03.280 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 89.7/100: 90% insanity voidform(3), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:04.537 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 85.5/100: 85% insanity voidform(4), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:05.789 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 86.1/100: 86% insanity voidform(6), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:07.029 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 93.4/100: 93% insanity voidform(7), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:08.262 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 100.0/100: 100% insanity voidform(8), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(24)
2:09.405 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 98.2/100: 98% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(23)
2:10.545 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 91.2/100: 91% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(22)
2:11.683 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 90.2/100: 90% insanity voidform(11), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(21)
2:12.819 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.4/100: 94% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(20)
2:13.949 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 88.2/100: 88% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(19)
2:16.759 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 66.7/100: 67% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(16)
2:17.879 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 67.5/100: 68% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(15)
2:18.997 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 60.4/100: 60% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(14)
2:20.116 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 43.3/100: 43% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(12)
2:21.235 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 35.1/100: 35% insanity voidform(21), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(11)
2:22.907 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 6.3/100: 6% insanity voidform(23), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(10)
2:24.018 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 21.3/100: 21% insanity shadowform, chorus_of_insanity(20), whispers_of_the_damned, overwhelming_power(8)
2:25.264 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 25.3/100: 25% insanity shadowform, chorus_of_insanity(13), whispers_of_the_damned, overwhelming_power(7)
2:29.010 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 43.3/100: 43% insanity shadowform, whispers_of_the_damned, overwhelming_power(3)
2:30.276 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 58.3/100: 58% insanity shadowform, whispers_of_the_damned, overwhelming_power(2)
2:31.544 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 64.3/100: 64% insanity shadowform, whispers_of_the_damned, overwhelming_power
2:32.817 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 84.3/100: 84% insanity shadowform, whispers_of_the_damned
2:34.093 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 90.3/100: 90% insanity shadowform, whispers_of_the_damned
2:36.219 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 90.2/100: 90% insanity voidform, insanity_drain_stacks, whispers_of_the_damned
2:37.487 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.2/100: 92% insanity voidform(2), insanity_drain_stacks, whispers_of_the_damned
2:38.751 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity voidform(3), insanity_drain_stacks, whispers_of_the_damned
2:40.007 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.0/100: 94% insanity voidform(4), insanity_drain_stacks, whispers_of_the_damned
2:41.257 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 88.6/100: 89% insanity voidform(6), insanity_drain_stacks, whispers_of_the_damned
2:43.112 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 78.4/100: 78% insanity voidform(7), insanity_drain_stacks, whispers_of_the_damned
2:44.346 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 79.0/100: 79% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned
2:45.566 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 79.6/100: 80% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned
2:48.589 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 51.4/100: 51% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
2:49.787 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 48.3/100: 48% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned
2:50.979 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 43.1/100: 43% insanity voidform(15), insanity_drain_stacks, whispers_of_the_damned
2:52.167 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 27.9/100: 28% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned
2:53.349 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 21.6/100: 22% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned
2:54.518 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 18.4/100: 18% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned
2:55.680 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 19.3/100: 19% insanity shadowform, chorus_of_insanity(20), whispers_of_the_damned
2:56.956 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 23.3/100: 23% insanity shadowform, chorus_of_insanity(12), whispers_of_the_damned
3:00.778 default 9 berserking Fluffy_Pillow 19999.0/19999: 100% mana | 41.3/100: 41% insanity shadowform, whispers_of_the_damned
3:00.778 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 41.3/100: 41% insanity berserking, shadowform, whispers_of_the_damned
3:01.888 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 84.5/100: 85% insanity berserking, voidform(2), insanity_drain_stacks, whispers_of_the_damned
3:02.986 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.4/100: 92% insanity berserking, voidform(3), insanity_drain_stacks, whispers_of_the_damned
3:04.081 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 98.8/100: 99% insanity berserking, voidform(4), insanity_drain_stacks, whispers_of_the_damned
3:05.170 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 95.3/100: 95% insanity berserking, voidform(5), insanity_drain_stacks, whispers_of_the_damned
3:06.253 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 95.7/100: 96% insanity berserking, voidform(6), insanity_drain_stacks, whispers_of_the_damned
3:07.331 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 96.4/100: 96% insanity berserking, voidform(7), insanity_drain_stacks, whispers_of_the_damned
3:08.404 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity berserking, voidform(8), insanity_drain_stacks, whispers_of_the_damned
3:09.473 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 93.0/100: 93% insanity berserking, voidform(9), insanity_drain_stacks, whispers_of_the_damned
3:12.270 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 81.8/100: 82% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned
3:13.475 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 85.4/100: 85% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
3:14.674 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 86.6/100: 87% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned
3:15.868 default 8 potion Fluffy_Pillow 19999.0/19999: 100% mana | 87.1/100: 87% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned
3:15.868 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 87.1/100: 87% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:17.051 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 84.5/100: 84% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:18.814 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 71.5/100: 71% insanity twist_of_fate, voidform(19), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:19.981 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 62.5/100: 63% insanity twist_of_fate, voidform(20), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:21.143 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 53.6/100: 54% insanity twist_of_fate, voidform(21), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:24.587 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 11.2/100: 11% insanity twist_of_fate, shadowform, chorus_of_insanity(20), whispers_of_the_damned, battle_potion_of_intellect
3:25.864 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 26.2/100: 26% insanity twist_of_fate, shadowform, chorus_of_insanity(12), whispers_of_the_damned, battle_potion_of_intellect
3:29.047 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 41.2/100: 41% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
3:30.323 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 45.2/100: 45% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
3:32.235 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 54.2/100: 54% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
3:33.509 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 69.2/100: 69% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
3:34.786 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 89.2/100: 89% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
3:36.063 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 95.2/100: 95% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
3:38.187 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 95.2/100: 95% insanity twist_of_fate, voidform, insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
3:39.459 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 92.1/100: 92% insanity twist_of_fate, voidform(2), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
3:40.724 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 89.1/100: 89% insanity twist_of_fate, voidform(3), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, battle_potion_of_intellect
3:41.981 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 93.9/100: 94% insanity twist_of_fate, voidform(4), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(24)
3:43.145 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 89.5/100: 89% insanity twist_of_fate, voidform(5), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(22)
3:46.044 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 73.3/100: 73% insanity twist_of_fate, voidform(8), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(19)
3:47.201 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 75.1/100: 75% insanity twist_of_fate, voidform(10), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(18)
3:48.353 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 74.7/100: 75% insanity twist_of_fate, voidform(11), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(17)
3:49.502 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 64.4/100: 64% insanity twist_of_fate, voidform(12), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(16)
3:50.650 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 63.0/100: 63% insanity twist_of_fate, voidform(13), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(15)
3:51.793 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 50.7/100: 51% insanity twist_of_fate, voidform(14), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(14)
3:52.935 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 46.4/100: 46% insanity twist_of_fate, voidform(15), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(12)
3:54.079 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 42.0/100: 42% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(10)
3:55.224 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 40.5/100: 40% insanity twist_of_fate, voidform(18), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(9)
3:56.363 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 24.0/100: 24% insanity twist_of_fate, voidform(19), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(8)
3:57.500 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 16.6/100: 17% insanity twist_of_fate, voidform(20), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(7)
3:58.635 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 17.1/100: 17% insanity twist_of_fate, shadowform, chorus_of_insanity(19), whispers_of_the_damned, overwhelming_power(6)
4:01.767 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 32.1/100: 32% insanity twist_of_fate, shadowform, whispers_of_the_damned, overwhelming_power(3)
4:03.033 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 74.3/100: 74% insanity twist_of_fate, voidform(2), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power
4:04.292 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 81.3/100: 81% insanity twist_of_fate, voidform(3), insanity_drain_stacks, whispers_of_the_damned
4:05.549 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 77.1/100: 77% insanity twist_of_fate, voidform(4), insanity_drain_stacks, whispers_of_the_damned
4:06.801 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 86.8/100: 87% insanity twist_of_fate, voidform(6), insanity_drain_stacks, whispers_of_the_damned
4:08.039 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 93.4/100: 93% insanity twist_of_fate, voidform(7), insanity_drain_stacks, whispers_of_the_damned
4:09.886 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 87.5/100: 87% insanity twist_of_fate, voidform(9), insanity_drain_stacks, whispers_of_the_damned
4:11.110 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 93.0/100: 93% insanity twist_of_fate, voidform(10), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(24)
4:12.240 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 90.7/100: 91% insanity twist_of_fate, voidform(11), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(23)
4:13.369 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 84.4/100: 84% insanity twist_of_fate, voidform(12), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(22)
4:14.496 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 79.2/100: 79% insanity twist_of_fate, voidform(13), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(21)
4:15.621 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 82.9/100: 83% insanity twist_of_fate, voidform(14), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(20)
4:16.745 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 86.8/100: 87% insanity twist_of_fate, voidform(15), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(19)
4:17.868 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 87.5/100: 88% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(18)
4:18.983 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 84.9/100: 85% insanity twist_of_fate, voidform(18), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(17)
4:21.489 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 45.8/100: 46% insanity twist_of_fate, voidform(20), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(14)
4:22.601 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 37.6/100: 38% insanity twist_of_fate, voidform(21), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(13)
4:23.712 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 27.4/100: 27% insanity twist_of_fate, voidform(22), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(12)
4:24.821 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 7.2/100: 7% insanity twist_of_fate, voidform(24), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(11)
4:25.924 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 0.1/100: 0% insanity twist_of_fate, shadowform, chorus_of_insanity(25), whispers_of_the_damned, overwhelming_power(10)
4:27.161 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 6.1/100: 6% insanity twist_of_fate, shadowform, chorus_of_insanity(13), whispers_of_the_damned, overwhelming_power(8)
4:28.405 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 21.1/100: 21% insanity twist_of_fate, shadowform, chorus_of_insanity, whispers_of_the_damned, torrent_of_elements, overwhelming_power(7)
4:34.041 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 48.1/100: 48% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements
4:35.318 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 63.1/100: 63% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements
4:36.594 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 69.1/100: 69% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements
4:37.870 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 89.1/100: 89% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements
4:39.147 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 95.1/100: 95% insanity twist_of_fate, shadowform, whispers_of_the_damned, torrent_of_elements
4:41.272 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 95.1/100: 95% insanity twist_of_fate, voidform, insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
4:42.542 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.2/100: 92% insanity twist_of_fate, voidform(2), insanity_drain_stacks, whispers_of_the_damned
4:43.806 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity twist_of_fate, voidform(3), insanity_drain_stacks, whispers_of_the_damned
4:45.065 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 89.8/100: 90% insanity twist_of_fate, voidform(4), insanity_drain_stacks, whispers_of_the_damned
4:46.316 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 88.6/100: 89% insanity twist_of_fate, voidform(6), insanity_drain_stacks, whispers_of_the_damned
4:48.171 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 78.3/100: 78% insanity twist_of_fate, voidform(7), insanity_drain_stacks, whispers_of_the_damned
4:49.404 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 79.0/100: 79% insanity twist_of_fate, voidform(9), insanity_drain_stacks, whispers_of_the_damned
4:50.627 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 79.6/100: 80% insanity twist_of_fate, voidform(10), insanity_drain_stacks, whispers_of_the_damned
4:53.652 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 51.3/100: 51% insanity twist_of_fate, voidform(13), insanity_drain_stacks, whispers_of_the_damned
4:54.850 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 48.1/100: 48% insanity twist_of_fate, voidform(14), insanity_drain_stacks, whispers_of_the_damned
4:56.044 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 42.9/100: 43% insanity twist_of_fate, voidform(15), insanity_drain_stacks, whispers_of_the_damned
4:57.231 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 27.8/100: 28% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned
4:58.413 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 21.4/100: 21% insanity twist_of_fate, voidform(18), insanity_drain_stacks, whispers_of_the_damned
4:59.584 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 18.2/100: 18% insanity twist_of_fate, voidform(19), insanity_drain_stacks, whispers_of_the_damned

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 8838 8035 7034
Intellect 1467 -3 8067 6916 5123 (377)
Spirit 0 0 0 0 0
Health 176760 160700 0
Mana 19999 19999 0
Insanity 100 100 0
Spell Power 8067 6916 0
Crit 20.12% 20.12% 1089
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 640 640 0
Mastery 21.97% 21.97% 742
Armor 1142 1142 1142
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 385, stats: { 148 Armor, +625 Int, +1127 Sta }
azerite powers: { Death Throes, Heed My Call, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 385, stats: { 137 Armor, +469 Int, +845 Sta }
azerite powers: { Whispers of the Damned, Earthlink, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 385, stats: { 183 Armor, +625 Int, +1127 Sta }
azerite powers: { Chorus of Insanity, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Twitching Tentacle of Xalzaix
ilevel: 385, stats: { +176 Crit }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: torrent_of_elements
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Fortress of the Mind (Shadow Priest) Shadowy Insight (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Body and Soul San'layn (Shadow Priest) Mania (Shadow Priest)
45 Twist of Fate (Shadow Priest) Misery (Shadow Priest) Dark Void (Shadow Priest)
60 Last Word (Shadow Priest) Mind Bomb (Shadow Priest) Psychic Horror (Shadow Priest)
75 Auspicious Spirits (Shadow Priest) Shadow Word: Death (Shadow Priest) Shadow Crash (Shadow Priest)
90 Lingering Insanity (Shadow Priest) Mindbender (Shadow Priest) Void Torrent (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Dark Ascension (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="T22_Priest_Shadow"
spec=shadow
level=120
race=troll
role=spell
position=ranged_back
talents=3111322

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast
actions.precombat+=/shadow_word_void

# Executed every time the actor is available.
actions=potion,if=buff.bloodlust.react|target.time_to_die<=80|target.health.pct<35
actions+=/variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions+=/berserking
actions+=/run_action_list,name=aoe,if=spell_targets.mind_sear>(5+1*talent.misery.enabled)
actions+=/run_action_list,name=cleave,if=active_enemies>1
actions+=/run_action_list,name=single,if=active_enemies=1

actions.aoe=void_eruption
actions.aoe+=/dark_ascension,if=buff.voidform.down
actions.aoe+=/void_bolt,if=talent.dark_void.enabled&dot.shadow_word_pain.remains>travel_time
actions.aoe+=/surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)
actions.aoe+=/dark_void,if=raid_event.adds.in>10
actions.aoe+=/mindbender
actions.aoe+=/shadow_crash,if=raid_event.adds.in>5&raid_event.adds.duration<20
actions.aoe+=/mind_sear,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
actions.aoe+=/shadow_word_pain

actions.cleave=void_eruption
actions.cleave+=/dark_ascension,if=buff.voidform.down
actions.cleave+=/void_bolt
actions.cleave+=/shadow_word_death,target_if=target.time_to_die<3|buff.voidform.down
actions.cleave+=/surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)
actions.cleave+=/dark_void,if=raid_event.adds.in>10
actions.cleave+=/mindbender
actions.cleave+=/mind_blast
actions.cleave+=/shadow_crash,if=(raid_event.adds.in>5&raid_event.adds.duration<2)|raid_event.adds.duration>2
actions.cleave+=/shadow_word_pain,target_if=refreshable&target.time_to_die>4,if=!talent.misery.enabled&!talent.dark_void.enabled
actions.cleave+=/vampiric_touch,target_if=refreshable,if=(target.time_to_die>6)
actions.cleave+=/vampiric_touch,target_if=dot.shadow_word_pain.refreshable,if=(talent.misery.enabled&target.time_to_die>4)
actions.cleave+=/void_torrent
actions.cleave+=/mind_sear,target_if=spell_targets.mind_sear>2,chain=1,interrupt=1
actions.cleave+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
actions.cleave+=/shadow_word_pain

actions.single=void_eruption
actions.single+=/dark_ascension,if=buff.voidform.down
actions.single+=/void_bolt
actions.single+=/shadow_word_death,if=target.time_to_die<3|cooldown.shadow_word_death.charges=2|(cooldown.shadow_word_death.charges=1&cooldown.shadow_word_death.remains<gcd.max)
actions.single+=/surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)&target.time_to_die>200|target.time_to_die<75
actions.single+=/dark_void,if=raid_event.adds.in>10
actions.single+=/mindbender
actions.single+=/shadow_word_death,if=!buff.voidform.up|(cooldown.shadow_word_death.charges=2&buff.voidform.stack<15)
actions.single+=/shadow_crash,if=raid_event.adds.in>5&raid_event.adds.duration<20
actions.single+=/mind_blast,if=variable.dots_up
actions.single+=/void_torrent,if=dot.shadow_word_pain.remains>4&dot.vampiric_touch.remains>4
actions.single+=/shadow_word_pain,if=refreshable&target.time_to_die>4&!talent.misery.enabled&!talent.dark_void.enabled
actions.single+=/vampiric_touch,if=refreshable&target.time_to_die>6|(talent.misery.enabled&dot.shadow_word_pain.refreshable)
actions.single+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
actions.single+=/shadow_word_pain

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507,azerite_powers=404/22/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507,azerite_powers=236/461/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507,azerite_powers=405/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=twitching_tentacle_of_xalzaix,id=160656,bonus_id=4800/1507
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=torrent_of_elements
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7034
# gear_intellect=5123
# gear_crit_rating=1089
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1142

T22_Rogue_Assassination : 16237 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16237.4 16237.4 8.9 / 0.055% 1534.6 / 9.5% 656.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
24.7 24.3 Energy 38.12% 36.9 100.0% 100%
Talents
  • 15: Elaborate Planning
  • 30: Subterfuge
  • 45: Vigor
  • 90: Toxic Blade (Assassination Rogue)
  • 100: Poison Bomb (Assassination Rogue)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Rogue_Assassination 16237
auto_attack_mh 1899 11.7% 222.4 1.35sec 2559 1918 Direct 222.4 2373 4737 2559 26.9% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 222.35 222.35 0.00 0.00 1.3344 0.0000 569044.80 813517.88 30.05 1917.89 1917.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.30 54.10% 2372.51 1928 3393 2373.63 2278 2484 285407 408024 30.05
crit 59.87 26.93% 4737.33 3855 6785 4739.48 4458 5078 283638 405494 30.05
miss 42.18 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
auto_attack_oh 940 5.8% 220.3 1.36sec 1278 949 Direct 220.3 1184 2366 1278 26.9% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 220.32 220.32 0.00 0.00 1.3466 0.0000 281622.31 402612.91 30.05 949.23 949.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.18 54.09% 1184.41 964 1696 1184.95 1136 1239 141159 201803 30.05
crit 59.37 26.95% 2365.73 1928 3393 2366.76 2199 2562 140464 200810 30.05
miss 41.77 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Deadly Poison (_dot) 1091 6.7% 504.6 0.77sec 648 0 Periodic 197.9 1303 2603 1653 26.9% 0.0% 99.6%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 504.58 0.00 197.93 197.93 0.0000 1.5089 327075.18 327075.18 0.00 1095.17 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.7 73.09% 1302.66 948 2271 1303.38 1248 1367 188440 188440 0.00
crit 53.3 26.91% 2602.55 1897 4543 2603.78 2369 2889 138635 138635 0.00
 
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance to poison the enemy for ${$2818m1*{$2818d=12 seconds}/$2818t1} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.063000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Deadly Poison (_instant) 2034 12.5% 503.6 0.77sec 1210 0 Direct 503.6 954 1904 1210 27.0% 0.0%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 503.58 503.58 0.00 0.00 0.0000 0.0000 609236.76 609236.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 367.83 73.04% 953.71 677 1622 954.20 913 1002 350808 350808 0.00
crit 135.75 26.96% 1903.73 1355 3245 1904.68 1778 2054 258429 258429 0.00
 
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
Envenom 2655 16.3% 39.6 7.49sec 20073 19983 Direct 39.6 15816 31579 20073 27.0% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.61 39.61 0.00 0.00 1.0045 0.0000 795031.95 795031.95 0.00 19983.21 19983.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.91 72.99% 15815.60 9681 28842 15826.74 13982 17802 457241 457241 0.00
crit 10.70 27.01% 31579.40 19361 57685 31572.62 22948 41344 337791 337791 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=4+talent.deeper_stratagem.enabled&(debuff.vendetta.up|debuff.toxic_blade.up|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2)&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Frenetic Blow (frentic_blow) 308 1.9% 3.6 73.05sec 25902 0 Direct 3.6 20388 40770 25901 27.1% 0.0%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 3.57 0.00 0.00 0.0000 0.0000 92409.07 132109.86 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.60 72.95% 20388.35 20334 20952 19827.58 0 20952 53063 75860 29.23
crit 0.97 27.05% 40770.44 40668 41903 26498.65 0 41903 39346 56250 19.53
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Garrote 2283 14.1% 16.9 18.11sec 40401 40221 Periodic 198.3 2723 5426 3449 26.9% 0.0% 99.2%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.93 0.00 198.31 198.31 1.0045 1.5007 684081.25 684081.25 0.00 2174.32 40221.15
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 145.0 73.11% 2722.52 1 5990 2724.94 2507 2946 394741 394741 0.00
crit 53.3 26.89% 5426.18 3 11981 5430.27 4517 6544 289340 289340 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.subterfuge.enabled|!(cooldown.vanish.up&cooldown.vendetta.remains<=4))&combo_points.deficit>=1&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&(target.time_to_die-remains>4&spell_targets.fan_of_knives<=1|target.time_to_die-remains>12)
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.120000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mutilate 0 (2175) 0.0% (13.4%) 93.8 3.20sec 6944 6913

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.79 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 6912.81 6912.81
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.use_filler
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of $<dmg> Physical damage. |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Mutilate (_mh) 1450 8.9% 93.8 3.20sec 4630 0 Direct 93.8 3647 7288 4630 27.0% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.79 93.79 0.00 0.00 0.0000 0.0000 434227.23 620779.97 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.48 73.01% 3647.12 2935 5081 3648.89 3437 3833 249766 357070 30.05
crit 25.31 26.99% 7287.69 5870 10162 7290.89 6629 8207 184461 263710 30.05
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Mutilate (_oh) 725 4.5% 93.8 3.20sec 2314 0 Direct 93.8 1824 3642 2314 27.0% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.79 93.79 0.00 0.00 0.0000 0.0000 217070.36 310328.15 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.50 73.03% 1823.84 1467 2541 1824.82 1737 1918 124926 178597 30.05
crit 25.30 26.97% 3642.34 2935 5081 3643.63 3298 4086 92144 131731 30.05
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Poison Bomb 404 2.5% 39.5 6.50sec 3068 0 Direct 39.5 2419 4825 3068 27.0% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.49 39.49 0.00 0.00 0.0000 0.0000 121169.54 121169.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.84 73.02% 2419.18 1821 3966 2420.23 1912 3185 69758 69758 0.00
crit 10.65 26.98% 4825.19 3643 7932 4823.15 0 7338 51411 51411 0.00
 
 

Action details: poison_bomb

Static Values
  • id:255546
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:255546
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc255544=Envenom and Rupture have a $<chance>% chance per combo point spent to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$255546s1=0}*{$s2=4}} Nature damage over {$255545d=2 seconds} to all enemies within it.}
 
Rupture 1936 11.9% 13.3 22.55sec 43740 43545 Periodic 196.5 2327 4648 2952 26.9% 0.0% 98.8%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.26 0.00 196.54 196.54 1.0045 1.5074 580197.17 580197.17 0.00 1874.02 43545.27
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.6 73.07% 2326.84 3 3475 2327.96 2253 2416 334156 334156 0.00
crit 52.9 26.93% 4648.12 24 6950 4650.26 4336 5087 246041 246041 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2)))
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${$o1*2} over 8 sec 2 points: ${$o1*3} over 12 sec 3 points: ${$o1*4} over 16 sec 4 points: ${$o1*5} over 20 sec 5 points: ${$o1*6} over 24 sec{$?s193531=false}[ 6 points: ${$o1*7} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.125300
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Toxic Blade 512 3.2% 12.2 25.17sec 12582 12527 Direct 12.2 9928 19797 12582 26.9% 0.0%  

Stats details: toxic_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.20 12.20 0.00 0.00 1.0045 0.0000 153564.31 153564.31 0.00 12526.66 12526.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.92 73.10% 9927.84 8017 14698 9931.60 8452 11561 88579 88579 0.00
crit 3.28 26.90% 19797.29 16033 29397 19355.13 0 28531 64985 64985 0.00
 
 

Action details: toxic_blade

Static Values
  • id:245388
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:25.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rupture.ticking
Spelldata
  • id:245388
  • name:Toxic Blade
  • school:nature
  • tooltip:
  • description:Stab your enemy with a toxic poisoned blade, dealing {$s2=0} Nature damage. Your Nature damage done against the target is increased by {$245389s1=30}% for {$245389d=9 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Rogue_Assassination
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Assassination
  • harmful:false
  • if_expr:
 
Berserking 2.0 240.19sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.vendetta.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Assassination
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Assassination
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.8 127.76sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.exsanguinate.enabled&(talent.nightstalker.enabled|talent.subterfuge.enabled&spell_targets.fan_of_knives<2)&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 3.0 120.10sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.rupture.ticking
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility. Generates ${{$256495s1=100}*{$256495d=3 seconds}/5} Energy over {$256495d=3 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:36.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=6}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Agility 2.0 0.0 129.3sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 240.2sec 240.2sec 6.43% 6.61% 0.0(0.0) 1.9

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Deadly Navigation 6.2 23.1 52.2sec 10.4sec 68.91% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_deadly_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:50.00

Stack Uptimes

  • deadly_navigation_1:18.03%
  • deadly_navigation_2:17.55%
  • deadly_navigation_3:16.91%
  • deadly_navigation_4:16.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268905
  • name:Deadly Navigation
  • tooltip:Increases Critical Strike by $w1.
  • description:{$@spelldesc268907=Permanently enchant a weapon to sometimes increase Critical Strike by $268905s for {$268905d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268904s Critical Strike for {$268904d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Deadly Navigation (_final) 5.5 0.0 52.3sec 52.3sec 18.04% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_deadly_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:600.00

Stack Uptimes

  • deadly_navigation_final_1:18.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268904
  • name:Deadly Navigation
  • tooltip:Increases Critical Strike by $w1.
  • description:{$@spelldesc268907=Permanently enchant a weapon to sometimes increase Critical Strike by $268905s for {$268905d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268904s Critical Strike for {$268904d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elaborate Planning 39.0 13.8 7.7sec 5.7sec 66.01% 53.83% 13.8(13.8) 38.4

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • elaborate_planning_1:66.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Increases damage done by {$s1=10}% for {$d=4 seconds}.
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Elemental Whirl (_crit) 2.6 0.2 74.1sec 64.6sec 9.01% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.7sec 65.8sec 9.01% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 74.9sec 65.8sec 8.92% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:8.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.7 0.2 74.1sec 64.7sec 9.18% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:9.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Envenom 20.4 19.2 14.7sec 7.5sec 67.62% 68.98% 19.2(19.2) 19.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • envenom_1:67.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 4.9 12.0 64.2sec 17.5sec 75.51% 0.00% 0.0(0.0) 0.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:27.51%
  • frothing_rage_2:25.02%
  • frothing_rage_3:22.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Overwhelming Power 4.9 0.0 59.5sec 37.3sec 37.85% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.48%
  • overwhelming_power_2:1.48%
  • overwhelming_power_3:1.49%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.51%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.52%
  • overwhelming_power_10:1.53%
  • overwhelming_power_11:1.53%
  • overwhelming_power_12:1.54%
  • overwhelming_power_13:1.54%
  • overwhelming_power_14:1.55%
  • overwhelming_power_15:1.55%
  • overwhelming_power_16:1.56%
  • overwhelming_power_17:1.56%
  • overwhelming_power_18:1.57%
  • overwhelming_power_19:1.57%
  • overwhelming_power_20:1.58%
  • overwhelming_power_21:1.58%
  • overwhelming_power_22:1.59%
  • overwhelming_power_23:1.59%
  • overwhelming_power_24:1.63%
  • overwhelming_power_25:0.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.0sec 10.4sec 68.85% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.02%
  • quick_navigation_2:17.49%
  • quick_navigation_3:16.90%
  • quick_navigation_4:16.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.11% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=20}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 3.8 0.0 86.5sec 128.1sec 3.75% 3.93% 0.0(0.0) 3.7

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • subterfuge_1:3.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=80}% increased damage and have no cooldown when used from Stealth and for {$115192d=3 seconds} after breaking Stealth.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Titanic Overcharge 12.3 33.4 25.0sec 6.6sec 85.18% 0.00% 3.7(3.7) 11.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:40.51

Stack Uptimes

  • titanic_overcharge_1:22.93%
  • titanic_overcharge_2:16.81%
  • titanic_overcharge_3:12.32%
  • titanic_overcharge_4:8.91%
  • titanic_overcharge_5:6.53%
  • titanic_overcharge_6:4.78%
  • titanic_overcharge_7:3.50%
  • titanic_overcharge_8:9.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=36} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 24.8 28.3 12.3sec 5.7sec 66.56% 0.00% 2.3(2.3) 24.2

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:31.03%
  • unstable_flames_2:16.70%
  • unstable_flames_3:8.86%
  • unstable_flames_4:4.68%
  • unstable_flames_5:5.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 2.8 0.0 127.7sec 127.7sec 0.34% 0.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vanish_1:0.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Vendetta (_energy) 3.0 0.0 120.1sec 120.1sec 2.99% 1.54% 0.0(0.0) 2.9

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_vendetta_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:20.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vendetta_energy_1:2.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:256495
  • name:Vendetta
  • tooltip:Generating ${{$s1=100}*{$d=3 seconds}/5} Energy over {$d=3 seconds}.
  • description:{$@spelldesc79140=Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility. Generates ${{$256495s1=100}*{$256495d=3 seconds}/5} Energy over {$256495d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Seal Fate 53.9 6.3sec

Resources

Resource Usage Type Count Total Average RPE APR
T22_Rogue_Assassination
envenom Energy 39.6 1386.3 35.0 35.0 573.5
envenom Combo Points 39.6 185.3 4.7 4.7 4290.3
garrote Energy 16.9 762.0 45.0 45.0 897.8
mutilate Energy 93.8 4689.7 50.0 50.0 138.9
rupture Energy 13.3 331.6 25.0 25.0 1749.6
rupture Combo Points 13.3 63.0 4.7 4.7 9213.1
toxic_blade Energy 12.2 244.1 20.0 20.0 629.1
Resource Gains Type Count Total Average Overflow
toxic_blade Combo Points 12.20 7.56 (3.01%) 0.62 4.64 38.04%
mutilate Combo Points 93.79 187.59 (74.64%) 2.00 0.00 0.00%
garrote Combo Points 16.93 16.93 (6.74%) 1.00 0.00 0.00%
energy_regen Energy 1897.84 4366.70 (59.83%) 2.30 4.49 0.10%
Seal Fate Combo Points 53.89 39.23 (15.61%) 0.73 14.67 27.21%
Vendetta Energy 28.84 168.21 (2.30%) 5.83 9.02 5.09%
Venomous Vim Energy 394.83 2763.63 (37.87%) 7.00 0.14 0.01%
Resource RPS-Gain RPS-Loss
Energy 24.33 24.71
Combo Points 0.84 0.83
Combat End Resource Mean Min Max
Energy 54.64 0.00 170.00
Combo Points 3.05 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data T22_Rogue_Assassination Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Rogue_Assassination Damage Per Second
Count 7499
Mean 16237.36
Minimum 14920.03
Maximum 17676.62
Spread ( max - min ) 2756.59
Range [ ( max - min ) / 2 * 100% ] 8.49%
Standard Deviation 391.0259
5th Percentile 15611.78
95th Percentile 16894.46
( 95th Percentile - 5th Percentile ) 1282.68
Mean Distribution
Standard Deviation 4.5155
95.00% Confidence Intervall ( 16228.51 - 16246.22 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2228
0.1 Scale Factor Error with Delta=300 1306
0.05 Scale Factor Error with Delta=300 5222
0.01 Scale Factor Error with Delta=300 130526
Priority Target DPS
Sample Data T22_Rogue_Assassination Priority Target Damage Per Second
Count 7499
Mean 16237.36
Minimum 14920.03
Maximum 17676.62
Spread ( max - min ) 2756.59
Range [ ( max - min ) / 2 * 100% ] 8.49%
Standard Deviation 391.0259
5th Percentile 15611.78
95th Percentile 16894.46
( 95th Percentile - 5th Percentile ) 1282.68
Mean Distribution
Standard Deviation 4.5155
95.00% Confidence Intervall ( 16228.51 - 16246.22 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2228
0.1 Scale Factor Error with Delta=300 1306
0.05 Scale Factor Error with Delta=300 5222
0.01 Scale Factor Error with Delta=300 130526
DPS(e)
Sample Data T22_Rogue_Assassination Damage Per Second (Effective)
Count 7499
Mean 16237.36
Minimum 14920.03
Maximum 17676.62
Spread ( max - min ) 2756.59
Range [ ( max - min ) / 2 * 100% ] 8.49%
Damage
Sample Data T22_Rogue_Assassination Damage
Count 7499
Mean 4864729.93
Minimum 3640097.22
Maximum 5954537.88
Spread ( max - min ) 2314440.66
Range [ ( max - min ) / 2 * 100% ] 23.79%
DTPS
Sample Data T22_Rogue_Assassination Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Rogue_Assassination Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Rogue_Assassination Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Rogue_Assassination Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Rogue_Assassination Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Rogue_Assassination Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Rogue_AssassinationTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Rogue_Assassination Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion
7 0.00 marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=energy_regen_combined,value=energy.regen+poisoned_bleeds*7%(2*spell_haste)
8 0.00 call_action_list,name=stealthed,if=stealthed.rogue
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=dot
B 0.00 call_action_list,name=direct
0.00 arcane_torrent,if=energy.deficit>=15+variable.energy_regen_combined
0.00 arcane_pulse
0.00 lights_judgment
actions.cds
# count action,conditions
C 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=60|debuff.vendetta.up&cooldown.vanish.remains<5
0.00 blood_fury,if=debuff.vendetta.up
D 1.96 berserking,if=debuff.vendetta.up
0.00 fireblood,if=debuff.vendetta.up
0.00 ancestral_call,if=debuff.vendetta.up
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit*1.5|(raid_event.adds.in>40&combo_points.deficit>=cp_max_spend)
E 2.97 vendetta,if=dot.rupture.ticking
0.00 vanish,if=talent.exsanguinate.enabled&(talent.nightstalker.enabled|talent.subterfuge.enabled&spell_targets.fan_of_knives<2)&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1
Vanish with Exsg + (Nightstalker, or Subterfuge only on 1T): Maximum CP and Exsg ready for next GCD
0.00 vanish,if=talent.nightstalker.enabled&!talent.exsanguinate.enabled&combo_points>=cp_max_spend&debuff.vendetta.up
Vanish with Nightstalker + No Exsg: Maximum CP and Vendetta up
F 2.76 vanish,if=talent.subterfuge.enabled&(!talent.exsanguinate.enabled|spell_targets.fan_of_knives>=2)&!stealthed.rogue&cooldown.garrote.up&dot.garrote.refreshable&(spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives|spell_targets.fan_of_knives>=4&combo_points.deficit>=4)
Vanish with Subterfuge + (No Exsg or 2T+): No stealth/subterfuge, Garrote Refreshable, enough space for incoming Garrote CP
0.00 vanish,if=talent.master_assassin.enabled&!stealthed.all&master_assassin_remains<=0&!dot.rupture.refreshable
Vanish with Master Assasin: No stealth and no active MA buff, Rupture not in refresh range
0.00 exsanguinate,if=dot.rupture.remains>4+4*cp_max_spend&!dot.garrote.refreshable
Exsanguinate when both Rupture and Garrote are up for long enough
G 12.21 toxic_blade,if=dot.rupture.ticking
actions.direct
# count action,conditions
H 39.38 envenom,if=combo_points>=4+talent.deeper_stratagem.enabled&(debuff.vendetta.up|debuff.toxic_blade.up|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2)&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)
Envenom at 4+ (5+ with DS) CP. Immediately on 2+ targets, with Vendetta, or with TB; otherwise wait for some energy. Also wait if Exsg combo is coming up.
0.00 variable,name=use_filler,value=combo_points.deficit>1|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2
0.00 poisoned_knife,if=variable.use_filler&buff.sharpened_blades.stack>=29&(azerite.sharpened_blades.rank>=2|spell_targets.fan_of_knives<=4)
Poisoned Knife at 29+ stacks of Sharpened Blades. Up to 4 targets with Rank 1, more otherwise.
0.00 fan_of_knives,if=variable.use_filler&(buff.hidden_blades.stack>=19|spell_targets.fan_of_knives>=2+stealthed.rogue|buff.the_dreadlords_deceit.stack>=29)
0.00 blindside,if=variable.use_filler&(buff.blindside.up|!talent.venom_rush.enabled)
I 93.79 mutilate,if=variable.use_filler
actions.dot
# count action,conditions
0.00 rupture,if=talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2)))
Special Rupture setup for Exsg
0.00 pool_resource,for_next=1
Garrote upkeep, also tries to use it as a special generator for the last CP before a finisher
J 13.23 garrote,cycle_targets=1,if=(!talent.subterfuge.enabled|!(cooldown.vanish.up&cooldown.vendetta.remains<=4))&combo_points.deficit>=1&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&(target.time_to_die-remains>4&spell_targets.fan_of_knives<=1|target.time_to_die-remains>12)
0.00 crimson_tempest,if=spell_targets>=2&remains<2+(spell_targets>=5)&combo_points>=4
Crimson Tempest only on multiple targets at 4+ CP when running out in 2s (up to 4 targets) or 3s (5+ targets)
K 12.84 rupture,cycle_targets=1,if=combo_points>=4&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>4
Keep up Rupture at 4+ on all targets (when living long enough and not snapshot)
actions.stealthed
# count action,conditions
L 0.43 rupture,if=combo_points>=4&(talent.nightstalker.enabled|talent.subterfuge.enabled&talent.exsanguinate.enabled&spell_targets.fan_of_knives<2|!ticking)&target.time_to_die-remains>6
Nighstalker, or Subt+Exsg on 1T: Snapshot Rupture; Also use Rupture over Envenom if it's not applied (Opener)
M 0.23 envenom,if=combo_points>=cp_max_spend
N 3.70 garrote,cycle_targets=1,if=talent.subterfuge.enabled&refreshable&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>2
Subterfuge: Apply or Refresh with buffed Garrotes
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&remains<=10&pmultiplier<=1&!exsanguinated&target.time_to_die-remains>2
Subterfuge: Override normal Garrotes with snapshot versions
0.00 pool_resource,for_next=1
Subterfuge + Exsg: Even override a snapshot Garrote right after Rupture before Exsanguination
0.00 garrote,if=talent.subterfuge.enabled&talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&prev_gcd.1.rupture&dot.rupture.remains>5+4*cp_max_spend

Sample Sequence

012456NIIKEDGIHIIHIIHFNIIHIIKIIHGIHIIHJIIHIIKIIJGHIIHIIKJIHIIHGIHIIHJIIKIIHJGIHIHIIKIJEHIIHICIGHIIHFNIIKIIHGIIHIJHIIKIIJHGIHIIKIIJHIIKIIGHIJHIIHIIKJIGHIIHIIEDHIJHIIHIIKGIHIIHFNIHIIKIIGHIJIHII

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Rogue_Assassination 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation T22_Rogue_Assassination 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food T22_Rogue_Assassination 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 apply_poison Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 5 stealth Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 6 potion Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, battle_potion_of_agility
0:00.000 stealthed N garrote Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, archive_of_the_titans, resounding_protection, battle_potion_of_agility
0:01.004 direct I mutilate Fluffy_Pillow 138.3/170: 81% energy | 1.0/5: 20% combo_points bloodlust, subterfuge, deadly_navigation, quick_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.008 direct I mutilate Fluffy_Pillow 112.7/170: 66% energy | 3.0/5: 60% combo_points bloodlust, subterfuge, deadly_navigation, quick_navigation, unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:03.012 dot K rupture Fluffy_Pillow 87.0/170: 51% energy | 5.0/5: 100% combo_points bloodlust, deadly_navigation, quick_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:04.016 cds E vendetta Fluffy_Pillow 79.3/170: 47% energy | 0.0/5: 0% combo_points bloodlust, elaborate_planning, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:05.021 cds D berserking Fluffy_Pillow 130.8/170: 77% energy | 0.0/5: 0% combo_points bloodlust, vendetta_energy, elaborate_planning, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:05.021 cds G toxic_blade Fluffy_Pillow 130.8/170: 77% energy | 0.0/5: 0% combo_points bloodlust, berserking, vendetta_energy, elaborate_planning, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:06.024 direct I mutilate Fluffy_Pillow 164.8/170: 97% energy | 2.0/5: 40% combo_points bloodlust, berserking, vendetta_energy, elaborate_planning, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:07.026 direct H envenom Fluffy_Pillow 168.5/170: 99% energy | 4.0/5: 80% combo_points bloodlust, berserking, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:08.031 direct I mutilate Fluffy_Pillow 167.4/170: 98% energy | 0.0/5: 0% combo_points bloodlust, berserking, envenom, elaborate_planning, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(2), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:09.037 direct I mutilate Fluffy_Pillow 151.5/170: 89% energy | 2.0/5: 40% combo_points bloodlust, berserking, envenom, elaborate_planning, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:10.043 direct H envenom Fluffy_Pillow 135.6/170: 80% energy | 5.0/5: 100% combo_points bloodlust, berserking, envenom, elaborate_planning, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:11.048 direct I mutilate Fluffy_Pillow 127.6/170: 75% energy | 0.0/5: 0% combo_points bloodlust, berserking, envenom, elaborate_planning, deadly_navigation(3), quick_navigation, elemental_whirl_versatility, elemental_whirl_haste, unstable_flames(4), archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:12.054 direct I mutilate Fluffy_Pillow 105.3/170: 62% energy | 2.0/5: 40% combo_points bloodlust, berserking, envenom, elaborate_planning, deadly_navigation(3), quick_navigation, elemental_whirl_versatility, elemental_whirl_haste, unstable_flames(4), archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:13.059 direct H envenom Fluffy_Pillow 90.0/170: 53% energy | 5.0/5: 100% combo_points bloodlust, berserking, envenom, elaborate_planning, deadly_navigation(3), quick_navigation, elemental_whirl_haste, unstable_flames(4), archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:14.063 cds F vanish Fluffy_Pillow 89.7/170: 53% energy | 0.0/5: 0% combo_points bloodlust, berserking, envenom, elaborate_planning, deadly_navigation(3), quick_navigation, elemental_whirl_haste, archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:14.063 stealthed N garrote Fluffy_Pillow 89.7/170: 53% energy | 0.0/5: 0% combo_points bloodlust, berserking, vanish, envenom, elaborate_planning, deadly_navigation(3), quick_navigation, elemental_whirl_haste, archive_of_the_titans(3), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:15.068 direct I mutilate Fluffy_Pillow 79.3/170: 47% energy | 1.0/5: 20% combo_points bloodlust, envenom, subterfuge, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation, elemental_whirl_haste, archive_of_the_titans(4), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:16.073 direct I mutilate Fluffy_Pillow 61.2/170: 36% energy | 3.0/5: 60% combo_points bloodlust, envenom, subterfuge, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation, elemental_whirl_haste, archive_of_the_titans(4), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:17.078 direct H envenom Fluffy_Pillow 43.3/170: 25% energy | 5.0/5: 100% combo_points bloodlust, envenom, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:18.080 Waiting     0.600 sec 40.3/170: 24% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, unstable_flames, archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:18.680 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, unstable_flames, archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:19.684 Waiting     0.600 sec 32.9/170: 19% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:20.284 direct I mutilate Fluffy_Pillow 57.7/170: 34% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(5), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:21.290 dot K rupture Fluffy_Pillow 25.6/170: 15% energy | 5.0/5: 100% combo_points bloodlust, envenom, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(5), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:22.294 Waiting     0.500 sec 32.0/170: 19% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(5), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:22.794 direct I mutilate Fluffy_Pillow 54.7/170: 32% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(5), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:23.799 Waiting     0.849 sec 22.4/170: 13% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(5), resounding_protection, titanic_overcharge(3)
0:24.648 direct I mutilate Fluffy_Pillow 51.3/170: 30% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(5), resounding_protection, titanic_overcharge(3)
0:25.653 Waiting     3.200 sec 32.9/170: 19% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, archive_of_the_titans(6), resounding_protection, titanic_overcharge(3)
0:28.853 direct H envenom Fluffy_Pillow 127.2/170: 75% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage, deadly_navigation(4), quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(6), resounding_protection, overwhelming_power(23), titanic_overcharge(3)
0:29.859 cds G toxic_blade Fluffy_Pillow 118.1/170: 69% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(6), resounding_protection, overwhelming_power(22), titanic_overcharge(3)
0:31.025 direct I mutilate Fluffy_Pillow 134.0/170: 79% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(7), resounding_protection, overwhelming_power(20), titanic_overcharge(3)
0:32.028 direct H envenom Fluffy_Pillow 116.7/170: 69% energy | 4.0/5: 80% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(7), resounding_protection, overwhelming_power(19), titanic_overcharge(3)
0:33.032 direct I mutilate Fluffy_Pillow 114.4/170: 67% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(7), resounding_protection, overwhelming_power(18)
0:34.037 direct I mutilate Fluffy_Pillow 96.8/170: 57% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(7), resounding_protection, overwhelming_power(17)
0:35.041 direct H envenom Fluffy_Pillow 79.2/170: 47% energy | 5.0/5: 100% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(8), resounding_protection, overwhelming_power(16), titanic_overcharge
0:36.046 dot J garrote Fluffy_Pillow 76.7/170: 45% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, elemental_whirl_haste, unstable_flames, archive_of_the_titans(8), resounding_protection, overwhelming_power(15), titanic_overcharge
0:37.051 direct I mutilate Fluffy_Pillow 50.7/170: 30% energy | 1.0/5: 20% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation(3), elemental_whirl_versatility, elemental_whirl_haste, unstable_flames, archive_of_the_titans(8), resounding_protection, overwhelming_power(14), titanic_overcharge(2)
0:38.055 Waiting     0.400 sec 33.7/170: 20% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(8), resounding_protection, overwhelming_power(13), titanic_overcharge(2)
0:38.455 direct I mutilate Fluffy_Pillow 55.2/170: 32% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(8), resounding_protection, overwhelming_power(13), titanic_overcharge(2)
0:39.459 Waiting     3.600 sec 24.2/170: 14% energy | 5.0/5: 100% combo_points bloodlust, envenom, frothing_rage(3), deadly_navigation_final, quick_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(8), resounding_protection, overwhelming_power(12), titanic_overcharge(2)
0:43.059 direct H envenom Fluffy_Pillow 125.0/170: 74% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(4), elemental_whirl_haste, archive_of_the_titans(9), resounding_protection, overwhelming_power(8), titanic_overcharge(3)
0:44.063 direct I mutilate Fluffy_Pillow 118.5/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(9), resounding_protection, overwhelming_power(7), titanic_overcharge(3)
0:45.068 direct I mutilate Fluffy_Pillow 96.9/170: 57% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(10), resounding_protection, overwhelming_power(6), titanic_overcharge(3)
0:46.072 dot K rupture Fluffy_Pillow 61.5/170: 36% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(10), resounding_protection, overwhelming_power(5), titanic_overcharge(4)
0:47.075 direct I mutilate Fluffy_Pillow 65.6/170: 39% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(10), resounding_protection, overwhelming_power(4), titanic_overcharge(4)
0:48.079 Waiting     0.400 sec 44.6/170: 26% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(10), resounding_protection, overwhelming_power(3), titanic_overcharge(4)
0:48.479 direct I mutilate Fluffy_Pillow 50.5/170: 30% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(10), resounding_protection, overwhelming_power(3), titanic_overcharge(4)
0:50.763 dot J garrote Fluffy_Pillow 48.6/170: 29% energy | 4.0/5: 80% combo_points frothing_rage(3), deadly_navigation, quick_navigation_final, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(11), resounding_protection, overwhelming_power, titanic_overcharge(5)
0:51.767 Waiting     3.100 sec 32.5/170: 19% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation, quick_navigation_final, elemental_whirl_haste, unstable_flames(4), archive_of_the_titans(11), resounding_protection, titanic_overcharge(5)
0:54.867 cds G toxic_blade Fluffy_Pillow 106.5/170: 63% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation, quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(11), resounding_protection, titanic_overcharge(5)
0:56.027 direct H envenom Fluffy_Pillow 117.5/170: 69% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(12), resounding_protection, titanic_overcharge(5)
0:57.030 direct I mutilate Fluffy_Pillow 110.2/170: 65% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, unstable_flames(5), archive_of_the_titans(12), resounding_protection, titanic_overcharge(6)
0:58.032 direct I mutilate Fluffy_Pillow 73.8/170: 43% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation, unstable_flames(5), archive_of_the_titans(12), resounding_protection, titanic_overcharge(6)
0:59.037 direct H envenom Fluffy_Pillow 51.5/170: 30% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation, archive_of_the_titans(12), resounding_protection, titanic_overcharge(6)
1:00.041 Waiting     0.500 sec 44.1/170: 26% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation, archive_of_the_titans(13), resounding_protection, titanic_overcharge(6)
1:00.541 direct I mutilate Fluffy_Pillow 50.9/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation, archive_of_the_titans(13), resounding_protection, titanic_overcharge(6)
1:01.546 Waiting     1.663 sec 14.6/170: 9% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, deadly_navigation(2), quick_navigation, archive_of_the_titans(13), resounding_protection, titanic_overcharge(6)
1:03.209 direct I mutilate Fluffy_Pillow 58.3/170: 34% energy | 3.0/5: 60% combo_points envenom, deadly_navigation(3), quick_navigation(2), unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge(6)
1:04.214 Waiting     3.600 sec 29.0/170: 17% energy | 5.0/5: 100% combo_points envenom, deadly_navigation(3), quick_navigation(2), unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge(6)
1:07.814 dot K rupture Fluffy_Pillow 106.5/170: 63% energy | 5.0/5: 100% combo_points deadly_navigation(3), quick_navigation(2), unstable_flames(3), archive_of_the_titans(14), resounding_protection, titanic_overcharge(7)
1:08.818 dot J garrote Fluffy_Pillow 109.3/170: 64% energy | 0.0/5: 0% combo_points elaborate_planning, deadly_navigation(3), quick_navigation(2), unstable_flames(5), archive_of_the_titans(14), resounding_protection, titanic_overcharge(7)
1:09.821 direct I mutilate Fluffy_Pillow 92.1/170: 54% energy | 1.0/5: 20% combo_points elaborate_planning, deadly_navigation(3), quick_navigation(2), unstable_flames(5), archive_of_the_titans(14), resounding_protection, titanic_overcharge(7)
1:10.825 Waiting     3.000 sec 56.0/170: 33% energy | 4.0/5: 80% combo_points elaborate_planning, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(15), resounding_protection, titanic_overcharge(7)
1:13.825 direct H envenom Fluffy_Pillow 125.6/170: 74% energy | 4.0/5: 80% combo_points deadly_navigation(3), quick_navigation_final, archive_of_the_titans(15), resounding_protection, titanic_overcharge(7)
1:14.830 direct I mutilate Fluffy_Pillow 119.1/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(15), resounding_protection
1:15.834 direct I mutilate Fluffy_Pillow 83.2/170: 49% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(16), resounding_protection
1:16.837 Waiting     2.500 sec 61.8/170: 36% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(16), resounding_protection
1:19.337 direct H envenom Fluffy_Pillow 126.1/170: 74% energy | 5.0/5: 100% combo_points deadly_navigation(3), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(16), resounding_protection
1:20.341 cds G toxic_blade Fluffy_Pillow 105.8/170: 62% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:21.345 direct I mutilate Fluffy_Pillow 114.4/170: 67% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:22.350 direct H envenom Fluffy_Pillow 93.1/170: 55% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:23.356 direct I mutilate Fluffy_Pillow 72.8/170: 43% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:24.360 direct I mutilate Fluffy_Pillow 50.8/170: 30% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, deadly_navigation(4), elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:25.364 Waiting     0.500 sec 28.5/170: 17% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, deadly_navigation(4), elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge
1:25.864 direct H envenom Fluffy_Pillow 35.3/170: 21% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, deadly_navigation(4), unstable_flames(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge
1:28.404 dot J garrote Fluffy_Pillow 61.8/170: 36% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(4), archive_of_the_titans(18), resounding_protection, titanic_overcharge
1:29.409 Waiting     0.700 sec 30.1/170: 18% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, deadly_navigation(4), archive_of_the_titans(18), resounding_protection
1:30.109 direct I mutilate Fluffy_Pillow 53.3/170: 31% energy | 1.0/5: 20% combo_points envenom, deadly_navigation(4), archive_of_the_titans(19), resounding_protection
1:31.113 Waiting     1.549 sec 16.5/170: 10% energy | 3.0/5: 60% combo_points envenom, deadly_navigation(4), archive_of_the_titans(19), resounding_protection
1:32.662 direct I mutilate Fluffy_Pillow 50.9/170: 30% energy | 3.0/5: 60% combo_points envenom, deadly_navigation(4), quick_navigation, unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge
1:33.665 dot K rupture Fluffy_Pillow 28.3/170: 17% energy | 5.0/5: 100% combo_points deadly_navigation(4), quick_navigation, unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge
1:34.670 Waiting     1.528 sec 16.6/170: 10% energy | 0.0/5: 0% combo_points elaborate_planning, deadly_navigation(4), quick_navigation, unstable_flames(3), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2)
1:36.198 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 0.0/5: 0% combo_points elaborate_planning, deadly_navigation(4), quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:37.202 Waiting     1.100 sec 28.4/170: 17% energy | 3.0/5: 60% combo_points elaborate_planning, deadly_navigation(4), quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:38.302 direct I mutilate Fluffy_Pillow 57.1/170: 34% energy | 3.0/5: 60% combo_points frothing_rage, deadly_navigation(4), quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:39.307 Waiting     4.738 sec 20.5/170: 12% energy | 5.0/5: 100% combo_points frothing_rage, deadly_navigation(4), quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:44.045 direct H envenom Fluffy_Pillow 126.3/170: 74% energy | 5.0/5: 100% combo_points frothing_rage(2), deadly_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:45.049 dot J garrote Fluffy_Pillow 118.8/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:46.055 cds G toxic_blade Fluffy_Pillow 87.4/170: 51% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:47.060 direct I mutilate Fluffy_Pillow 95.0/170: 56% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:48.064 direct H envenom Fluffy_Pillow 65.6/170: 39% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), deadly_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:49.067 direct I mutilate Fluffy_Pillow 51.2/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:50.073 Waiting     0.500 sec 28.9/170: 17% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:50.573 direct H envenom Fluffy_Pillow 35.6/170: 21% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:51.579 Waiting     1.300 sec 28.3/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:52.879 direct I mutilate Fluffy_Pillow 52.9/170: 31% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:53.885 Waiting     1.008 sec 23.5/170: 14% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:54.893 direct I mutilate Fluffy_Pillow 51.2/170: 30% energy | 3.0/5: 60% combo_points envenom, frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
1:55.896 Waiting     0.731 sec 14.9/170: 9% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
1:56.627 dot K rupture Fluffy_Pillow 39.0/170: 23% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
1:57.631 Waiting     0.600 sec 27.8/170: 16% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
1:58.231 direct I mutilate Fluffy_Pillow 50.1/170: 29% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
1:59.236 Waiting     1.505 sec 13.9/170: 8% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:00.741 dot J garrote Fluffy_Pillow 50.1/170: 29% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(6)
2:01.746 Waiting     2.100 sec 33.8/170: 20% energy | 4.0/5: 80% combo_points frothing_rage(2), deadly_navigation, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(6)
2:03.846 cds E vendetta Fluffy_Pillow 78.5/170: 46% energy | 4.0/5: 80% combo_points frothing_rage(2), deadly_navigation, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(6)
2:05.019 direct H envenom Fluffy_Pillow 129.6/170: 76% energy | 4.0/5: 80% combo_points vendetta_energy, frothing_rage(2), deadly_navigation, quick_navigation(3), unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(6)
2:06.021 direct I mutilate Fluffy_Pillow 143.0/170: 84% energy | 0.0/5: 0% combo_points envenom, vendetta_energy, elaborate_planning, frothing_rage(2), deadly_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(17)
2:07.025 direct I mutilate Fluffy_Pillow 141.5/170: 83% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
2:08.028 direct H envenom Fluffy_Pillow 106.1/170: 62% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge
2:09.032 direct I mutilate Fluffy_Pillow 99.7/170: 59% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(2)
2:10.039 cds C potion Fluffy_Pillow 78.4/170: 46% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(2), quick_navigation(4), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(2)
2:10.039 direct I mutilate Fluffy_Pillow 78.4/170: 46% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(2), quick_navigation(4), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(2), battle_potion_of_agility
2:11.043 cds G toxic_blade Fluffy_Pillow 43.0/170: 25% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(2), quick_navigation(4), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(2), battle_potion_of_agility
2:12.059 direct H envenom Fluffy_Pillow 51.7/170: 30% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), deadly_navigation(3), quick_navigation(4), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(2), battle_potion_of_agility
2:13.065 Waiting     0.300 sec 45.9/170: 27% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(3), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(2), battle_potion_of_agility
2:13.365 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(3), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(2), battle_potion_of_agility
2:14.369 Waiting     1.431 sec 15.5/170: 9% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(2), battle_potion_of_agility
2:15.800 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(2), battle_potion_of_agility
2:16.807 Waiting     0.400 sec 29.7/170: 17% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), deadly_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(2), battle_potion_of_agility
2:17.207 direct H envenom Fluffy_Pillow 35.5/170: 21% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), deadly_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(2), battle_potion_of_agility
2:18.212 Waiting     0.500 sec 29.0/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), battle_potion_of_agility
2:18.712 cds F vanish Fluffy_Pillow 36.2/170: 21% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), battle_potion_of_agility
2:18.969 stealthed N garrote Fluffy_Pillow 53.8/170: 32% energy | 0.0/5: 0% combo_points vanish, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), battle_potion_of_agility
2:19.973 Waiting     0.929 sec 23.2/170: 14% energy | 1.0/5: 20% combo_points envenom, subterfuge, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), battle_potion_of_agility
2:20.902 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 1.0/5: 20% combo_points envenom, subterfuge, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), battle_potion_of_agility
2:21.908 Waiting     1.622 sec 14.7/170: 9% energy | 3.0/5: 60% combo_points envenom, subterfuge, frothing_rage(2), deadly_navigation_final, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge, battle_potion_of_agility
2:23.530 direct I mutilate Fluffy_Pillow 64.3/170: 38% energy | 3.0/5: 60% combo_points envenom, frothing_rage(2), deadly_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:24.535 dot K rupture Fluffy_Pillow 27.7/170: 16% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), deadly_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:25.540 Waiting     1.300 sec 30.0/170: 18% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), deadly_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:26.840 direct I mutilate Fluffy_Pillow 61.3/170: 36% energy | 0.0/5: 0% combo_points elaborate_planning, deadly_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:27.844 Waiting     0.900 sec 24.6/170: 14% energy | 2.0/5: 40% combo_points elaborate_planning, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:28.744 direct I mutilate Fluffy_Pillow 50.6/170: 30% energy | 2.0/5: 40% combo_points unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:29.747 Waiting     5.224 sec 14.0/170: 8% energy | 5.0/5: 100% combo_points unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:34.971 direct H envenom Fluffy_Pillow 125.6/170: 74% energy | 5.0/5: 100% combo_points frothing_rage, deadly_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:35.975 cds G toxic_blade Fluffy_Pillow 118.1/170: 69% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:37.059 direct I mutilate Fluffy_Pillow 127.5/170: 75% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(24)
2:38.062 direct I mutilate Fluffy_Pillow 91.7/170: 54% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(23)
2:39.066 direct H envenom Fluffy_Pillow 69.9/170: 41% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(22)
2:40.071 direct I mutilate Fluffy_Pillow 63.1/170: 37% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(21)
2:41.588 dot J garrote Fluffy_Pillow 48.4/170: 28% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(20)
2:42.593 Waiting     0.541 sec 17.4/170: 10% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(19)
2:43.134 direct H envenom Fluffy_Pillow 39.0/170: 23% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(18)
2:44.138 Waiting     1.295 sec 18.1/170: 11% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(17)
2:45.433 direct I mutilate Fluffy_Pillow 50.2/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(16)
2:46.438 Waiting     1.300 sec 28.2/170: 17% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15)
2:47.738 direct I mutilate Fluffy_Pillow 60.2/170: 35% energy | 2.0/5: 40% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(14)
2:48.742 Waiting     0.100 sec 24.1/170: 14% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(13)
2:48.842 dot K rupture Fluffy_Pillow 25.5/170: 15% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(13)
2:49.845 Waiting     1.000 sec 28.3/170: 17% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(12)
2:50.845 direct I mutilate Fluffy_Pillow 56.0/170: 33% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11)
2:51.850 Waiting     1.273 sec 19.9/170: 12% energy | 2.0/5: 40% combo_points elaborate_planning, deadly_navigation(2), quick_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
2:53.123 direct I mutilate Fluffy_Pillow 51.3/170: 30% energy | 2.0/5: 40% combo_points frothing_rage, deadly_navigation(2), quick_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
2:54.128 Waiting     0.600 sec 29.1/170: 17% energy | 4.0/5: 80% combo_points frothing_rage, deadly_navigation(2), quick_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge
2:55.491 dot J garrote Fluffy_Pillow 47.7/170: 28% energy | 4.0/5: 80% combo_points frothing_rage, deadly_navigation(2), quick_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(2)
2:56.496 Waiting     4.100 sec 30.4/170: 18% energy | 5.0/5: 100% combo_points frothing_rage, deadly_navigation(2), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(2)
3:00.596 direct H envenom Fluffy_Pillow 128.0/170: 75% energy | 5.0/5: 100% combo_points frothing_rage, deadly_navigation(2), quick_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(2)
3:01.602 cds G toxic_blade Fluffy_Pillow 106.6/170: 63% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation(3), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:02.607 direct I mutilate Fluffy_Pillow 114.2/170: 67% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:03.613 direct H envenom Fluffy_Pillow 77.8/170: 46% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:04.617 direct I mutilate Fluffy_Pillow 70.4/170: 41% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection
3:05.621 Waiting     0.200 sec 47.9/170: 28% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection
3:05.821 direct I mutilate Fluffy_Pillow 50.6/170: 30% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection
3:06.825 Waiting     0.807 sec 14.1/170: 8% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection
3:07.632 dot K rupture Fluffy_Pillow 39.0/170: 23% energy | 4.0/5: 80% combo_points envenom, frothing_rage, deadly_navigation(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection
3:08.637 Waiting     0.700 sec 27.6/170: 16% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:09.337 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:10.341 Waiting     1.600 sec 28.6/170: 17% energy | 2.0/5: 40% combo_points elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:11.941 direct I mutilate Fluffy_Pillow 64.3/170: 38% energy | 2.0/5: 40% combo_points frothing_rage, deadly_navigation(3), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:13.711 dot J garrote Fluffy_Pillow 52.2/170: 31% energy | 4.0/5: 80% combo_points frothing_rage, deadly_navigation(3), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:14.718 Waiting     4.410 sec 20.8/170: 12% energy | 5.0/5: 100% combo_points frothing_rage, deadly_navigation(4), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:19.128 direct H envenom Fluffy_Pillow 125.2/170: 74% energy | 5.0/5: 100% combo_points frothing_rage(2), deadly_navigation_final, quick_navigation_final, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:20.130 direct I mutilate Fluffy_Pillow 118.6/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:21.134 direct I mutilate Fluffy_Pillow 82.9/170: 49% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:22.138 Waiting     1.700 sec 61.3/170: 36% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:23.838 dot K rupture Fluffy_Pillow 99.6/170: 59% energy | 5.0/5: 100% combo_points envenom, frothing_rage(2), deadly_navigation_final, quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:24.842 direct I mutilate Fluffy_Pillow 102.9/170: 61% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:25.847 direct I mutilate Fluffy_Pillow 66.6/170: 39% energy | 2.0/5: 40% combo_points elaborate_planning, frothing_rage(2), deadly_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:26.850 cds G toxic_blade Fluffy_Pillow 44.0/170: 26% energy | 4.0/5: 80% combo_points elaborate_planning, frothing_rage(2), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:27.854 direct H envenom Fluffy_Pillow 51.4/170: 30% energy | 5.0/5: 100% combo_points frothing_rage(2), quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:28.859 Waiting     0.500 sec 30.0/170: 18% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:29.359 direct I mutilate Fluffy_Pillow 50.8/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:30.365 Waiting     0.784 sec 14.4/170: 8% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation, quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:31.658 dot J garrote Fluffy_Pillow 45.9/170: 27% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation, quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:32.663 Waiting     0.500 sec 28.5/170: 17% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:33.163 direct H envenom Fluffy_Pillow 35.3/170: 21% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:34.168 Waiting     1.600 sec 20.9/170: 12% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:35.768 direct I mutilate Fluffy_Pillow 56.8/170: 33% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:36.772 Waiting     0.700 sec 27.6/170: 16% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:37.472 direct I mutilate Fluffy_Pillow 51.3/170: 30% energy | 2.0/5: 40% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:38.476 Waiting     4.911 sec 15.2/170: 9% energy | 4.0/5: 80% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:43.387 direct H envenom Fluffy_Pillow 125.3/170: 74% energy | 4.0/5: 80% combo_points frothing_rage(3), deadly_navigation, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:44.391 direct I mutilate Fluffy_Pillow 118.3/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:45.395 direct I mutilate Fluffy_Pillow 96.2/170: 57% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
3:46.400 Waiting     1.500 sec 60.1/170: 35% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection
3:47.900 dot K rupture Fluffy_Pillow 94.2/170: 55% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation(2), quick_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:48.905 dot J garrote Fluffy_Pillow 96.8/170: 57% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:49.908 direct I mutilate Fluffy_Pillow 65.4/170: 38% energy | 1.0/5: 20% combo_points elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:50.913 Waiting     0.700 sec 43.0/170: 25% energy | 4.0/5: 80% combo_points elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:51.613 cds G toxic_blade Fluffy_Pillow 52.4/170: 31% energy | 4.0/5: 80% combo_points elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:52.854 direct H envenom Fluffy_Pillow 63.2/170: 37% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:53.858 direct I mutilate Fluffy_Pillow 55.8/170: 33% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:54.861 Waiting     1.312 sec 19.4/170: 11% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:56.173 direct I mutilate Fluffy_Pillow 51.2/170: 30% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:57.176 Waiting     0.400 sec 29.5/170: 17% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:57.576 direct H envenom Fluffy_Pillow 35.2/170: 21% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:58.580 Waiting     1.200 sec 28.5/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:59.780 direct I mutilate Fluffy_Pillow 59.6/170: 35% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:00.787 Waiting     0.900 sec 23.9/170: 14% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:01.687 direct I mutilate Fluffy_Pillow 51.3/170: 30% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), deadly_navigation(3), quick_navigation_final, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(25), titanic_overcharge(3)
4:02.691 Waiting     1.102 sec 17.1/170: 10% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(3)
4:03.793 cds E vendetta Fluffy_Pillow 48.4/170: 28% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(3)
4:05.021 cds D berserking Fluffy_Pillow 101.7/170: 60% energy | 5.0/5: 100% combo_points vendetta_energy, frothing_rage(3), deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(3)
4:05.021 direct H envenom Fluffy_Pillow 101.7/170: 60% energy | 5.0/5: 100% combo_points berserking, vendetta_energy, frothing_rage(3), deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(3)
4:06.025 direct I mutilate Fluffy_Pillow 118.7/170: 70% energy | 0.0/5: 0% combo_points berserking, envenom, vendetta_energy, elaborate_planning, deadly_navigation(4), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(3)
4:07.030 dot J garrote Fluffy_Pillow 119.6/170: 70% energy | 3.0/5: 60% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(4)
4:08.036 direct H envenom Fluffy_Pillow 91.5/170: 54% energy | 4.0/5: 80% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(4)
4:09.041 direct I mutilate Fluffy_Pillow 87.3/170: 51% energy | 0.0/5: 0% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(4)
4:10.045 direct I mutilate Fluffy_Pillow 68.1/170: 40% energy | 3.0/5: 60% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, quick_navigation, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(4)
4:11.051 direct H envenom Fluffy_Pillow 48.9/170: 29% energy | 5.0/5: 100% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, quick_navigation, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(4)
4:12.055 Waiting     0.400 sec 37.4/170: 22% energy | 0.0/5: 0% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(5)
4:12.455 direct I mutilate Fluffy_Pillow 50.9/170: 30% energy | 0.0/5: 0% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(5)
4:13.459 Waiting     1.200 sec 31.1/170: 18% energy | 3.0/5: 60% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(5)
4:14.659 direct I mutilate Fluffy_Pillow 50.6/170: 30% energy | 3.0/5: 60% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(5)
4:15.664 dot K rupture Fluffy_Pillow 29.6/170: 17% energy | 5.0/5: 100% combo_points envenom, frothing_rage, deadly_navigation_final, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(6)
4:16.669 cds G toxic_blade Fluffy_Pillow 32.9/170: 19% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation_final, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(7)
4:17.855 Waiting     0.500 sec 43.7/170: 26% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(7)
4:18.355 direct I mutilate Fluffy_Pillow 50.8/170: 30% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(7)
4:19.357 Waiting     0.500 sec 29.0/170: 17% energy | 4.0/5: 80% combo_points elaborate_planning, frothing_rage, deadly_navigation, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(7)
4:19.857 direct H envenom Fluffy_Pillow 36.0/170: 21% energy | 4.0/5: 80% combo_points frothing_rage, deadly_navigation, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(7)
4:20.861 Waiting     1.500 sec 29.1/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(7)
4:22.361 direct I mutilate Fluffy_Pillow 57.2/170: 34% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(8)
4:23.365 Waiting     0.600 sec 28.2/170: 17% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(8)
4:23.965 direct I mutilate Fluffy_Pillow 50.6/170: 30% energy | 2.0/5: 40% combo_points envenom, frothing_rage, deadly_navigation, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(8)
4:24.970 Waiting     0.745 sec 14.6/170: 9% energy | 5.0/5: 100% combo_points frothing_rage(2), deadly_navigation, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(8)
4:25.715 direct H envenom Fluffy_Pillow 39.0/170: 23% energy | 5.0/5: 100% combo_points frothing_rage(2), deadly_navigation, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:26.720 cds F vanish Fluffy_Pillow 17.9/170: 11% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:27.740 stealthed N garrote Fluffy_Pillow 46.1/170: 27% energy | 0.0/5: 0% combo_points vanish, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:28.744 Waiting     1.400 sec 29.6/170: 17% energy | 1.0/5: 20% combo_points envenom, subterfuge, elaborate_planning, frothing_rage(2), deadly_navigation(2), quick_navigation(4), elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:30.144 direct I mutilate Fluffy_Pillow 57.4/170: 34% energy | 1.0/5: 20% combo_points envenom, subterfuge, frothing_rage(2), deadly_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(25), titanic_overcharge(8)
4:31.148 Waiting     3.300 sec 30.6/170: 18% energy | 4.0/5: 80% combo_points envenom, frothing_rage(2), deadly_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(8)
4:34.448 direct H envenom Fluffy_Pillow 125.3/170: 74% energy | 4.0/5: 80% combo_points frothing_rage(2), deadly_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(8)
4:35.452 direct I mutilate Fluffy_Pillow 106.2/170: 62% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(8)
4:36.457 direct I mutilate Fluffy_Pillow 86.1/170: 51% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(8)
4:37.460 dot K rupture Fluffy_Pillow 66.0/170: 39% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(8)
4:38.464 direct I mutilate Fluffy_Pillow 56.1/170: 33% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(17)
4:39.470 Waiting     0.600 sec 34.6/170: 20% energy | 2.0/5: 40% combo_points elaborate_planning, frothing_rage(2), deadly_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(16)
4:40.070 direct I mutilate Fluffy_Pillow 56.9/170: 33% energy | 2.0/5: 40% combo_points elaborate_planning, frothing_rage(2), deadly_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(15)
4:41.075 Waiting     0.614 sec 20.7/170: 12% energy | 4.0/5: 80% combo_points elaborate_planning, frothing_rage(2), deadly_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14)
4:41.689 cds G toxic_blade Fluffy_Pillow 43.1/170: 25% energy | 4.0/5: 80% combo_points frothing_rage(2), deadly_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14)
4:42.854 direct H envenom Fluffy_Pillow 39.1/170: 23% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
4:43.858 Waiting     1.000 sec 31.9/170: 19% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge
4:44.858 direct I mutilate Fluffy_Pillow 59.6/170: 35% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
4:45.863 Waiting     0.619 sec 23.4/170: 14% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
4:46.482 dot J garrote Fluffy_Pillow 45.8/170: 27% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
4:47.487 Waiting     1.671 sec 14.5/170: 9% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), deadly_navigation(3), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
4:49.158 direct I mutilate Fluffy_Pillow 51.2/170: 30% energy | 3.0/5: 60% combo_points frothing_rage(3), deadly_navigation(4), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge
4:50.161 Waiting     0.500 sec 28.7/170: 17% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation(4), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
4:50.661 direct H envenom Fluffy_Pillow 35.5/170: 21% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation(4), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
4:51.667 Waiting     1.200 sec 28.1/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
4:52.867 direct I mutilate Fluffy_Pillow 58.2/170: 34% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(2)
4:53.871 Waiting     1.147 sec 21.7/170: 13% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(2)
4:55.018 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), deadly_navigation_final, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:56.022 Waiting     4.085 sec 14.5/170: 9% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation_final, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 6566 6148 4387 (3433)
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 1676 1464 0
Spirit 0 0 0 0 0
Health 180520 164120 0
Energy 170 170 0
Combo Points 5 5 0
Crit 22.58% 22.58% 906
Haste 19.37% 19.37% 1317
Damage / Heal Versatility 2.29% 2.29% 195
Attack Power 7223 6148 0
Mastery 27.39% 27.39% 584
Armor 1897 1897 1897
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Hood of Pestilent Ichor
ilevel: 390, stats: { 260 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Unstable Flames, Resounding Protection, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Usurper's Bloodcaked Spaulders
ilevel: 390, stats: { 240 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Vampiric Speed, Azerite Empowered }
Local Chest Jerkin of the Aberrant Chimera
ilevel: 390, stats: { 320 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Resounding Protection, Azerite Empowered }
Local Waist Replicated Chitin Cord
ilevel: 385, stats: { 174 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Legs Pathogenic Legwraps
ilevel: 385, stats: { 271 Armor, +329 AgiInt, +556 Sta, +154 Haste, +91 Mastery }
Local Feet Quarantine Protocol Treads
ilevel: 385, stats: { 213 Armor, +247 AgiInt, +417 Sta, +104 Haste, +80 Vers }
Local Wrists Wristwraps of Coursing Miasma
ilevel: 385, stats: { 135 Armor, +185 AgiInt, +312 Sta, +83 Crit, +54 Haste }
Local Hands Gloves of Descending Madness
ilevel: 385, stats: { 193 Armor, +247 AgiInt, +417 Sta, +115 Haste, +68 Crit }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: deadly_navigation
Local Off Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: quick_navigation

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Blindside (Assassination Rogue)
30 Nightstalker Subterfuge Master Assassin (Assassination Rogue)
45 Vigor Deeper Stratagem Marked for Death
60 Leeching Poison (Assassination Rogue) Cheat Death Elusiveness
75 Internal Bleeding (Assassination Rogue) Iron Wire (Assassination Rogue) Prey on the Weak
90 Venom Rush (Assassination Rogue) Toxic Blade (Assassination Rogue) Exsanguinate (Assassination Rogue)
100 Poison Bomb (Assassination Rogue) Hidden Blades (Assassination Rogue) Crimson Tempest (Assassination Rogue)

Profile

rogue="T22_Rogue_Assassination"
spec=assassination
level=120
race=troll
role=attack
position=back
talents=2210021

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion
actions.precombat+=/marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=variable,name=energy_regen_combined,value=energy.regen+poisoned_bleeds*7%(2*spell_haste)
actions+=/call_action_list,name=stealthed,if=stealthed.rogue
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=dot
actions+=/call_action_list,name=direct
actions+=/arcane_torrent,if=energy.deficit>=15+variable.energy_regen_combined
actions+=/arcane_pulse
actions+=/lights_judgment

actions.cds=potion,if=buff.bloodlust.react|target.time_to_die<=60|debuff.vendetta.up&cooldown.vanish.remains<5
actions.cds+=/blood_fury,if=debuff.vendetta.up
actions.cds+=/berserking,if=debuff.vendetta.up
actions.cds+=/fireblood,if=debuff.vendetta.up
actions.cds+=/ancestral_call,if=debuff.vendetta.up
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit*1.5|(raid_event.adds.in>40&combo_points.deficit>=cp_max_spend)
actions.cds+=/vendetta,if=dot.rupture.ticking
# Vanish with Exsg + (Nightstalker, or Subterfuge only on 1T): Maximum CP and Exsg ready for next GCD
actions.cds+=/vanish,if=talent.exsanguinate.enabled&(talent.nightstalker.enabled|talent.subterfuge.enabled&spell_targets.fan_of_knives<2)&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1
# Vanish with Nightstalker + No Exsg: Maximum CP and Vendetta up
actions.cds+=/vanish,if=talent.nightstalker.enabled&!talent.exsanguinate.enabled&combo_points>=cp_max_spend&debuff.vendetta.up
# Vanish with Subterfuge + (No Exsg or 2T+): No stealth/subterfuge, Garrote Refreshable, enough space for incoming Garrote CP
actions.cds+=/vanish,if=talent.subterfuge.enabled&(!talent.exsanguinate.enabled|spell_targets.fan_of_knives>=2)&!stealthed.rogue&cooldown.garrote.up&dot.garrote.refreshable&(spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives|spell_targets.fan_of_knives>=4&combo_points.deficit>=4)
# Vanish with Master Assasin: No stealth and no active MA buff, Rupture not in refresh range
actions.cds+=/vanish,if=talent.master_assassin.enabled&!stealthed.all&master_assassin_remains<=0&!dot.rupture.refreshable
# Exsanguinate when both Rupture and Garrote are up for long enough
actions.cds+=/exsanguinate,if=dot.rupture.remains>4+4*cp_max_spend&!dot.garrote.refreshable
actions.cds+=/toxic_blade,if=dot.rupture.ticking

# Envenom at 4+ (5+ with DS) CP. Immediately on 2+ targets, with Vendetta, or with TB; otherwise wait for some energy. Also wait if Exsg combo is coming up.
actions.direct=envenom,if=combo_points>=4+talent.deeper_stratagem.enabled&(debuff.vendetta.up|debuff.toxic_blade.up|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2)&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)
actions.direct+=/variable,name=use_filler,value=combo_points.deficit>1|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2
# Poisoned Knife at 29+ stacks of Sharpened Blades. Up to 4 targets with Rank 1, more otherwise.
actions.direct+=/poisoned_knife,if=variable.use_filler&buff.sharpened_blades.stack>=29&(azerite.sharpened_blades.rank>=2|spell_targets.fan_of_knives<=4)
actions.direct+=/fan_of_knives,if=variable.use_filler&(buff.hidden_blades.stack>=19|spell_targets.fan_of_knives>=2+stealthed.rogue|buff.the_dreadlords_deceit.stack>=29)
actions.direct+=/blindside,if=variable.use_filler&(buff.blindside.up|!talent.venom_rush.enabled)
actions.direct+=/mutilate,if=variable.use_filler

# Special Rupture setup for Exsg
actions.dot=rupture,if=talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2)))
# Garrote upkeep, also tries to use it as a special generator for the last CP before a finisher
actions.dot+=/pool_resource,for_next=1
actions.dot+=/garrote,cycle_targets=1,if=(!talent.subterfuge.enabled|!(cooldown.vanish.up&cooldown.vendetta.remains<=4))&combo_points.deficit>=1&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&(target.time_to_die-remains>4&spell_targets.fan_of_knives<=1|target.time_to_die-remains>12)
# Crimson Tempest only on multiple targets at 4+ CP when running out in 2s (up to 4 targets) or 3s (5+ targets)
actions.dot+=/crimson_tempest,if=spell_targets>=2&remains<2+(spell_targets>=5)&combo_points>=4
# Keep up Rupture at 4+ on all targets (when living long enough and not snapshot)
actions.dot+=/rupture,cycle_targets=1,if=combo_points>=4&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>4

# Nighstalker, or Subt+Exsg on 1T: Snapshot Rupture; Also use Rupture over Envenom if it's not applied (Opener)
actions.stealthed=rupture,if=combo_points>=4&(talent.nightstalker.enabled|talent.subterfuge.enabled&talent.exsanguinate.enabled&spell_targets.fan_of_knives<2|!ticking)&target.time_to_die-remains>6
actions.stealthed+=/envenom,if=combo_points>=cp_max_spend
# Subterfuge: Apply or Refresh with buffed Garrotes
actions.stealthed+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&refreshable&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>2
# Subterfuge: Override normal Garrotes with snapshot versions
actions.stealthed+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&remains<=10&pmultiplier<=1&!exsanguinated&target.time_to_die-remains>2
# Subterfuge + Exsg: Even override a snapshot Garrote right after Rupture before Exsanguination
actions.stealthed+=/pool_resource,for_next=1
actions.stealthed+=/garrote,if=talent.subterfuge.enabled&talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&prev_gcd.1.rupture&dot.rupture.remains>5+4*cp_max_spend

head=hood_of_pestilent_ichor,id=160623,bonus_id=4824/1507/4775,azerite_powers=4/483/459/15/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=usurpers_bloodcaked_spaulders,id=160620,bonus_id=4824/1507/4775,azerite_powers=4/483/30/44/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=jerkin_of_the_aberrant_chimera,id=160619,bonus_id=4824/1507/4775,azerite_powers=4/483/21/15/13
wrists=wristwraps_of_coursing_miasma,id=160621,bonus_id=4800/1507
hands=gloves_of_descending_madness,id=160618,bonus_id=4800/1507
waist=replicated_chitin_cord,id=160717,bonus_id=4800/1507
legs=pathogenic_legwraps,id=160625,bonus_id=4800/1507
feet=quarantine_protocol_treads,id=160624,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=deadly_navigation
off_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=906
# gear_haste_rating=1317
# gear_mastery_rating=584
# gear_versatility_rating=195
# gear_armor=1897

T22_Rogue_Outlaw : 16454 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16454.2 16454.2 17.3 / 0.105% 3013.9 / 18.3% 498.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
33.0 32.6 Energy 10.42% 57.3 100.0% 100%
Talents
  • 15: Quick Draw (Outlaw Rogue)
  • 30: Hit and Run (Outlaw Rogue)
  • 45: Vigor
  • 90: Alacrity (Outlaw Rogue)
  • 100: Killing Spree (Outlaw Rogue)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Rogue_Outlaw 16454
Ambush 241 1.5% 6.6 57.28sec 10882 10833 Direct 6.6 8490 17280 10882 27.2% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.64 6.64 0.00 0.00 1.0045 0.0000 72204.17 103224.54 30.05 10833.33 10833.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.83 72.79% 8490.18 7519 11754 8480.41 0 10294 41006 58623 30.05
crit 1.81 27.21% 17280.26 15412 23979 15133.23 0 23690 31198 44602 26.32
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing {$s1=0} Physical damage. |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
auto_attack_mh 2472 15.0% 214.3 1.41sec 3458 2513 Direct 214.3 3110 6344 3458 29.0% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.31 214.31 0.00 0.00 1.3758 0.0000 741036.23 1059400.29 30.05 2513.18 2513.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.40 51.98% 3110.26 2817 3696 3110.51 3057 3169 346487 495344 30.05
crit 62.19 29.02% 6344.46 5747 7539 6344.84 6228 6504 394550 564056 30.05
miss 40.73 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
auto_attack_oh 1220 7.4% 211.5 1.42sec 1730 1237 Direct 211.5 1555 3172 1730 29.0% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 211.47 211.47 0.00 0.00 1.3980 0.0000 365732.41 522858.40 30.05 1237.13 1237.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.93 51.98% 1555.19 1409 1848 1555.32 1529 1586 170962 244411 30.05
crit 61.41 29.04% 3171.70 2873 3769 3171.86 3112 3247 194770 278447 30.05
miss 40.13 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Between the Eyes 735 4.5% 8.1 24.71sec 27057 28959 Direct 8.1 7593 31252 27058 82.3% 0.0%  

Stats details: between_the_eyes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.14 8.14 0.00 0.00 0.9344 0.0000 220352.52 315020.38 30.05 28959.46 28959.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.44 17.73% 7593.03 5674 9285 5565.61 0 9173 10964 15674 22.02
crit 6.70 82.27% 31251.74 19010 38255 30499.03 0 37174 209389 299346 29.29
 
 

Action details: between_the_eyes

Static Values
  • id:199804
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ruthless_precision.up|azerite.ace_up_your_sleeve.enabled|azerite.deadshot.enabled
Spelldata
  • id:199804
  • name:Between the Eyes
  • school:physical
  • tooltip:Stunned.
  • description:Finishing move that deals damage with your pistol and stuns the target.$?a235484[ Critical strikes with this ability deal four times normal damage.][] 1 point : ${$<damage>*1} damage, 1 sec 2 points: ${$<damage>*2} damage, 2 sec 3 points: ${$<damage>*3} damage, 3 sec 4 points: ${$<damage>*4} damage, 4 sec 5 points: ${$<damage>*5} damage, 5 sec{$?s193531=false}[ 6 points: ${$<damage>*6} damage, 6 sec][]
 
Dispatch 3689 22.4% 58.6 5.00sec 18879 20264 Direct 58.6 14536 29690 18879 28.7% 0.0%  

Stats details: dispatch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.56 58.56 0.00 0.00 0.9317 0.0000 1105625.23 1580624.04 30.05 20264.02 20264.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.78 71.34% 14536.47 8523 17955 14559.75 13516 15464 607350 868279 30.05
crit 16.78 28.66% 29690.50 17060 36628 29727.28 25850 32033 498276 712345 30.05
 
 

Action details: dispatch

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Dispatch
  • school:physical
  • tooltip:
  • description:Finishing move that dispatches the enemy, dealing damage per combo point: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Frenetic Blow (frentic_blow) 369 2.2% 4.0 66.85sec 27702 0 Direct 4.0 21099 43027 27701 30.1% 0.0%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.99 3.99 0.00 0.00 0.0000 0.0000 110613.57 158135.38 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.79 69.89% 21098.83 20587 22607 20711.30 0 22607 58877 84171 29.50
crit 1.20 30.11% 43027.09 41997 46119 31802.98 0 46119 51737 73964 22.21
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Killing Spree 0 (645) 0.0% (3.9%) 5.7 49.91sec 34268 15280

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.65 0.00 33.79 0.00 2.2428 0.3331 0.00 0.00 0.00 15280.37 15280.37
 
 

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_flurry_sync&(energy.time_to_max>5|energy<15)
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec.
  • description:Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Killing Spree (_mh) 323 2.0% 33.8 7.14sec 2868 0 Periodic 33.8 2191 4466 2868 29.7% 0.0% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.79 0.00 0.00 33.79 0.0000 0.0000 96907.41 138540.78 30.05 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.7 70.27% 2191.41 2035 2426 2191.42 2113 2279 52037 74393 30.05
crit 10.0 29.73% 4466.07 4151 4949 4465.64 4238 4909 44871 64148 30.05
 
 

Action details: killing_spree_mh

Static Values
  • id:57841
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57841
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Killing Spree (_oh) 323 2.0% 33.8 7.14sec 2866 0 Periodic 33.8 2191 4467 2866 29.7% 0.0% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.79 0.00 0.00 33.79 0.0000 0.0000 96863.00 138477.29 30.05 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.8 70.33% 2191.18 2035 2426 2191.11 2112 2280 52079 74454 30.05
crit 10.0 29.67% 4467.18 4151 4949 4466.39 0 4909 44784 64024 30.05
 
 

Action details: killing_spree_oh

Static Values
  • id:57842
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57842
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Main Gauche 2113 12.8% 117.3 2.64sec 5402 0 Direct 117.3 4130 8424 5402 29.6% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.30 117.30 0.00 0.00 0.0000 0.0000 633601.71 905809.74 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.55 70.37% 4129.63 3668 5781 4129.90 3990 4434 340886 487338 30.05
crit 34.75 29.63% 8423.78 7482 11792 8423.39 8038 9080 292716 418472 30.05
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:{$@spelldesc76806=Your main-hand attacks have a {$h=30}% chance to trigger an attack with your off-hand that deals {$86392s1=0} Physical damage.}
 
Pistol Shot 1751 10.6% 51.3 5.76sec 10234 11005 Direct 51.3 7829 15912 10233 29.7% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.30 51.30 0.00 0.00 0.9299 0.0000 525004.07 750556.36 30.05 11004.99 11004.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.04 70.25% 7829.00 6884 10814 7832.13 7473 8798 282162 403385 30.05
crit 15.26 29.75% 15912.42 14044 22061 15923.97 14975 18813 242842 347171 30.05
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadside.up+talent.quick_draw.enabled&buff.opportunity.up
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing ${{$s1=0}*$<CAP>/$AP} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Sinister Strike 3220 19.6% 131.5 2.27sec 7343 7889 Direct 183.1 4026 8186 5272 30.0% 0.0%  

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.48 183.11 0.00 0.00 0.9307 0.0000 965405.87 1380163.63 30.05 7889.37 7889.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.23 70.03% 4025.60 3549 5575 4027.61 3880 4455 516206 737979 30.05
crit 54.88 29.97% 8185.57 7239 11372 8192.80 7839 9119 449199 642185 30.05
 
 

Action details: sinister_strike

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193315
  • name:Sinister Strike
  • school:physical
  • tooltip:
  • description:Viciously strike an enemy, causing ${{$s1=0}*$<mult>} Physical damage.{$?s279876=true}[ Has a {$s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Rogue_Outlaw
Adrenaline Rush 4.7 72.59sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.66 0.00 0.00 0.00 0.7890 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.8000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=60}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=60}% and your attack speed by {$s2=20}% for {$d=20 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Outlaw
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Outlaw
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Outlaw
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 14.7 20.14sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.66 0.00 0.00 0.00 0.9292 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Vanish 5.6 57.28sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.64 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!stealthed.all&variable.ambush_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 4.7 0.0 71.8sec 72.5sec 29.90% 27.35% 0.0(0.0) 4.4

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • adrenaline_rush_1:29.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=60}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=60}% and your attack speed by {$s2=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 77.2 0.0sec 3.8sec 99.05% 100.00% 73.2(73.2) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_alacrity
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • alacrity_1:0.94%
  • alacrity_2:0.96%
  • alacrity_3:0.96%
  • alacrity_4:0.96%
  • alacrity_5:95.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=2}% for {$d=20 seconds}.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:36.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=6}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Agility 2.0 0.0 72.8sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Broadside 3.0 0.0 62.0sec 62.0sec 15.73% 13.98% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_broadside
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • broadside_1:15.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193356
  • name:Broadside
  • tooltip:Your combo-point generating abilities generate {$s1=1} additional combo point and deal {$s4=20}% increased damage.
  • description:Your combo-point generating abilities generate {$s1=1} additional combo point and deal {$s4=20}% increased damage for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 3.1 0.0 62.7sec 62.7sec 17.01% 15.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • buried_treasure_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by ${{$s1=20}/5} per sec.
  • description:Your base Energy regeneration is increased by ${{$s1=20}/5} per sec for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.6 0.2 75.2sec 66.1sec 8.97% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:8.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.9sec 66.0sec 8.99% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 74.5sec 65.3sec 9.04% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 74.2sec 65.1sec 9.02% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 5.1 13.1 61.9sec 16.2sec 75.24% 0.00% 0.0(0.0) 0.4

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:27.01%
  • frothing_rage_2:25.03%
  • frothing_rage_3:23.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Grand Melee 3.0 0.0 75.9sec 75.9sec 38.70% 39.71% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.65
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grand_melee_1:38.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=55}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=55}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Killing Spree 2.2 0.0 149.7sec 149.7sec 1.45% 0.00% 10.8(10.8) 2.2

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:2.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.40

Stack Uptimes

  • killing_spree_1:1.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51690
  • name:Killing Spree
  • tooltip:Attacking an enemy every $t1 sec.
  • description:Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.
  • max_stacks:0
  • duration:2.00
  • cooldown:120.00
  • default_chance:0.00%
Opportunity 51.6 0.0 5.8sec 5.8sec 32.62% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • opportunity_1:32.62%

Trigger Attempt Success

  • trigger_pct:39.47%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot costs {$s1=50}% less Energy and deals {$s3=100}% increased damage.
  • description:{$@spelldesc193315=Viciously strike an enemy, causing ${{$s1=0}*$<mult>} Physical damage.{$?s279876=true}[ Has a {$s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 5.2 0.0 56.8sec 34.6sec 39.63% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.55%
  • overwhelming_power_2:1.56%
  • overwhelming_power_3:1.56%
  • overwhelming_power_4:1.57%
  • overwhelming_power_5:1.57%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.58%
  • overwhelming_power_8:1.59%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.60%
  • overwhelming_power_11:1.61%
  • overwhelming_power_12:1.61%
  • overwhelming_power_13:1.61%
  • overwhelming_power_14:1.62%
  • overwhelming_power_15:1.63%
  • overwhelming_power_16:1.63%
  • overwhelming_power_17:1.64%
  • overwhelming_power_18:1.64%
  • overwhelming_power_19:1.65%
  • overwhelming_power_20:1.65%
  • overwhelming_power_21:1.66%
  • overwhelming_power_22:1.66%
  • overwhelming_power_23:1.67%
  • overwhelming_power_24:1.70%
  • overwhelming_power_25:0.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.2sec 10.4sec 68.92% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.03%
  • quick_navigation_2:17.52%
  • quick_navigation_3:16.97%
  • quick_navigation_4:16.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.08% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roll the Bones 2.6 12.1 107.9sec 20.2sec 98.35% 0.00% 12.1(12.1) 1.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • roll_the_bones_1:98.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Ruthless Precision 3.0 0.0 76.1sec 76.1sec 38.52% 44.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_ruthless_precision
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • ruthless_precision_1:38.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193357
  • name:Ruthless Precision
  • tooltip:Critical strike chance of Between the Eyes increased by ${{$s1=20}+{$s2=40}}%. Critical strike chance of all other abilities increased by {$s1=20}%.
  • description:Increases the critical ctrike chance of Between the Eyes by ${{$s1=20}+{$s2=40}}% and the critical strike chance of all other abilities by {$s1=20}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Skull and Crossbones 3.0 0.0 62.4sec 62.4sec 16.33% 15.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_skull_and_crossbones
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • skull_and_crossbones_1:16.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199603
  • name:Skull and Crossbones
  • tooltip:Sinister Strike has an additional {$s1=30}% chance of striking an additional time.
  • description:Causes Sinister Strike to have an additional {$s1=30}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=20}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Titanic Overcharge 12.3 33.4 25.0sec 6.6sec 85.07% 0.00% 3.7(3.7) 11.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:40.51

Stack Uptimes

  • titanic_overcharge_1:22.99%
  • titanic_overcharge_2:16.78%
  • titanic_overcharge_3:12.26%
  • titanic_overcharge_4:8.89%
  • titanic_overcharge_5:6.54%
  • titanic_overcharge_6:4.72%
  • titanic_overcharge_7:3.47%
  • titanic_overcharge_8:9.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=36} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
True Bearing 3.0 0.0 63.2sec 63.2sec 17.06% 18.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • true_bearing_1:17.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishing moves reduce the remaining cooldown of many of your abilities by an additional $<cdr> sec per combo point.
  • description:Finishing moves reduce the remaining cooldown of many of your abilities by an additional $<cdr> sec per combo point.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unstable Flames 25.9 28.5 11.8sec 5.5sec 67.49% 0.00% 2.2(2.2) 25.2

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:32.09%
  • unstable_flames_2:16.84%
  • unstable_flames_3:8.82%
  • unstable_flames_4:4.62%
  • unstable_flames_5:5.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 5.6 0.0 57.2sec 57.2sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vanish_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Versatile Navigation 6.2 23.1 52.1sec 10.4sec 68.94% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_versatile_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:50.00

Stack Uptimes

  • versatile_navigation_1:18.04%
  • versatile_navigation_2:17.49%
  • versatile_navigation_3:16.96%
  • versatile_navigation_4:16.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268854
  • name:Versatile Navigation
  • tooltip:Increases Versatility by $w1.
  • description:{$@spelldesc268852=Permanently enchant a weapon to sometimes increase Versatility by $268854s for {$268854d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268856s Versatility for {$268856d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Versatile Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.11% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_versatile_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:600.00

Stack Uptimes

  • versatile_navigation_final_1:18.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268856
  • name:Versatile Navigation
  • tooltip:Increases Versatility by $w1.
  • description:{$@spelldesc268852=Permanently enchant a weapon to sometimes increase Versatility by $268854s for {$268854d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268856s Versatility for {$268856d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Sinister Strike Extra Attack 51.6 5.8sec
Roll the Bones: 1 buff 11.6 24.4sec
Roll the Bones: 2 buffs 3.0 76.1sec
Roll the Bones: 5 buffs 0.2 115.3sec

Resources

Resource Usage Type Count Total Average RPE APR
T22_Rogue_Outlaw
ambush Energy 6.6 331.8 50.0 50.0 217.6
between_the_eyes Energy 8.1 203.6 25.0 25.0 1082.2
between_the_eyes Combo Points 8.1 39.4 4.8 4.8 5587.8
dispatch Energy 58.6 2049.7 35.0 35.0 539.4
dispatch Combo Points 58.6 281.0 4.8 4.8 3934.3
pistol_shot Energy 51.3 1026.0 20.0 20.0 511.7
roll_the_bones Energy 14.7 366.5 25.0 25.0 0.0
roll_the_bones Combo Points 14.7 70.8 4.8 4.8 0.0
sinister_strike Energy 131.5 5916.5 45.0 45.0 163.2
Resource Gains Type Count Total Average Overflow
pistol_shot Combo Points 51.30 51.30 (13.02%) 1.00 0.00 0.00%
sinister_strike Combo Points 183.11 170.84 (43.34%) 0.93 12.27 6.70%
ambush Combo Points 6.64 13.27 (3.37%) 2.00 0.00 0.00%
energy_regen Energy 1173.66 6194.10 (63.29%) 5.28 129.33 2.05%
Adrenaline Rush Energy 318.50 1072.35 (10.96%) 3.37 72.05 6.30%
Buried Treasure Energy 171.67 193.06 (1.97%) 1.12 10.48 5.15%
Combat Potency Energy 241.87 2327.47 (23.78%) 9.62 91.27 3.77%
Quick Draw Combo Points 51.30 51.30 (13.02%) 1.00 0.00 0.00%
Broadside Combo Points 31.60 29.15 (7.40%) 0.92 2.44 7.74%
Ruthlessness Combo Points 78.27 78.27 (19.86%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 32.62 32.98
Combo Points 1.31 1.30
Combat End Resource Mean Min Max
Energy 43.03 0.00 150.00
Combo Points 2.92 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.3%

Statistics & Data Analysis

Fight Length
Sample Data T22_Rogue_Outlaw Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Rogue_Outlaw Damage Per Second
Count 7499
Mean 16454.22
Minimum 13955.50
Maximum 20998.49
Spread ( max - min ) 7042.99
Range [ ( max - min ) / 2 * 100% ] 21.40%
Standard Deviation 764.4758
5th Percentile 15281.60
95th Percentile 17803.96
( 95th Percentile - 5th Percentile ) 2522.36
Mean Distribution
Standard Deviation 8.8280
95.00% Confidence Intervall ( 16436.92 - 16471.53 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 83
0.1% Error 8293
0.1 Scale Factor Error with Delta=300 4989
0.05 Scale Factor Error with Delta=300 19956
0.01 Scale Factor Error with Delta=300 498898
Priority Target DPS
Sample Data T22_Rogue_Outlaw Priority Target Damage Per Second
Count 7499
Mean 16454.22
Minimum 13955.50
Maximum 20998.49
Spread ( max - min ) 7042.99
Range [ ( max - min ) / 2 * 100% ] 21.40%
Standard Deviation 764.4758
5th Percentile 15281.60
95th Percentile 17803.96
( 95th Percentile - 5th Percentile ) 2522.36
Mean Distribution
Standard Deviation 8.8280
95.00% Confidence Intervall ( 16436.92 - 16471.53 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 83
0.1% Error 8293
0.1 Scale Factor Error with Delta=300 4989
0.05 Scale Factor Error with Delta=300 19956
0.01 Scale Factor Error with Delta=300 498898
DPS(e)
Sample Data T22_Rogue_Outlaw Damage Per Second (Effective)
Count 7499
Mean 16454.22
Minimum 13955.50
Maximum 20998.49
Spread ( max - min ) 7042.99
Range [ ( max - min ) / 2 * 100% ] 21.40%
Damage
Sample Data T22_Rogue_Outlaw Damage
Count 7499
Mean 4933346.19
Minimum 3476255.17
Maximum 6675074.90
Spread ( max - min ) 3198819.73
Range [ ( max - min ) / 2 * 100% ] 32.42%
DTPS
Sample Data T22_Rogue_Outlaw Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Rogue_Outlaw Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Rogue_Outlaw Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Rogue_Outlaw Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Rogue_Outlaw Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Rogue_Outlaw Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Rogue_OutlawTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Rogue_Outlaw Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion
6 0.00 marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40
7 0.00 roll_the_bones,precombat_seconds=2
8 0.00 slice_and_dice,precombat_seconds=2
9 0.00 adrenaline_rush,precombat_seconds=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=rtb_buffs<2&(buff.loaded_dice.up|!buff.grand_melee.up&!buff.ruthless_precision.up)
Reroll for 2+ buffs with Loaded Dice up. Otherwise reroll for 2+ or Grand Melee or Ruthless Precision.
0.00 variable,name=ambush_condition,value=combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&cooldown.ghostly_strike.remains<1)+buff.broadside.up&energy>60&!buff.skull_and_crossbones.up
0.00 variable,name=blade_flurry_sync,value=spell_targets.blade_flurry<2&raid_event.adds.in>20|buff.blade_flurry.up
With multiple targets, this variable is checked to decide whether some CDs should be synced with Blade Flurry
A 0.00 call_action_list,name=stealth,if=stealthed.all
B 0.00 call_action_list,name=cds
C 0.00 call_action_list,name=finish,if=combo_points>=cp_max_spend-(buff.broadside.up+buff.opportunity.up)*(talent.quick_draw.enabled&(!talent.marked_for_death.enabled|cooldown.marked_for_death.remains>1))
Finish at maximum CP. Substract one for each Broadside and Opportunity when Quick Draw is selected and MfD is not ready after the next second.
D 0.00 call_action_list,name=build
0.00 arcane_torrent,if=energy.deficit>=15+energy.regen
0.00 arcane_pulse
0.00 lights_judgment
actions.build
# count action,conditions
E 51.30 pistol_shot,if=combo_points.deficit>=1+buff.broadside.up+talent.quick_draw.enabled&buff.opportunity.up
F 131.48 sinister_strike
actions.cds
# count action,conditions
G 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=60|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
H 3.66 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.time_to_max>1
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15-buff.adrenaline_rush.up*5)&!stealthed.rogue&combo_points.deficit>=cp_max_spend-1)
0.00 blade_flurry,if=spell_targets>=2&!buff.blade_flurry.up&(!raid_event.adds.exists|raid_event.adds.remains>8|cooldown.blade_flurry.charges=1&raid_event.adds.in>(2-cooldown.blade_flurry.charges_fractional)*25)
Blade Flurry on 2+ enemies. With adds: Use if they stay for 8+ seconds or if your next charge will be ready in time for the next wave.
0.00 ghostly_strike,if=variable.blade_flurry_sync&combo_points.deficit>=1+buff.broadside.up
I 5.65 killing_spree,if=variable.blade_flurry_sync&(energy.time_to_max>5|energy<15)
0.00 blade_rush,if=variable.blade_flurry_sync&energy.time_to_max>1
J 5.64 vanish,if=!stealthed.all&variable.ambush_condition
Using Vanish/Ambush is only a very tiny increase, so in reality, you're absolutely fine to use it as a utility spell.
0.00 shadowmeld,if=!stealthed.all&variable.ambush_condition
actions.finish
# count action,conditions
0.00 slice_and_dice,if=buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
K 14.66 roll_the_bones,if=(buff.roll_the_bones.remains<=3|variable.rtb_reroll)&(target.time_to_die>20|buff.roll_the_bones.remains<target.time_to_die)
L 8.14 between_the_eyes,if=buff.ruthless_precision.up|azerite.ace_up_your_sleeve.enabled|azerite.deadshot.enabled
BTE with the Ruthless Precision buff from RtB or with the Ace Up Your Sleeve or Deadshot traits.
M 58.56 dispatch
actions.stealth
# count action,conditions
N 6.64 ambush

Sample Sequence

012459NJNFKFFFFMFFFFMFEMFFFFMFEMFEMFEMFFFFMFFFFMEFKEFFMEFIFMFEMJNFFMFFFMEFFMFFMEFFKFEKHGFFKFFLFFMFFMFMEMFFILEMFMJNMEMFLEMFFMFFMFLEMFKEFFKFFFFKFFFFMIEFFMHFEMJNFFMFFMEFFMFFFFMFFMEFFMFFFFKFFFFLFFMEFFMIEFFLJNFMEFFMEFFKFFLEHFFMFEMFEMFFFFLFEMFEMFFFFIMFELJNFKEFMEFMEFFLFFMEFFMFFFFLFEMFFFFKF

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Rogue_Outlaw 150.0/150: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation T22_Rogue_Outlaw 150.0/150: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food T22_Rogue_Outlaw 150.0/150: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 5 potion Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth, battle_potion_of_agility
Pre precombat 9 adrenaline_rush Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth, adrenaline_rush, battle_potion_of_agility
0:00.000 stealth N ambush Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth, adrenaline_rush, archive_of_the_titans, resounding_protection, battle_potion_of_agility
0:01.006 cds J vanish Fluffy_Pillow 128.5/150: 86% energy | 2.0/5: 40% combo_points bloodlust, adrenaline_rush, versatile_navigation, quick_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:01.006 stealth N ambush Fluffy_Pillow 128.5/150: 86% energy | 2.0/5: 40% combo_points bloodlust, vanish, adrenaline_rush, versatile_navigation, quick_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.009 build F sinister_strike Fluffy_Pillow 115.4/150: 77% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, versatile_navigation, quick_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.814 finish K roll_the_bones Fluffy_Pillow 100.0/150: 67% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, versatile_navigation, quick_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:03.617 build F sinister_strike Fluffy_Pillow 125.1/150: 83% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity, versatile_navigation, quick_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:04.421 build F sinister_strike Fluffy_Pillow 110.4/150: 74% energy | 2.0/5: 40% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity, versatile_navigation, quick_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:05.226 build F sinister_strike Fluffy_Pillow 105.8/150: 71% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity, versatile_navigation, quick_navigation, elemental_whirl_mastery, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:06.029 build F sinister_strike Fluffy_Pillow 101.1/150: 67% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity, versatile_navigation, quick_navigation, elemental_whirl_mastery, archive_of_the_titans(2), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:06.833 finish M dispatch Fluffy_Pillow 98.9/150: 66% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity, versatile_navigation, quick_navigation, elemental_whirl_mastery, archive_of_the_titans(2), resounding_protection, overwhelming_power(25), titanic_overcharge(3), battle_potion_of_agility
0:07.636 build F sinister_strike Fluffy_Pillow 107.2/150: 71% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(2), versatile_navigation, quick_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(2), resounding_protection, overwhelming_power(24), titanic_overcharge(3), battle_potion_of_agility
0:08.440 build F sinister_strike Fluffy_Pillow 105.5/150: 70% energy | 2.0/5: 40% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(2), versatile_navigation, quick_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(2), resounding_protection, overwhelming_power(23), titanic_overcharge(3), battle_potion_of_agility
0:09.246 build F sinister_strike Fluffy_Pillow 103.8/150: 69% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(2), versatile_navigation, quick_navigation, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(2), resounding_protection, overwhelming_power(22), titanic_overcharge(3), battle_potion_of_agility
0:10.050 build F sinister_strike Fluffy_Pillow 92.0/150: 61% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(2), versatile_navigation, quick_navigation, unstable_flames(2), archive_of_the_titans(3), resounding_protection, overwhelming_power(21), titanic_overcharge(3), battle_potion_of_agility
0:10.855 finish M dispatch Fluffy_Pillow 100.1/150: 67% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(2), versatile_navigation, quick_navigation, unstable_flames(2), archive_of_the_titans(3), resounding_protection, overwhelming_power(21), titanic_overcharge(3), battle_potion_of_agility
0:11.660 build F sinister_strike Fluffy_Pillow 108.7/150: 72% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(3), versatile_navigation, quick_navigation, unstable_flames(2), archive_of_the_titans(3), resounding_protection, overwhelming_power(20), titanic_overcharge(3), battle_potion_of_agility
0:12.464 build E pistol_shot Fluffy_Pillow 107.4/150: 72% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(3), versatile_navigation, quick_navigation(2), unstable_flames(2), archive_of_the_titans(3), resounding_protection, overwhelming_power(19), titanic_overcharge(3), battle_potion_of_agility
0:13.269 finish M dispatch Fluffy_Pillow 141.1/150: 94% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(3), versatile_navigation, quick_navigation(2), unstable_flames(2), archive_of_the_titans(3), resounding_protection, overwhelming_power(18), titanic_overcharge(3), battle_potion_of_agility
0:14.073 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(4), versatile_navigation, quick_navigation(2), unstable_flames(3), archive_of_the_titans(3), resounding_protection, overwhelming_power(17), titanic_overcharge(4), battle_potion_of_agility
0:14.876 build F sinister_strike Fluffy_Pillow 139.4/150: 93% energy | 2.0/5: 40% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(4), versatile_navigation, quick_navigation(3), unstable_flames(3), archive_of_the_titans(3), resounding_protection, overwhelming_power(17), titanic_overcharge(4), battle_potion_of_agility
0:15.681 build F sinister_strike Fluffy_Pillow 148.9/150: 99% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(4), versatile_navigation, quick_navigation(3), unstable_flames(3), archive_of_the_titans(4), resounding_protection, overwhelming_power(16), titanic_overcharge(4), battle_potion_of_agility
0:16.486 build F sinister_strike Fluffy_Pillow 138.3/150: 92% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(4), versatile_navigation(2), quick_navigation(3), unstable_flames(3), archive_of_the_titans(4), resounding_protection, overwhelming_power(15), titanic_overcharge(5), battle_potion_of_agility
0:17.291 finish M dispatch Fluffy_Pillow 137.8/150: 92% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(4), versatile_navigation(3), quick_navigation(3), unstable_flames(3), archive_of_the_titans(4), resounding_protection, overwhelming_power(14), titanic_overcharge(5), battle_potion_of_agility
0:18.096 build F sinister_strike Fluffy_Pillow 147.8/150: 99% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(3), unstable_flames(3), archive_of_the_titans(4), resounding_protection, overwhelming_power(13), titanic_overcharge(5), battle_potion_of_agility
0:18.900 build E pistol_shot Fluffy_Pillow 148.0/150: 99% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), archive_of_the_titans(4), resounding_protection, overwhelming_power(13), titanic_overcharge(6), battle_potion_of_agility
0:19.706 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), archive_of_the_titans(4), resounding_protection, overwhelming_power(12), titanic_overcharge(6), battle_potion_of_agility
0:20.710 build F sinister_strike Fluffy_Pillow 142.4/150: 95% energy | 1.0/5: 20% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), archive_of_the_titans(5), resounding_protection, overwhelming_power(11), titanic_overcharge(6), battle_potion_of_agility
0:21.715 build E pistol_shot Fluffy_Pillow 144.7/150: 96% energy | 3.0/5: 60% combo_points bloodlust, opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), archive_of_the_titans(5), resounding_protection, overwhelming_power(10), titanic_overcharge(6), battle_potion_of_agility
0:22.718 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, archive_of_the_titans(5), resounding_protection, overwhelming_power(9), titanic_overcharge(7), battle_potion_of_agility
0:23.722 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(8), titanic_overcharge(7)
0:24.726 build E pistol_shot Fluffy_Pillow 133.4/150: 89% energy | 3.0/5: 60% combo_points bloodlust, opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(7), titanic_overcharge(7)
0:25.730 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(6), resounding_protection, overwhelming_power(6), titanic_overcharge(7)
0:26.735 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(6), resounding_protection, overwhelming_power(5), titanic_overcharge(7)
0:27.738 build F sinister_strike Fluffy_Pillow 133.2/150: 89% energy | 2.0/5: 40% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(6), resounding_protection, overwhelming_power(4), titanic_overcharge(7)
0:28.740 build F sinister_strike Fluffy_Pillow 116.3/150: 78% energy | 3.0/5: 60% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(6), resounding_protection, overwhelming_power(3), titanic_overcharge(8)
0:29.745 build F sinister_strike Fluffy_Pillow 109.5/150: 73% energy | 4.0/5: 80% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(6), resounding_protection, overwhelming_power(2), titanic_overcharge(8)
0:30.747 finish M dispatch Fluffy_Pillow 112.5/150: 75% energy | 5.0/5: 100% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge(8)
0:31.752 build F sinister_strike Fluffy_Pillow 105.4/150: 70% energy | 1.0/5: 20% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), archive_of_the_titans(7), resounding_protection, titanic_overcharge(8)
0:32.756 build F sinister_strike Fluffy_Pillow 96.6/150: 64% energy | 2.0/5: 40% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(7), resounding_protection, titanic_overcharge(8)
0:33.763 build F sinister_strike Fluffy_Pillow 87.8/150: 59% energy | 3.0/5: 60% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(7), resounding_protection, titanic_overcharge(8)
0:34.766 build F sinister_strike Fluffy_Pillow 78.9/150: 53% energy | 4.0/5: 80% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(7), resounding_protection, titanic_overcharge(8)
0:35.768 finish M dispatch Fluffy_Pillow 79.9/150: 53% energy | 5.0/5: 100% combo_points bloodlust, opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(8), resounding_protection, titanic_overcharge(8)
0:36.774 build E pistol_shot Fluffy_Pillow 81.1/150: 54% energy | 1.0/5: 20% combo_points bloodlust, opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), archive_of_the_titans(8), resounding_protection, titanic_overcharge(8)
0:37.779 build F sinister_strike Fluffy_Pillow 97.2/150: 65% energy | 3.0/5: 60% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), archive_of_the_titans(8), resounding_protection, titanic_overcharge(8)
0:38.783 finish K roll_the_bones Fluffy_Pillow 97.9/150: 65% energy | 5.0/5: 100% combo_points bloodlust, opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation, archive_of_the_titans(8), resounding_protection
0:39.787 build E pistol_shot Fluffy_Pillow 108.2/150: 72% energy | 1.0/5: 20% combo_points bloodlust, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation, archive_of_the_titans(8), resounding_protection
0:40.792 build F sinister_strike Fluffy_Pillow 123.5/150: 82% energy | 3.0/5: 60% combo_points bloodlust, grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation, unstable_flames, archive_of_the_titans(9), resounding_protection, titanic_overcharge
0:41.796 build F sinister_strike Fluffy_Pillow 109.3/150: 73% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation, unstable_flames, archive_of_the_titans(9), resounding_protection, titanic_overcharge
0:42.800 finish M dispatch Fluffy_Pillow 83.8/150: 56% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation, unstable_flames, archive_of_the_titans(9), resounding_protection, titanic_overcharge
0:43.804 build E pistol_shot Fluffy_Pillow 78.3/150: 52% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation, unstable_flames, archive_of_the_titans(9), resounding_protection, titanic_overcharge
0:44.809 build F sinister_strike Fluffy_Pillow 79.3/150: 53% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation, archive_of_the_titans(9), resounding_protection, overwhelming_power(24), titanic_overcharge
0:45.813 cds I killing_spree Fluffy_Pillow 55.3/150: 37% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation, archive_of_the_titans(10), resounding_protection, overwhelming_power(23), titanic_overcharge
0:48.042 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation(2), archive_of_the_titans(10), resounding_protection, overwhelming_power(20), titanic_overcharge(2)
0:49.047 finish M dispatch Fluffy_Pillow 136.0/150: 91% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation(2), archive_of_the_titans(10), resounding_protection, overwhelming_power(19), titanic_overcharge(2)
0:50.051 build F sinister_strike Fluffy_Pillow 131.9/150: 88% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation(2), archive_of_the_titans(11), resounding_protection, overwhelming_power(18), titanic_overcharge(2)
0:51.055 build E pistol_shot Fluffy_Pillow 127.7/150: 85% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation(2), archive_of_the_titans(11), resounding_protection, overwhelming_power(17), titanic_overcharge(2)
0:52.059 finish M dispatch Fluffy_Pillow 138.5/150: 92% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), archive_of_the_titans(11), resounding_protection, overwhelming_power(16), titanic_overcharge(3)
0:53.063 cds J vanish Fluffy_Pillow 124.3/150: 83% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), archive_of_the_titans(11), resounding_protection, overwhelming_power(15), titanic_overcharge(3)
0:53.063 stealth N ambush Fluffy_Pillow 124.3/150: 83% energy | 1.0/5: 20% combo_points vanish, grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), archive_of_the_titans(11), resounding_protection, overwhelming_power(15), titanic_overcharge(3)
0:54.068 build F sinister_strike Fluffy_Pillow 105.1/150: 70% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), unstable_flames, archive_of_the_titans(11), resounding_protection, overwhelming_power(14), titanic_overcharge(3)
0:55.073 build F sinister_strike Fluffy_Pillow 100.8/150: 67% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), unstable_flames, archive_of_the_titans(12), resounding_protection, overwhelming_power(13), titanic_overcharge(4)
0:56.077 finish M dispatch Fluffy_Pillow 86.6/150: 58% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(12), resounding_protection, overwhelming_power(12), titanic_overcharge(4)
0:57.082 build F sinister_strike Fluffy_Pillow 72.2/150: 48% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(12), resounding_protection, overwhelming_power(11), titanic_overcharge(4)
0:58.086 build F sinister_strike Fluffy_Pillow 47.8/150: 32% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(12), resounding_protection, overwhelming_power(10), titanic_overcharge(4)
0:59.091 Waiting     1.100 sec 23.5/150: 16% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), unstable_flames(3), archive_of_the_titans(12), resounding_protection, overwhelming_power(9), titanic_overcharge(5)
1:00.191 build F sinister_strike Fluffy_Pillow 46.0/150: 31% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), unstable_flames(3), archive_of_the_titans(13), resounding_protection, overwhelming_power(8), titanic_overcharge(5)
1:01.196 Waiting     0.668 sec 21.6/150: 14% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(2), unstable_flames(3), archive_of_the_titans(13), resounding_protection, overwhelming_power(7), titanic_overcharge(5)
1:01.864 finish M dispatch Fluffy_Pillow 35.2/150: 23% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(2), unstable_flames(3), archive_of_the_titans(13), resounding_protection, overwhelming_power(7), titanic_overcharge(6)
1:02.868 build E pistol_shot Fluffy_Pillow 30.7/150: 20% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), unstable_flames(3), archive_of_the_titans(13), resounding_protection, overwhelming_power(6), titanic_overcharge(6)
1:03.873 Waiting     0.700 sec 31.2/150: 21% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), unstable_flames(4), archive_of_the_titans(13), resounding_protection, overwhelming_power(5), titanic_overcharge(6)
1:04.573 build F sinister_strike Fluffy_Pillow 45.4/150: 30% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), unstable_flames(4), archive_of_the_titans(13), resounding_protection, overwhelming_power(4), titanic_overcharge(6)
1:05.577 Waiting     0.200 sec 41.5/150: 28% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_haste, unstable_flames(4), archive_of_the_titans(14), resounding_protection, overwhelming_power(3), titanic_overcharge(6)
1:05.777 build F sinister_strike Fluffy_Pillow 45.7/150: 30% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(3), elemental_whirl_haste, unstable_flames(4), archive_of_the_titans(14), resounding_protection, overwhelming_power(3), titanic_overcharge(6)
1:06.781 Waiting     0.255 sec 21.7/150: 14% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(14), resounding_protection, overwhelming_power(2), titanic_overcharge(6)
1:07.036 finish M dispatch Fluffy_Pillow 37.1/150: 25% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(14), resounding_protection, overwhelming_power, titanic_overcharge(6)
1:08.039 Waiting     0.600 sec 23.0/150: 15% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(14), resounding_protection, titanic_overcharge(6)
1:08.639 build F sinister_strike Fluffy_Pillow 45.5/150: 30% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(14), resounding_protection, titanic_overcharge(6)
1:09.643 Waiting     0.200 sec 41.4/150: 28% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(14), resounding_protection, titanic_overcharge(6)
1:09.843 build F sinister_strike Fluffy_Pillow 45.6/150: 30% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(14), resounding_protection, titanic_overcharge(6)
1:10.847 finish M dispatch Fluffy_Pillow 41.5/150: 28% energy | 4.0/5: 80% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, archive_of_the_titans(15), resounding_protection, titanic_overcharge(6)
1:11.852 build E pistol_shot Fluffy_Pillow 37.2/150: 25% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, archive_of_the_titans(15), resounding_protection
1:12.856 Waiting     0.200 sec 37.5/150: 25% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, archive_of_the_titans(15), resounding_protection
1:13.056 build F sinister_strike Fluffy_Pillow 51.5/150: 34% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, archive_of_the_titans(15), resounding_protection
1:14.061 Waiting     0.500 sec 36.9/150: 25% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, archive_of_the_titans(15), resounding_protection
1:14.561 build F sinister_strike Fluffy_Pillow 47.0/150: 31% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), elemental_whirl_haste, archive_of_the_titans(15), resounding_protection
1:15.566 finish K roll_the_bones Fluffy_Pillow 31.7/150: 21% energy | 5.0/5: 100% combo_points alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), unstable_flames, archive_of_the_titans(16), resounding_protection
1:16.571 Waiting     1.000 sec 26.4/150: 18% energy | 1.0/5: 20% combo_points skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), unstable_flames, archive_of_the_titans(16), resounding_protection
1:17.571 build F sinister_strike Fluffy_Pillow 46.0/150: 31% energy | 1.0/5: 20% combo_points skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), unstable_flames, archive_of_the_titans(16), resounding_protection
1:18.575 build E pistol_shot Fluffy_Pillow 30.6/150: 20% energy | 3.0/5: 60% combo_points opportunity, skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), unstable_flames, archive_of_the_titans(16), resounding_protection
1:19.579 finish K roll_the_bones Fluffy_Pillow 30.3/150: 20% energy | 5.0/5: 100% combo_points skull_and_crossbones, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), unstable_flames(2), archive_of_the_titans(16), resounding_protection
1:20.583 cds H adrenaline_rush Fluffy_Pillow 35.1/150: 23% energy | 1.0/5: 20% combo_points broadside, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:21.589 cds G potion Fluffy_Pillow 66.8/150: 45% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:21.589 build F sinister_strike Fluffy_Pillow 66.8/150: 45% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:22.392 build F sinister_strike Fluffy_Pillow 57.1/150: 38% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:23.198 finish K roll_the_bones Fluffy_Pillow 37.5/150: 25% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:24.003 Waiting     0.300 sec 37.8/150: 25% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(17), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:24.303 build F sinister_strike Fluffy_Pillow 47.3/150: 32% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(17), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:25.108 Waiting     0.300 sec 37.8/150: 25% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:25.408 build F sinister_strike Fluffy_Pillow 47.3/150: 32% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:26.212 finish L between_the_eyes Fluffy_Pillow 27.9/150: 19% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:27.017 Waiting     0.300 sec 38.6/150: 26% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:27.317 build F sinister_strike Fluffy_Pillow 48.3/150: 32% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_mastery, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:28.122 Waiting     0.200 sec 40.2/150: 27% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_mastery, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:28.322 build F sinister_strike Fluffy_Pillow 46.9/150: 31% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_mastery, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:29.129 finish M dispatch Fluffy_Pillow 48.8/150: 33% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_mastery, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:29.932 build F sinister_strike Fluffy_Pillow 50.7/150: 34% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:30.738 Waiting     0.400 sec 32.6/150: 22% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:31.138 build F sinister_strike Fluffy_Pillow 45.9/150: 31% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:31.942 Waiting     0.300 sec 27.8/150: 19% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:32.242 finish M dispatch Fluffy_Pillow 37.8/150: 25% energy | 5.0/5: 100% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:33.046 Waiting     0.400 sec 29.7/150: 20% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:33.446 build F sinister_strike Fluffy_Pillow 53.1/150: 35% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:34.250 finish M dispatch Fluffy_Pillow 55.1/150: 37% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:35.054 build E pistol_shot Fluffy_Pillow 47.1/150: 31% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:35.860 finish M dispatch Fluffy_Pillow 64.1/150: 43% energy | 4.0/5: 80% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:36.664 build F sinister_strike Fluffy_Pillow 56.1/150: 37% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:37.468 build F sinister_strike Fluffy_Pillow 47.4/150: 32% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:38.272 cds I killing_spree Fluffy_Pillow 27.6/150: 18% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:40.486 finish L between_the_eyes Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:41.291 build E pistol_shot Fluffy_Pillow 141.9/150: 95% energy | 1.0/5: 20% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:42.296 finish M dispatch Fluffy_Pillow 141.5/150: 94% energy | 4.0/5: 80% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
1:43.300 build F sinister_strike Fluffy_Pillow 125.9/150: 84% energy | 1.0/5: 20% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, battle_potion_of_agility
1:44.305 finish M dispatch Fluffy_Pillow 100.2/150: 67% energy | 5.0/5: 100% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, battle_potion_of_agility
1:45.309 cds J vanish Fluffy_Pillow 94.5/150: 63% energy | 1.0/5: 20% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, battle_potion_of_agility
1:45.309 stealth N ambush Fluffy_Pillow 94.5/150: 63% energy | 1.0/5: 20% combo_points vanish, opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, battle_potion_of_agility
1:46.314 finish M dispatch Fluffy_Pillow 64.0/150: 43% energy | 4.0/5: 80% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation, archive_of_the_titans(20), resounding_protection, battle_potion_of_agility
1:47.319 build E pistol_shot Fluffy_Pillow 48.5/150: 32% energy | 1.0/5: 20% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection
1:48.324 finish M dispatch Fluffy_Pillow 58.1/150: 39% energy | 4.0/5: 80% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection
1:49.329 Waiting     0.200 sec 42.7/150: 28% energy | 1.0/5: 20% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), quick_navigation(2), archive_of_the_titans(20), resounding_protection
1:49.529 build F sinister_strike Fluffy_Pillow 46.6/150: 31% energy | 1.0/5: 20% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), quick_navigation(2), archive_of_the_titans(20), resounding_protection
1:50.532 finish L between_the_eyes Fluffy_Pillow 32.7/150: 22% energy | 5.0/5: 100% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(24)
1:51.535 build E pistol_shot Fluffy_Pillow 28.8/150: 19% energy | 1.0/5: 20% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(23)
1:52.539 finish M dispatch Fluffy_Pillow 39.9/150: 27% energy | 4.0/5: 80% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
1:53.544 Waiting     0.500 sec 26.0/150: 17% energy | 0.0/5: 0% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
1:54.044 build F sinister_strike Fluffy_Pillow 46.5/150: 31% energy | 0.0/5: 0% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
1:55.048 Waiting     0.700 sec 32.4/150: 22% energy | 2.0/5: 40% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
1:55.748 build F sinister_strike Fluffy_Pillow 57.0/150: 38% energy | 2.0/5: 40% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
1:56.754 Waiting     0.100 sec 32.9/150: 22% energy | 4.0/5: 80% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
1:56.854 finish M dispatch Fluffy_Pillow 35.0/150: 23% energy | 4.0/5: 80% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
1:57.859 Waiting     1.200 sec 20.8/150: 14% energy | 1.0/5: 20% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
1:59.059 build F sinister_strike Fluffy_Pillow 45.6/150: 30% energy | 1.0/5: 20% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge
2:00.065 Waiting     0.700 sec 31.5/150: 21% energy | 3.0/5: 60% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(4), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
2:00.765 build F sinister_strike Fluffy_Pillow 46.3/150: 31% energy | 3.0/5: 60% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
2:01.769 Waiting     0.100 sec 32.9/150: 22% energy | 5.0/5: 100% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12)
2:01.869 finish M dispatch Fluffy_Pillow 35.0/150: 23% energy | 5.0/5: 100% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12)
2:02.874 Waiting     0.665 sec 21.5/150: 14% energy | 1.0/5: 20% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11)
2:03.539 build F sinister_strike Fluffy_Pillow 45.6/150: 30% energy | 1.0/5: 20% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10)
2:04.543 finish L between_the_eyes Fluffy_Pillow 41.9/150: 28% energy | 5.0/5: 100% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(9)
2:05.547 build E pistol_shot Fluffy_Pillow 48.3/150: 32% energy | 1.0/5: 20% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
2:06.551 finish M dispatch Fluffy_Pillow 59.6/150: 40% energy | 4.0/5: 80% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge
2:07.556 build F sinister_strike Fluffy_Pillow 45.8/150: 31% energy | 1.0/5: 20% combo_points broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
2:08.561 finish K roll_the_bones Fluffy_Pillow 42.0/150: 28% energy | 5.0/5: 100% combo_points opportunity, broadside, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge
2:09.565 build E pistol_shot Fluffy_Pillow 42.1/150: 28% energy | 1.0/5: 20% combo_points opportunity, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
2:10.569 build F sinister_strike Fluffy_Pillow 56.8/150: 38% energy | 3.0/5: 60% combo_points buried_treasure, roll_the_bones, alacrity(5), frothing_rage(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge
2:11.574 build F sinister_strike Fluffy_Pillow 45.3/150: 30% energy | 4.0/5: 80% combo_points buried_treasure, roll_the_bones, alacrity(5), frothing_rage(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge
2:12.579 finish K roll_the_bones Fluffy_Pillow 33.8/150: 23% energy | 5.0/5: 100% combo_points buried_treasure, roll_the_bones, alacrity(5), frothing_rage(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:13.582 Waiting     0.800 sec 28.2/150: 19% energy | 1.0/5: 20% combo_points true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:14.382 build F sinister_strike Fluffy_Pillow 53.7/150: 36% energy | 1.0/5: 20% combo_points true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:15.385 Waiting     0.400 sec 38.0/150: 25% energy | 2.0/5: 40% combo_points true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection
2:15.785 build F sinister_strike Fluffy_Pillow 45.7/150: 30% energy | 2.0/5: 40% combo_points true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), archive_of_the_titans(20), resounding_protection
2:16.790 Waiting     0.800 sec 30.0/150: 20% energy | 3.0/5: 60% combo_points true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), archive_of_the_titans(20), resounding_protection
2:17.590 build F sinister_strike Fluffy_Pillow 45.4/150: 30% energy | 3.0/5: 60% combo_points true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation, archive_of_the_titans(20), resounding_protection
2:18.596 Waiting     0.300 sec 39.7/150: 26% energy | 4.0/5: 80% combo_points true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation, archive_of_the_titans(20), resounding_protection
2:18.896 build F sinister_strike Fluffy_Pillow 45.5/150: 30% energy | 4.0/5: 80% combo_points true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation, archive_of_the_titans(20), resounding_protection
2:19.900 finish K roll_the_bones Fluffy_Pillow 29.8/150: 20% energy | 5.0/5: 100% combo_points true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), archive_of_the_titans(20), resounding_protection
2:20.906 Waiting     1.100 sec 24.2/150: 16% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation, archive_of_the_titans(20), resounding_protection
2:22.006 build F sinister_strike Fluffy_Pillow 45.5/150: 30% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation, archive_of_the_titans(20), resounding_protection
2:23.008 Waiting     0.300 sec 40.1/150: 27% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:23.308 build F sinister_strike Fluffy_Pillow 46.0/150: 31% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:24.313 Waiting     1.315 sec 20.8/150: 14% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:25.628 build F sinister_strike Fluffy_Pillow 46.8/150: 31% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:26.632 Waiting     0.700 sec 31.8/150: 21% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:27.332 build F sinister_strike Fluffy_Pillow 45.7/150: 30% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:28.336 Waiting     0.300 sec 30.7/150: 20% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:28.636 finish M dispatch Fluffy_Pillow 36.7/150: 24% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:29.640 cds I killing_spree Fluffy_Pillow 21.6/150: 14% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:31.921 build E pistol_shot Fluffy_Pillow 137.2/150: 91% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:32.925 build F sinister_strike Fluffy_Pillow 137.6/150: 92% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:33.931 build F sinister_strike Fluffy_Pillow 113.0/150: 75% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
2:34.934 finish M dispatch Fluffy_Pillow 108.4/150: 72% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:35.939 cds H adrenaline_rush Fluffy_Pillow 103.9/150: 69% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:36.945 build F sinister_strike Fluffy_Pillow 147.6/150: 98% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:37.750 build E pistol_shot Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:38.554 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:39.361 cds J vanish Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:39.361 stealth N ambush Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points vanish, adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:40.365 build F sinister_strike Fluffy_Pillow 134.5/150: 90% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
2:41.169 build F sinister_strike Fluffy_Pillow 129.0/150: 86% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(8)
2:41.972 finish M dispatch Fluffy_Pillow 133.4/150: 89% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation, quick_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(8)
2:42.777 build F sinister_strike Fluffy_Pillow 137.8/150: 92% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation, quick_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(8)
2:43.583 build F sinister_strike Fluffy_Pillow 132.2/150: 88% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation, quick_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(8)
2:44.388 finish M dispatch Fluffy_Pillow 126.5/150: 84% energy | 4.0/5: 80% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation, quick_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(8)
2:45.192 build E pistol_shot Fluffy_Pillow 120.7/150: 80% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation, quick_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(8)
2:45.996 build F sinister_strike Fluffy_Pillow 139.8/150: 93% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(8)
2:46.802 build F sinister_strike Fluffy_Pillow 122.9/150: 82% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(8)
2:47.607 finish M dispatch Fluffy_Pillow 115.1/150: 77% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(8)
2:48.412 build F sinister_strike Fluffy_Pillow 127.3/150: 85% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(8)
2:49.218 build F sinister_strike Fluffy_Pillow 109.4/150: 73% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(8)
2:50.023 build F sinister_strike Fluffy_Pillow 91.4/150: 61% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(8)
2:50.828 build F sinister_strike Fluffy_Pillow 73.3/150: 49% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(8)
2:51.634 finish M dispatch Fluffy_Pillow 65.2/150: 43% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(8)
2:52.438 build F sinister_strike Fluffy_Pillow 67.0/150: 45% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(8)
2:53.242 build F sinister_strike Fluffy_Pillow 58.7/150: 39% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(8)
2:54.046 finish M dispatch Fluffy_Pillow 40.2/150: 27% energy | 4.0/5: 80% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(10)
2:54.850 build E pistol_shot Fluffy_Pillow 40.7/150: 27% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(10)
2:55.653 build F sinister_strike Fluffy_Pillow 56.1/150: 37% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(9)
2:56.456 build F sinister_strike Fluffy_Pillow 50.4/150: 34% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power(8)
2:57.461 Waiting     0.100 sec 25.2/150: 17% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7)
2:57.561 finish M dispatch Fluffy_Pillow 37.1/150: 25% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7)
2:58.565 Waiting     0.300 sec 31.8/150: 21% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(6)
2:58.865 build F sinister_strike Fluffy_Pillow 47.7/150: 32% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(6)
2:59.868 Waiting     0.200 sec 42.4/150: 28% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5)
3:00.068 build F sinister_strike Fluffy_Pillow 46.4/150: 31% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(4)
3:01.071 Waiting     0.797 sec 21.1/150: 14% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
3:01.868 build F sinister_strike Fluffy_Pillow 46.8/150: 31% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
3:02.871 Waiting     0.200 sec 41.4/150: 28% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge
3:03.071 build F sinister_strike Fluffy_Pillow 45.3/150: 30% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge
3:04.076 finish K roll_the_bones Fluffy_Pillow 39.9/150: 27% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:05.081 Waiting     0.600 sec 34.5/150: 23% energy | 1.0/5: 20% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:05.681 build F sinister_strike Fluffy_Pillow 46.3/150: 31% energy | 1.0/5: 20% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:06.686 Waiting     0.200 sec 31.1/150: 21% energy | 2.0/5: 40% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:06.886 build F sinister_strike Fluffy_Pillow 45.0/150: 30% energy | 2.0/5: 40% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:07.890 Waiting     0.800 sec 29.8/150: 20% energy | 3.0/5: 60% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:08.690 build F sinister_strike Fluffy_Pillow 45.5/150: 30% energy | 3.0/5: 60% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:09.695 Waiting     0.800 sec 30.3/150: 20% energy | 4.0/5: 80% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:10.495 build F sinister_strike Fluffy_Pillow 46.0/150: 31% energy | 4.0/5: 80% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:11.500 Waiting     0.307 sec 20.9/150: 14% energy | 5.0/5: 100% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:11.807 finish L between_the_eyes Fluffy_Pillow 27.0/150: 18% energy | 5.0/5: 100% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:12.813 Waiting     1.251 sec 22.0/150: 15% energy | 1.0/5: 20% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:14.064 build F sinister_strike Fluffy_Pillow 46.9/150: 31% energy | 1.0/5: 20% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:15.071 Waiting     0.500 sec 31.9/150: 21% energy | 2.0/5: 40% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:15.571 build F sinister_strike Fluffy_Pillow 51.8/150: 35% energy | 2.0/5: 40% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:16.576 finish M dispatch Fluffy_Pillow 36.9/150: 25% energy | 4.0/5: 80% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:17.579 build E pistol_shot Fluffy_Pillow 32.0/150: 21% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:18.582 Waiting     0.700 sec 32.0/150: 21% energy | 3.0/5: 60% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:19.282 build F sinister_strike Fluffy_Pillow 46.0/150: 31% energy | 3.0/5: 60% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:20.286 Waiting     0.700 sec 31.1/150: 21% energy | 4.0/5: 80% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:20.986 build F sinister_strike Fluffy_Pillow 45.1/150: 30% energy | 4.0/5: 80% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:21.991 Waiting     0.300 sec 30.1/150: 20% energy | 5.0/5: 100% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:22.291 finish M dispatch Fluffy_Pillow 36.1/150: 24% energy | 5.0/5: 100% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:23.296 cds I killing_spree Fluffy_Pillow 31.2/150: 21% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:25.643 build E pistol_shot Fluffy_Pillow 148.1/150: 99% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection
3:26.647 build F sinister_strike Fluffy_Pillow 147.8/150: 99% energy | 3.0/5: 60% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:27.650 build F sinister_strike Fluffy_Pillow 132.6/150: 88% energy | 4.0/5: 80% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:28.653 finish L between_the_eyes Fluffy_Pillow 117.5/150: 78% energy | 5.0/5: 100% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:29.658 cds J vanish Fluffy_Pillow 122.4/150: 82% energy | 1.0/5: 20% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:29.658 stealth N ambush Fluffy_Pillow 122.4/150: 82% energy | 1.0/5: 20% combo_points vanish, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:30.661 build F sinister_strike Fluffy_Pillow 112.3/150: 75% energy | 3.0/5: 60% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:31.664 finish M dispatch Fluffy_Pillow 97.2/150: 65% energy | 5.0/5: 100% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:32.668 build E pistol_shot Fluffy_Pillow 92.2/150: 61% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:33.675 build F sinister_strike Fluffy_Pillow 92.3/150: 62% energy | 3.0/5: 60% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:34.680 build F sinister_strike Fluffy_Pillow 77.4/150: 52% energy | 4.0/5: 80% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:35.685 finish M dispatch Fluffy_Pillow 62.5/150: 42% energy | 5.0/5: 100% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:36.690 build E pistol_shot Fluffy_Pillow 57.6/150: 38% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:37.696 build F sinister_strike Fluffy_Pillow 57.7/150: 38% energy | 3.0/5: 60% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:38.699 build F sinister_strike Fluffy_Pillow 52.8/150: 35% energy | 4.0/5: 80% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:39.705 finish K roll_the_bones Fluffy_Pillow 37.9/150: 25% energy | 5.0/5: 100% combo_points ruthless_precision, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:40.709 Waiting     0.600 sec 33.0/150: 22% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:41.309 build F sinister_strike Fluffy_Pillow 55.1/150: 37% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:42.313 Waiting     0.200 sec 41.8/150: 28% energy | 2.0/5: 40% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:42.513 build F sinister_strike Fluffy_Pillow 46.1/150: 31% energy | 2.0/5: 40% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:43.517 Waiting     0.202 sec 22.8/150: 15% energy | 4.0/5: 80% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:43.719 finish L between_the_eyes Fluffy_Pillow 27.1/150: 18% energy | 4.0/5: 80% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:44.724 build E pistol_shot Fluffy_Pillow 23.5/150: 16% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:45.729 cds H adrenaline_rush Fluffy_Pillow 24.9/150: 17% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:46.944 build F sinister_strike Fluffy_Pillow 73.7/150: 49% energy | 3.0/5: 60% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:47.749 build F sinister_strike Fluffy_Pillow 66.1/150: 44% energy | 4.0/5: 80% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:48.555 finish M dispatch Fluffy_Pillow 48.6/150: 32% energy | 5.0/5: 100% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:49.358 build F sinister_strike Fluffy_Pillow 51.0/150: 34% energy | 1.0/5: 20% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:50.162 build E pistol_shot Fluffy_Pillow 45.3/150: 30% energy | 3.0/5: 60% combo_points adrenaline_rush, opportunity, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(24)
3:50.967 finish M dispatch Fluffy_Pillow 54.7/150: 36% energy | 5.0/5: 100% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge
3:51.771 build F sinister_strike Fluffy_Pillow 57.4/150: 38% energy | 1.0/5: 20% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(2)
3:52.575 build E pistol_shot Fluffy_Pillow 49.1/150: 33% energy | 3.0/5: 60% combo_points adrenaline_rush, opportunity, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(2)
3:53.378 finish M dispatch Fluffy_Pillow 55.7/150: 37% energy | 5.0/5: 100% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge(2)
3:54.183 build F sinister_strike Fluffy_Pillow 57.4/150: 38% energy | 1.0/5: 20% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(2)
3:54.989 build F sinister_strike Fluffy_Pillow 49.0/150: 33% energy | 2.0/5: 40% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge(2)
3:55.795 Waiting     0.500 sec 30.5/150: 20% energy | 3.0/5: 60% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge(2)
3:56.295 build F sinister_strike Fluffy_Pillow 46.9/150: 31% energy | 3.0/5: 60% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(2)
3:57.101 Waiting     0.300 sec 38.4/150: 26% energy | 4.0/5: 80% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(2)
3:57.401 build F sinister_strike Fluffy_Pillow 48.2/150: 32% energy | 4.0/5: 80% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(2)
3:58.205 finish L between_the_eyes Fluffy_Pillow 49.5/150: 33% energy | 5.0/5: 100% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(2)
3:59.008 build F sinister_strike Fluffy_Pillow 50.7/150: 34% energy | 1.0/5: 20% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(2)
3:59.813 build E pistol_shot Fluffy_Pillow 51.9/150: 35% energy | 3.0/5: 60% combo_points adrenaline_rush, opportunity, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(2)
4:00.617 finish M dispatch Fluffy_Pillow 58.0/150: 39% energy | 5.0/5: 100% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(3)
4:01.421 build F sinister_strike Fluffy_Pillow 60.0/150: 40% energy | 1.0/5: 20% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(3)
4:02.227 build E pistol_shot Fluffy_Pillow 42.0/150: 28% energy | 3.0/5: 60% combo_points adrenaline_rush, opportunity, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(3)
4:03.032 finish M dispatch Fluffy_Pillow 48.9/150: 33% energy | 5.0/5: 100% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(3)
4:03.834 Waiting     0.200 sec 40.6/150: 27% energy | 1.0/5: 20% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(3)
4:04.034 build F sinister_strike Fluffy_Pillow 47.2/150: 31% energy | 1.0/5: 20% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(3)
4:04.838 Waiting     0.500 sec 29.0/150: 19% energy | 2.0/5: 40% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(3)
4:05.338 build F sinister_strike Fluffy_Pillow 45.5/150: 30% energy | 2.0/5: 40% combo_points adrenaline_rush, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(3)
4:06.143 Waiting     0.600 sec 34.7/150: 23% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(3)
4:06.743 build F sinister_strike Fluffy_Pillow 47.0/150: 31% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(3)
4:07.749 Waiting     1.108 sec 22.8/150: 15% energy | 4.0/5: 80% combo_points ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(3)
4:08.857 build F sinister_strike Fluffy_Pillow 45.5/150: 30% energy | 4.0/5: 80% combo_points ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(3)
4:09.862 cds I killing_spree Fluffy_Pillow 41.0/150: 27% energy | 5.0/5: 100% combo_points ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_versatility, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(3)
4:12.196 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation_final, elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power
4:13.201 build F sinister_strike Fluffy_Pillow 134.4/150: 90% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection
4:14.205 build E pistol_shot Fluffy_Pillow 118.8/150: 79% energy | 3.0/5: 60% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), quick_navigation, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection
4:15.210 finish L between_the_eyes Fluffy_Pillow 118.4/150: 79% energy | 5.0/5: 100% combo_points ruthless_precision, roll_the_bones, alacrity(5), quick_navigation, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:16.215 cds J vanish Fluffy_Pillow 123.0/150: 82% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:16.215 stealth N ambush Fluffy_Pillow 123.0/150: 82% energy | 1.0/5: 20% combo_points vanish, ruthless_precision, roll_the_bones, alacrity(5), quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:17.219 build F sinister_strike Fluffy_Pillow 102.7/150: 68% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:18.224 finish K roll_the_bones Fluffy_Pillow 87.5/150: 58% energy | 5.0/5: 100% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:19.230 build E pistol_shot Fluffy_Pillow 92.3/150: 62% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:20.234 build F sinister_strike Fluffy_Pillow 92.1/150: 61% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:21.239 finish M dispatch Fluffy_Pillow 66.8/150: 45% energy | 5.0/5: 100% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:22.245 build E pistol_shot Fluffy_Pillow 51.6/150: 34% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:23.250 build F sinister_strike Fluffy_Pillow 61.4/150: 41% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:24.255 finish M dispatch Fluffy_Pillow 36.1/150: 24% energy | 5.0/5: 100% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:25.261 build E pistol_shot Fluffy_Pillow 31.0/150: 21% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:26.266 Waiting     0.300 sec 40.9/150: 27% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:26.566 build F sinister_strike Fluffy_Pillow 46.8/150: 31% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:27.570 Waiting     1.268 sec 21.7/150: 14% energy | 4.0/5: 80% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:28.838 build F sinister_strike Fluffy_Pillow 46.7/150: 31% energy | 4.0/5: 80% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:29.842 finish L between_the_eyes Fluffy_Pillow 41.6/150: 28% energy | 5.0/5: 100% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:30.846 build F sinister_strike Fluffy_Pillow 46.4/150: 31% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:31.851 Waiting     0.200 sec 31.3/150: 21% energy | 2.0/5: 40% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:32.051 build F sinister_strike Fluffy_Pillow 45.3/150: 30% energy | 2.0/5: 40% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:33.057 finish M dispatch Fluffy_Pillow 40.1/150: 27% energy | 4.0/5: 80% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:34.061 build E pistol_shot Fluffy_Pillow 26.5/150: 18% energy | 1.0/5: 20% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(3)
4:35.065 Waiting     0.400 sec 37.5/150: 25% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(23)
4:35.465 build F sinister_strike Fluffy_Pillow 45.9/150: 31% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(23)
4:36.471 Waiting     0.700 sec 31.9/150: 21% energy | 4.0/5: 80% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
4:37.171 build F sinister_strike Fluffy_Pillow 46.5/150: 31% energy | 4.0/5: 80% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
4:38.175 Waiting     0.226 sec 22.4/150: 15% energy | 5.0/5: 100% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
4:38.401 finish M dispatch Fluffy_Pillow 37.1/150: 25% energy | 5.0/5: 100% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
4:39.405 Waiting     0.600 sec 32.8/150: 22% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge(2)
4:40.005 build F sinister_strike Fluffy_Pillow 45.3/150: 30% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(2)
4:41.008 Waiting     0.700 sec 31.1/150: 21% energy | 2.0/5: 40% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(2)
4:41.708 build F sinister_strike Fluffy_Pillow 45.7/150: 30% energy | 2.0/5: 40% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(2)
4:42.711 Waiting     0.700 sec 31.4/150: 21% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(2)
4:43.411 build F sinister_strike Fluffy_Pillow 45.9/150: 31% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(2)
4:44.414 Waiting     0.700 sec 31.6/150: 21% energy | 4.0/5: 80% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(2)
4:45.114 build F sinister_strike Fluffy_Pillow 46.0/150: 31% energy | 4.0/5: 80% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(2)
4:46.120 finish L between_the_eyes Fluffy_Pillow 31.6/150: 21% energy | 5.0/5: 100% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(2)
4:47.123 Waiting     0.600 sec 27.1/150: 18% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(2)
4:47.723 build F sinister_strike Fluffy_Pillow 49.3/150: 33% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(3)
4:48.729 build E pistol_shot Fluffy_Pillow 34.9/150: 23% energy | 3.0/5: 60% combo_points opportunity, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(4)
4:49.735 finish M dispatch Fluffy_Pillow 35.5/150: 24% energy | 5.0/5: 100% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(5)
4:50.737 Waiting     0.784 sec 21.2/150: 14% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(5)
4:51.521 build F sinister_strike Fluffy_Pillow 47.3/150: 32% energy | 1.0/5: 20% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(5)
4:52.525 Waiting     0.900 sec 23.0/150: 15% energy | 2.0/5: 40% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(6)
4:53.425 build F sinister_strike Fluffy_Pillow 51.5/150: 34% energy | 2.0/5: 40% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(6)
4:54.430 Waiting     0.900 sec 27.1/150: 18% energy | 3.0/5: 60% combo_points ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation(4), unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(6)
4:55.330 build F sinister_strike Fluffy_Pillow 45.6/150: 30% energy | 3.0/5: 60% combo_points alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(6)
4:56.333 Waiting     0.700 sec 32.0/150: 21% energy | 4.0/5: 80% combo_points alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(6)
4:57.033 build F sinister_strike Fluffy_Pillow 46.9/150: 31% energy | 4.0/5: 80% combo_points alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:58.038 finish K roll_the_bones Fluffy_Pillow 43.3/150: 29% energy | 5.0/5: 100% combo_points alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:59.042 Waiting     0.300 sec 39.7/150: 26% energy | 1.0/5: 20% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:59.342 build F sinister_strike Fluffy_Pillow 46.0/150: 31% energy | 1.0/5: 20% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)

Stats

Level Bonus (120) Race Bonus (dwarf) Raid-Buffed Unbuffed Gear Amount
Strength 1467 2 1529 1469 0
Agility 1467 -2 6562 6144 4387 (3433)
Stamina 1001 1 9027 8207 7205
Intellect 1467 -1 1678 1466 0
Spirit 0 0 0 0 0
Health 180540 164140 0
Energy 150 150 0
Combo Points 5 5 0
Crit 20.72% 20.72% 772
Haste 17.75% 17.75% 1207
Damage / Heal Versatility 3.56% 3.56% 303
Attack Power 7218 6144 0
Mastery 23.40% 23.40% 720
Armor 1897 1897 1897
Run Speed 9 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Hood of Pestilent Ichor
ilevel: 390, stats: { 260 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Unstable Flames, Resounding Protection, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Usurper's Bloodcaked Spaulders
ilevel: 390, stats: { 240 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Vampiric Speed, Azerite Empowered }
Local Chest Jerkin of the Aberrant Chimera
ilevel: 390, stats: { 320 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Resounding Protection, Azerite Empowered }
Local Waist Replicated Chitin Cord
ilevel: 385, stats: { 174 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Legs Pathogenic Legwraps
ilevel: 385, stats: { 271 Armor, +329 AgiInt, +556 Sta, +154 Haste, +91 Mastery }
Local Feet Quarantine Protocol Treads
ilevel: 385, stats: { 213 Armor, +247 AgiInt, +417 Sta, +104 Haste, +80 Vers }
Local Wrists Wristwraps of Coursing Miasma
ilevel: 385, stats: { 135 Armor, +185 AgiInt, +312 Sta, +83 Crit, +54 Haste }
Local Hands Gloves of Descending Madness
ilevel: 385, stats: { 193 Armor, +247 AgiInt, +417 Sta, +115 Haste, +68 Crit }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Lancet of the Deft Hand
ilevel: 385, weapon: { 400 - 571, 2.6 }, stats: { +164 Agi, +277 Sta, +68 Mastery, +54 Vers }, enchant: versatile_navigation
Local Off Hand Lancet of the Deft Hand
ilevel: 385, weapon: { 400 - 571, 2.6 }, stats: { +164 Agi, +277 Sta, +68 Mastery, +54 Vers }, enchant: quick_navigation

Talents

Level
15 Weaponmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue) Ghostly Strike (Outlaw Rogue)
30 Acrobatic Strikes (Outlaw Rogue) Retractable Hook (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Vigor Deeper Stratagem Marked for Death
60 Iron Stomach (Outlaw Rogue) Cheat Death Elusiveness
75 Dirty Tricks (Outlaw Rogue) Blinding Powder (Outlaw Rogue) Prey on the Weak
90 Loaded Dice (Outlaw Rogue) Alacrity (Outlaw Rogue) Slice and Dice (Outlaw Rogue)
100 Dancing Steel (Outlaw Rogue) Blade Rush (Outlaw Rogue) Killing Spree (Outlaw Rogue)

Profile

rogue="T22_Rogue_Outlaw"
spec=outlaw
level=120
race=dwarf
role=attack
position=back
talents=2310023

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion
actions.precombat+=/marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,precombat_seconds=2
actions.precombat+=/slice_and_dice,precombat_seconds=2
actions.precombat+=/adrenaline_rush,precombat_seconds=1

# Executed every time the actor is available.
# Reroll for 2+ buffs with Loaded Dice up. Otherwise reroll for 2+ or Grand Melee or Ruthless Precision.
actions=variable,name=rtb_reroll,value=rtb_buffs<2&(buff.loaded_dice.up|!buff.grand_melee.up&!buff.ruthless_precision.up)
actions+=/variable,name=ambush_condition,value=combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&cooldown.ghostly_strike.remains<1)+buff.broadside.up&energy>60&!buff.skull_and_crossbones.up
# With multiple targets, this variable is checked to decide whether some CDs should be synced with Blade Flurry
actions+=/variable,name=blade_flurry_sync,value=spell_targets.blade_flurry<2&raid_event.adds.in>20|buff.blade_flurry.up
actions+=/call_action_list,name=stealth,if=stealthed.all
actions+=/call_action_list,name=cds
# Finish at maximum CP. Substract one for each Broadside and Opportunity when Quick Draw is selected and MfD is not ready after the next second.
actions+=/call_action_list,name=finish,if=combo_points>=cp_max_spend-(buff.broadside.up+buff.opportunity.up)*(talent.quick_draw.enabled&(!talent.marked_for_death.enabled|cooldown.marked_for_death.remains>1))
actions+=/call_action_list,name=build
actions+=/arcane_torrent,if=energy.deficit>=15+energy.regen
actions+=/arcane_pulse
actions+=/lights_judgment

actions.build=pistol_shot,if=combo_points.deficit>=1+buff.broadside.up+talent.quick_draw.enabled&buff.opportunity.up
actions.build+=/sinister_strike

actions.cds=potion,if=buff.bloodlust.react|target.time_to_die<=60|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/fireblood
actions.cds+=/ancestral_call
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.time_to_max>1
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15-buff.adrenaline_rush.up*5)&!stealthed.rogue&combo_points.deficit>=cp_max_spend-1)
# Blade Flurry on 2+ enemies. With adds: Use if they stay for 8+ seconds or if your next charge will be ready in time for the next wave.
actions.cds+=/blade_flurry,if=spell_targets>=2&!buff.blade_flurry.up&(!raid_event.adds.exists|raid_event.adds.remains>8|cooldown.blade_flurry.charges=1&raid_event.adds.in>(2-cooldown.blade_flurry.charges_fractional)*25)
actions.cds+=/ghostly_strike,if=variable.blade_flurry_sync&combo_points.deficit>=1+buff.broadside.up
actions.cds+=/killing_spree,if=variable.blade_flurry_sync&(energy.time_to_max>5|energy<15)
actions.cds+=/blade_rush,if=variable.blade_flurry_sync&energy.time_to_max>1
# Using Vanish/Ambush is only a very tiny increase, so in reality, you're absolutely fine to use it as a utility spell.
actions.cds+=/vanish,if=!stealthed.all&variable.ambush_condition
actions.cds+=/shadowmeld,if=!stealthed.all&variable.ambush_condition

actions.finish=slice_and_dice,if=buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions.finish+=/roll_the_bones,if=(buff.roll_the_bones.remains<=3|variable.rtb_reroll)&(target.time_to_die>20|buff.roll_the_bones.remains<target.time_to_die)
# BTE with the Ruthless Precision buff from RtB or with the Ace Up Your Sleeve or Deadshot traits.
actions.finish+=/between_the_eyes,if=buff.ruthless_precision.up|azerite.ace_up_your_sleeve.enabled|azerite.deadshot.enabled
actions.finish+=/dispatch

actions.stealth=ambush

head=hood_of_pestilent_ichor,id=160623,bonus_id=4824/1507/4775,azerite_powers=4/483/459/15/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=usurpers_bloodcaked_spaulders,id=160620,bonus_id=4824/1507/4775,azerite_powers=4/483/30/44/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=jerkin_of_the_aberrant_chimera,id=160619,bonus_id=4824/1507/4775,azerite_powers=4/483/21/15/13
wrists=wristwraps_of_coursing_miasma,id=160621,bonus_id=4800/1507
hands=gloves_of_descending_madness,id=160618,bonus_id=4800/1507
waist=replicated_chitin_cord,id=160717,bonus_id=4800/1507
legs=pathogenic_legwraps,id=160625,bonus_id=4800/1507
feet=quarantine_protocol_treads,id=160624,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=lancet_of_the_deft_hand,id=160693,bonus_id=4800/1507,enchant=versatile_navigation
off_hand=lancet_of_the_deft_hand,id=160693,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=772
# gear_haste_rating=1207
# gear_mastery_rating=720
# gear_versatility_rating=303
# gear_armor=1897

T22_Rogue_Subtlety : 16614 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16613.7 16613.7 10.1 / 0.061% 1738.7 / 10.5% 652.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
25.4 25.2 Energy 19.29% 57.2 100.0% 100%
Talents
  • 15: Find Weakness (Subtlety Rogue)
  • 30: Shadow Focus (Subtlety Rogue)
  • 45: Marked for Death
  • 90: Enveloping Shadows (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Rogue_Subtlety 16614
auto_attack_mh 1768 10.6% 210.1 1.43sec 2522 1781 Direct 210.1 2391 4782 2523 24.5% 18.9%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 210.11 210.11 0.00 0.00 1.4162 0.0000 530009.11 683114.96 22.41 1781.13 1781.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 118.93 56.60% 2390.74 1908 3057 2391.04 2324 2452 284339 366480 22.41
crit 51.38 24.45% 4781.78 3817 6113 4782.35 4526 5039 245670 316635 22.41
miss 39.80 18.94% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
auto_attack_oh 877 5.3% 208.5 1.44sec 1261 883 Direct 208.5 1196 2391 1261 24.5% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 208.46 208.46 0.00 0.00 1.4283 0.0000 262830.29 338806.08 22.42 882.77 882.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 117.74 56.48% 1195.68 954 1528 1195.83 1161 1232 140780 181475 22.42
crit 51.04 24.48% 2391.43 1908 3057 2391.74 2277 2516 122051 157331 22.42
miss 39.68 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Backstab 1548 9.3% 67.4 4.19sec 6889 6858 Direct 67.4 5539 11075 6889 24.4% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.44 67.44 0.00 0.00 1.0045 0.0000 464600.75 608244.33 23.62 6858.39 6858.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.99 75.61% 5538.85 4166 7478 5539.75 5334 5829 282424 369690 23.60
crit 16.45 24.39% 11075.11 8331 14957 11076.76 10140 12305 182176 238555 23.62
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${{$s2=0}*$<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Eviscerate 6403 38.5% 60.9 4.92sec 31509 31367 Direct 60.9 25324 50692 31509 24.4% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.86 60.86 0.00 0.00 1.0045 0.0000 1917714.28 2454228.21 21.86 31367.49 31367.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.03 75.62% 25324.16 11096 37746 25326.85 23529 26959 1165554 1491823 21.87
crit 14.84 24.38% 50691.77 25224 75493 50702.68 42254 59170 752160 962406 21.85
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Frenetic Blow (frentic_blow) 270 1.6% 3.2 77.31sec 24963 0 Direct 3.2 20093 40187 24963 24.2% 0.0%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.24 3.24 0.00 0.00 0.0000 0.0000 80942.73 115717.35 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.46 75.76% 20092.76 20037 20655 19447.37 0 20655 49362 70569 29.09
crit 0.79 24.24% 40186.90 40074 41309 23153.12 0 41309 31580 45148 17.32
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Nightblade 2116 12.7% 19.8 15.07sec 32040 31898 Periodic 184.2 2768 5536 3445 24.5% 0.0% 96.7%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.80 0.00 184.17 184.17 1.0045 1.5747 634441.94 634441.94 0.00 2047.18 31897.53
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.1 75.55% 2768.05 1 3945 2768.23 2672 2851 385140 385140 0.00
crit 45.0 24.45% 5536.25 3 7889 5536.25 5129 5864 249302 249302 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>6&remains<gcd.max&combo_points>=4-(time<10)*2
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Healing effects reduced by {$s7=15}%. Taking {$s6=15}% increased damage from the Rogue.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and reduces the effectiveness of healing on the target by {$s7=15}%. Lasts longer per combo point. 1 point : ${$<damage>*8/6} over 8 sec 2 points: ${$<damage>*10/6} over 10 sec 3 points: ${$<damage>*12/6} over 12 sec 4 points: ${$<damage>*14/6} over 14 sec 5 points: ${$<damage>*16/6} over 16 sec{$?s193531=false}[ 6 points: ${$<damage>*18/6} over 18 sec][] You deal {$s6=15}% increased damage to enemies afflicted by your Nightblade.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.126126
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Shadow Blades 0 (401) 0.0% (2.4%) 2.0 180.03sec 59243 117944

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.5024 0.0000 0.00 0.00 0.00 117944.46 117944.46
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Combo point generating abilities generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow.
  • description:Draws upon surrounding shadows to empower your weapons, causing your combo point generating abilities to generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow for {$d=20 seconds}.
 
    Shadow Blades (_attack) 401 2.4% 22.5 9.60sec 5279 0 Direct 22.5 5279 0 5279 0.0% 0.0%  

Stats details: shadow_blades_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.45 22.45 0.00 0.00 0.0000 0.0000 118534.19 118534.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.45 100.00% 5278.83 2170 11651 5278.27 3997 6948 118534 118534 0.00
 
 

Action details: shadow_blades_attack

Static Values
  • id:279043
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your combo point generating abilities to generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow for {$d=20 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6308.58
  • base_dd_max:6308.58
 
Shadowstrike 3232 19.5% 88.3 3.42sec 10963 10914 Direct 88.3 8818 17639 10963 24.3% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.33 88.33 0.00 0.00 1.0045 0.0000 968449.98 1234220.49 21.53 10914.45 10914.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.85 75.67% 8817.54 6149 13243 8817.37 8514 9049 589420 751221 21.54
crit 21.49 24.33% 17639.10 12298 25694 17640.12 16227 19183 379030 482999 21.53
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stealth.up
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage.$?a231718[ While Stealthed, you strike through the shadows and appear behind your target up to ${5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage.][] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Rogue_Subtlety
Arcane Torrent 3.4 91.07sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.35 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:25046
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy.deficit>=15+energy.regen
Spelldata
  • id:25046
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within $A1 yards and restore $m2 Energy.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Subtlety
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Subtlety
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Subtlety
  • harmful:false
  • if_expr:
 
Marked for Death 9.8 34.27sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=5} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 22.7 13.48sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadow_dance.up&target.time_to_die<=5+talent.subterfuge.enabled
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=5 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=20}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Symbols of Death 10.3 30.28sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.nightblade.ticking
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=15}%.
  • description:Invoke ancient symbols of power, generating {$s5=40} Energy and increasing your damage done by {$s1=15}% for {$d=10 seconds}.
 
Vanish 2.3 129.48sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!variable.shd_threshold&debuff.find_weakness.remains<1
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:36.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=6}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Agility 2.0 0.0 199.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.6 0.2 75.2sec 65.7sec 8.98% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:8.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.4sec 65.4sec 9.02% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.7 0.2 74.5sec 65.4sec 9.07% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:9.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 75.2sec 65.9sec 8.90% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:8.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 4.8 11.2 65.7sec 18.4sec 75.43% 0.00% 0.0(0.0) 0.8

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:28.30%
  • frothing_rage_2:25.05%
  • frothing_rage_3:22.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Master of Shadows 24.9 0.1 12.3sec 12.2sec 24.88% 0.00% 149.1(149.1) 24.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_master_of_shadows
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • master_of_shadows_1:24.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196980
  • name:Master of Shadows
  • tooltip:Regenerating ${{$s1=4}*{$d=3 seconds}/$t1+{$s2=1}} Energy over {$d=3 seconds}.
  • description:{$@spelldesc196976=Gain ${{$196980s1=4}*{$196980d=3 seconds}/$196980t1+{$196980s2=1}} Energy over {$196980d=3 seconds} when you enter Stealth or activate Shadow Dance.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Masterful Navigation 6.2 23.1 52.1sec 10.4sec 68.89% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_masterful_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:50.00

Stack Uptimes

  • masterful_navigation_1:17.96%
  • masterful_navigation_2:17.49%
  • masterful_navigation_3:16.94%
  • masterful_navigation_4:16.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268899
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Masterful Navigation (_final) 5.5 0.0 52.3sec 52.3sec 18.08% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_masterful_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:600.00

Stack Uptimes

  • masterful_navigation_final_1:18.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268898
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.7 0.0 61.5sec 38.8sec 36.31% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.42%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.43%
  • overwhelming_power_4:1.43%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.45%
  • overwhelming_power_7:1.45%
  • overwhelming_power_8:1.45%
  • overwhelming_power_9:1.46%
  • overwhelming_power_10:1.46%
  • overwhelming_power_11:1.47%
  • overwhelming_power_12:1.47%
  • overwhelming_power_13:1.48%
  • overwhelming_power_14:1.48%
  • overwhelming_power_15:1.49%
  • overwhelming_power_16:1.49%
  • overwhelming_power_17:1.50%
  • overwhelming_power_18:1.50%
  • overwhelming_power_19:1.51%
  • overwhelming_power_20:1.51%
  • overwhelming_power_21:1.52%
  • overwhelming_power_22:1.52%
  • overwhelming_power_23:1.53%
  • overwhelming_power_24:1.55%
  • overwhelming_power_25:0.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.1sec 10.4sec 68.84% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.07%
  • quick_navigation_2:17.46%
  • quick_navigation_3:16.80%
  • quick_navigation_4:16.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.10% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades 2.0 0.0 179.7sec 180.3sec 13.18% 14.60% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shadow_blades_1:13.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Combo point generating abilities generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow.
  • description:Draws upon surrounding shadows to empower your weapons, causing your combo point generating abilities to generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Shadow Dance 22.7 0.0 13.5sec 13.5sec 37.56% 41.46% 0.0(0.0) 22.1

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shadow_dance_1:37.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=5 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=20}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:5.00
  • cooldown:1.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 1.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=20}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Symbols of Death 10.3 0.0 30.3sec 30.3sec 33.89% 36.72% 0.0(0.0) 10.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • symbols_of_death_1:33.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=15}%.
  • description:Invoke ancient symbols of power, generating {$s5=40} Energy and increasing your damage done by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Titanic Overcharge 12.3 33.3 25.0sec 6.6sec 85.10% 0.00% 3.7(3.7) 11.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:40.51

Stack Uptimes

  • titanic_overcharge_1:23.08%
  • titanic_overcharge_2:16.80%
  • titanic_overcharge_3:12.20%
  • titanic_overcharge_4:8.91%
  • titanic_overcharge_5:6.52%
  • titanic_overcharge_6:4.74%
  • titanic_overcharge_7:3.48%
  • titanic_overcharge_8:9.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=36} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 26.0 27.6 11.7sec 5.6sec 66.79% 0.00% 2.0(2.0) 25.3

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:32.35%
  • unstable_flames_2:16.68%
  • unstable_flames_3:8.64%
  • unstable_flames_4:4.39%
  • unstable_flames_5:4.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 2.3 0.0 129.7sec 129.7sec 0.01% 2.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vanish_1:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
T22_Rogue_Subtlety
backstab Energy 67.4 2360.4 35.0 35.0 196.8
eviscerate Energy 60.9 1960.2 32.2 32.2 978.3
eviscerate Combo Points 60.9 284.2 4.7 4.7 6746.8
nightblade Energy 19.8 480.2 24.3 24.3 1321.2
nightblade Combo Points 19.8 90.9 4.6 4.6 6981.9
shadowstrike Energy 88.3 2826.7 32.0 32.0 342.6
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 9.80 48.82 (12.93%) 4.98 0.17 0.34%
arcane_torrent Energy 3.35 50.27 (0.67%) 15.00 0.00 0.00%
backstab Combo Points 67.44 67.44 (17.87%) 1.00 0.00 0.00%
symbols_of_death Energy 10.29 364.35 (4.82%) 35.42 47.12 11.45%
shadowstrike Combo Points 88.33 174.67 (46.28%) 1.98 2.00 1.13%
energy_regen Energy 1129.36 3695.60 (48.88%) 3.27 50.01 1.34%
Shadow Techniques Energy 74.98 598.82 (7.92%) 7.99 1.04 0.17%
Shadow Techniques Combo Points 74.98 70.01 (18.55%) 0.93 4.98 6.64%
Master of Shadows Energy 173.93 600.24 (7.94%) 3.45 20.50 3.30%
Shadow Blades Combo Points 22.45 16.49 (4.37%) 0.73 5.96 26.55%
Relentless Strikes Energy 80.66 2250.55 (29.77%) 27.90 0.11 0.00%
Resource RPS-Gain RPS-Loss
Energy 25.20 25.42
Combo Points 1.26 1.25
Combat End Resource Mean Min Max
Energy 32.03 0.01 100.00
Combo Points 2.34 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.6%

Statistics & Data Analysis

Fight Length
Sample Data T22_Rogue_Subtlety Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Rogue_Subtlety Damage Per Second
Count 7499
Mean 16613.68
Minimum 15153.51
Maximum 18485.12
Spread ( max - min ) 3331.62
Range [ ( max - min ) / 2 * 100% ] 10.03%
Standard Deviation 444.5600
5th Percentile 15907.48
95th Percentile 17365.30
( 95th Percentile - 5th Percentile ) 1457.82
Mean Distribution
Standard Deviation 5.1337
95.00% Confidence Intervall ( 16603.62 - 16623.74 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2751
0.1 Scale Factor Error with Delta=300 1688
0.05 Scale Factor Error with Delta=300 6749
0.01 Scale Factor Error with Delta=300 168712
Priority Target DPS
Sample Data T22_Rogue_Subtlety Priority Target Damage Per Second
Count 7499
Mean 16613.68
Minimum 15153.51
Maximum 18485.12
Spread ( max - min ) 3331.62
Range [ ( max - min ) / 2 * 100% ] 10.03%
Standard Deviation 444.5600
5th Percentile 15907.48
95th Percentile 17365.30
( 95th Percentile - 5th Percentile ) 1457.82
Mean Distribution
Standard Deviation 5.1337
95.00% Confidence Intervall ( 16603.62 - 16623.74 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2751
0.1 Scale Factor Error with Delta=300 1688
0.05 Scale Factor Error with Delta=300 6749
0.01 Scale Factor Error with Delta=300 168712
DPS(e)
Sample Data T22_Rogue_Subtlety Damage Per Second (Effective)
Count 7499
Mean 16613.68
Minimum 15153.51
Maximum 18485.12
Spread ( max - min ) 3331.62
Range [ ( max - min ) / 2 * 100% ] 10.03%
Damage
Sample Data T22_Rogue_Subtlety Damage
Count 7499
Mean 4977523.27
Minimum 3815483.38
Maximum 6290982.93
Spread ( max - min ) 2475499.55
Range [ ( max - min ) / 2 * 100% ] 24.87%
DTPS
Sample Data T22_Rogue_Subtlety Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Rogue_Subtlety Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Rogue_Subtlety Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Rogue_Subtlety Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Rogue_Subtlety Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Rogue_Subtlety Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Rogue_SubtletyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Rogue_Subtlety Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=stealth_threshold,value=60+talent.vigor.enabled*35+talent.master_of_shadows.enabled*10
Used to define when to use stealth CDs or builders
5 0.00 stealth
6 0.00 marked_for_death,precombat_seconds=15
7 0.00 shadow_blades,precombat_seconds=1
8 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
9 0.00 call_action_list,name=cds
Check CDs at first
A 0.00 run_action_list,name=stealthed,if=stealthed.all
Run fully switches to the Stealthed Rotation (by doing so, it forces pooling if nothing is available).
B 6.65 nightblade,if=target.time_to_die>6&remains<gcd.max&combo_points>=4-(time<10)*2
Apply Nightblade at 2+ CP during the first 10 seconds, after that 4+ CP if it expires within the next GCD or is not up
C 0.00 call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&combo_points.deficit>=4
Consider using a Stealth CD when reaching the energy threshold and having space for at least 4 CP
D 0.00 call_action_list,name=finish,if=combo_points>=4+talent.deeper_stratagem.enabled|target.time_to_die<=1&combo_points>=3
Finish at 4+ without DS, 5+ with DS (outside stealth)
E 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold-40*!(talent.alacrity.enabled|talent.shadow_focus.enabled|talent.master_of_shadows.enabled)
Use a builder when reaching the energy threshold (minus 40 if none of Alacrity, Shadow Focus, and Master of Shadows is selected)
F 3.35 arcane_torrent,if=energy.deficit>=15+energy.regen
Lowest priority in all of the APL because it causes a GCD
0.00 arcane_pulse
0.00 lights_judgment
actions.build
# count action,conditions
0.00 shuriken_toss,if=buff.sharpened_blades.stack>=29&spell_targets.shuriken_storm<=1+3*azerite.sharpened_blades.rank=2+4*azerite.sharpened_blades.rank=3
Shuriken Toss at 29+ Sharpened Blades stacks. 1T at Rank 1, up to 4 at Rank 2, up to 5 at Rank 3
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2|buff.the_dreadlords_deceit.stack>=29
0.00 gloomblade
G 67.44 backstab
actions.cds
# count action,conditions
H 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=60|(buff.vanish.up&(buff.shadow_blades.up|cooldown.shadow_blades.remains<=30))
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 fireblood,if=stealthed.rogue
0.00 ancestral_call,if=stealthed.rogue
I 10.29 symbols_of_death,if=dot.nightblade.ticking
J 0.26 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit
K 8.54 marked_for_death,if=raid_event.adds.in>30&!stealthed.all&combo_points.deficit>=cp_max_spend
L 1.00 shadow_blades,if=combo_points.deficit>=2+stealthed.all
0.00 shuriken_tornado,if=spell_targets>=3&dot.nightblade.ticking&buff.symbols_of_death.up&buff.shadow_dance.up
M 0.63 shadow_dance,if=!buff.shadow_dance.up&target.time_to_die<=5+talent.subterfuge.enabled
actions.finish
# count action,conditions
N 8.05 nightblade,if=(!talent.dark_shadow.enabled|!buff.shadow_dance.up)&target.time_to_die-remains>6&remains<tick_time*2&(spell_targets.shuriken_storm<4|!buff.symbols_of_death.up)
Keep up Nightblade if it is about to run out. Do not use NB during Dance, if talented into Dark Shadow.
0.00 nightblade,cycle_targets=1,if=spell_targets.shuriken_storm>=2&(spell_targets.shuriken_storm<=5|talent.secret_technique.enabled)&!buff.shadow_dance.up&target.time_to_die>=(5+(2*combo_points))&refreshable
Multidotting outside Dance on targets that will live for the duration of Nightblade with refresh during pandemic if you have less than 6 targets or play with Secret Technique.
O 5.10 nightblade,if=remains<cooldown.symbols_of_death.remains+10&cooldown.symbols_of_death.remains<=5&target.time_to_die-remains>cooldown.symbols_of_death.remains+5
Refresh Nightblade early if it will expire during Symbols. Do that refresh if SoD gets ready in the next 5s.
0.00 secret_technique,if=buff.symbols_of_death.up&(!talent.dark_shadow.enabled|spell_targets.shuriken_storm<2|buff.shadow_dance.up)
Secret Technique during Symbols. With Dark Shadow and multiple targets also only during Shadow Dance (until threshold in next line).
0.00 secret_technique,if=spell_targets.shuriken_storm>=2+talent.dark_shadow.enabled+talent.nightstalker.enabled
With enough targets always use SecTec on CD.
P 60.86 eviscerate
actions.stealth_cds
# count action,conditions
0.00 variable,name=shd_threshold,value=cooldown.shadow_dance.charges_fractional>=1.75
Helper Variable
Q 2.29 vanish,if=!variable.shd_threshold&debuff.find_weakness.remains<1
Vanish unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
0.00 pool_resource,for_next=1,extra_amount=40
Pool for Shadowmeld + Shadowstrike unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
0.00 shadowmeld,if=energy>=40&energy.deficit>=10&!variable.shd_threshold&debuff.find_weakness.remains<1
R 21.73 shadow_dance,if=(!talent.dark_shadow.enabled|dot.nightblade.remains>=5+talent.subterfuge.enabled)&(variable.shd_threshold|buff.symbols_of_death.remains>=1.2|spell_targets>=4&cooldown.symbols_of_death.remains>10)
With Dark Shadow only Dance when Nightblade will stay up. Use during Symbols or above threshold.
S 0.35 shadow_dance,if=target.time_to_die<cooldown.symbols_of_death.remains
actions.stealthed
# count action,conditions
T 1.00 shadowstrike,if=buff.stealth.up
If stealth is up, we really want to use Shadowstrike to benefits from the passive bonus, even if we are at max cp (from the precombat MfD).
U 0.00 call_action_list,name=finish,if=combo_points.deficit<=1-(talent.deeper_stratagem.enabled&buff.vanish.up)
Finish at 4+ CP without DS, 5+ with DS, and 6 with DS after Vanish
0.00 shadowstrike,cycle_targets=1,if=talent.secret_technique.enabled&talent.find_weakness.enabled&debuff.find_weakness.remains<1&spell_targets.shuriken_storm=2&target.time_to_die-remains>6
At 2 targets with Secret Technique keep up Find Weakness by cycling Shadowstrike.
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=3
V 87.33 shadowstrike

Sample Sequence

01245678TBIRVPVPVPRVVPVVPRVNVVPKPGGGPRVVPVVNGGIGPRVVPVVPRVVPVVNGGFGPKPGGGNQVGIPRVVPVVPRVVPVVNGGGPGGOKPGGIGPRVVPVVPGGGBGGPGRVOVVIPKPRVVPVVPRVVPVVBGFGGPGGGNGIGGPKPRVVPVVNGGGPGGLGBQHVIPRVVPVVPRVPVPVGBKPGGPGGPRVVOVVIPRVVPVVPRVVPVVPGFGGBKPGGPGGIGNRVVPVVPGGGNGGPKPGGORVVIPVVPRVVPVVPSVVNVVPGGGJP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Rogue_Subtlety 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation T22_Rogue_Subtlety 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food T22_Rogue_Subtlety 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 5 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 6 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth
Pre precombat 7 shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth, shadow_blades
Pre precombat 8 potion Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth, shadow_blades, battle_potion_of_agility
0:00.000 stealthed T shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth, shadow_blades, archive_of_the_titans, resounding_protection, battle_potion_of_agility
0:01.004 default B nightblade Fluffy_Pillow 80.9/100: 81% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, frothing_rage, quick_navigation, masterful_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans, resounding_protection, overwhelming_power(24), titanic_overcharge(2), battle_potion_of_agility
0:02.007 cds I symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% combo_points bloodlust, shadow_blades, frothing_rage, quick_navigation, masterful_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans, resounding_protection, overwhelming_power(23), titanic_overcharge(3), battle_potion_of_agility
0:02.007 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% combo_points bloodlust, shadow_blades, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans, resounding_protection, overwhelming_power(23), titanic_overcharge(3), battle_potion_of_agility
0:02.007 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans, resounding_protection, overwhelming_power(23), titanic_overcharge(3), battle_potion_of_agility
0:03.012 finish P eviscerate Fluffy_Pillow 92.8/100: 93% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans, resounding_protection, overwhelming_power(22), titanic_overcharge(3), battle_potion_of_agility
0:04.015 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/5: 20% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans, resounding_protection, overwhelming_power(21), titanic_overcharge(3), battle_potion_of_agility
0:05.020 finish P eviscerate Fluffy_Pillow 92.8/100: 93% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_haste, archive_of_the_titans(2), resounding_protection, overwhelming_power(20), titanic_overcharge(3), battle_potion_of_agility
0:06.025 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_haste, archive_of_the_titans(2), resounding_protection, overwhelming_power(19), titanic_overcharge(3), battle_potion_of_agility
0:07.029 finish P eviscerate Fluffy_Pillow 92.7/100: 93% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_haste, archive_of_the_titans(2), resounding_protection, overwhelming_power(18), titanic_overcharge(3), battle_potion_of_agility
0:08.034 stealth_cds R shadow_dance Fluffy_Pillow 98.3/100: 98% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_haste, archive_of_the_titans(2), resounding_protection, overwhelming_power(17), titanic_overcharge(3), battle_potion_of_agility
0:08.034 stealthed V shadowstrike Fluffy_Pillow 99.3/100: 99% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_haste, archive_of_the_titans(2), resounding_protection, overwhelming_power(17), titanic_overcharge(3), battle_potion_of_agility
0:09.039 stealthed V shadowstrike Fluffy_Pillow 91.9/100: 92% energy | 3.0/5: 60% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_haste, unstable_flames, archive_of_the_titans(2), resounding_protection, overwhelming_power(16), titanic_overcharge(3), battle_potion_of_agility
0:10.044 finish P eviscerate Fluffy_Pillow 92.4/100: 92% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(2), masterful_navigation(3), unstable_flames, archive_of_the_titans(3), resounding_protection, overwhelming_power(15), titanic_overcharge(3), battle_potion_of_agility
0:11.050 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(3), unstable_flames, archive_of_the_titans(3), resounding_protection, overwhelming_power(14), battle_potion_of_agility
0:12.053 stealthed V shadowstrike Fluffy_Pillow 83.7/100: 84% energy | 3.0/5: 60% combo_points bloodlust, shadow_blades, shadow_dance, frothing_rage, quick_navigation(2), masterful_navigation(3), unstable_flames, archive_of_the_titans(3), resounding_protection, overwhelming_power(13), titanic_overcharge, battle_potion_of_agility
0:13.058 finish P eviscerate Fluffy_Pillow 75.5/100: 76% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(3), resounding_protection, overwhelming_power(12), titanic_overcharge, battle_potion_of_agility
0:14.062 stealth_cds R shadow_dance Fluffy_Pillow 86.3/100: 86% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(3), resounding_protection, overwhelming_power(10), titanic_overcharge(2), battle_potion_of_agility
0:14.062 stealthed V shadowstrike Fluffy_Pillow 87.3/100: 87% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(3), resounding_protection, overwhelming_power(10), titanic_overcharge(2), battle_potion_of_agility
0:15.066 finish N nightblade Fluffy_Pillow 87.0/100: 87% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(4), resounding_protection, overwhelming_power(9), titanic_overcharge(3), battle_potion_of_agility
0:16.071 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(4), resounding_protection, overwhelming_power(8), titanic_overcharge(4), battle_potion_of_agility
0:17.075 stealthed V shadowstrike Fluffy_Pillow 91.8/100: 92% energy | 3.0/5: 60% combo_points bloodlust, shadow_blades, shadow_dance, frothing_rage, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(4), resounding_protection, overwhelming_power(7), titanic_overcharge(4), battle_potion_of_agility
0:18.080 finish P eviscerate Fluffy_Pillow 83.6/100: 84% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, shadow_dance, frothing_rage, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(4), resounding_protection, overwhelming_power(6), titanic_overcharge(4), battle_potion_of_agility
0:19.084 cds K marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, frothing_rage, quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(4), resounding_protection, overwhelming_power(5), titanic_overcharge(5), battle_potion_of_agility
0:19.084 finish P eviscerate Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage, quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(4), resounding_protection, overwhelming_power(5), titanic_overcharge(5), battle_potion_of_agility
0:20.087 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, frothing_rage, quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(5), resounding_protection, overwhelming_power(4), titanic_overcharge(5), battle_potion_of_agility
0:21.090 build G backstab Fluffy_Pillow 88.7/100: 89% energy | 2.0/5: 40% combo_points bloodlust, frothing_rage, quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(3), titanic_overcharge(5), battle_potion_of_agility
0:22.095 build G backstab Fluffy_Pillow 69.4/100: 69% energy | 3.0/5: 60% combo_points bloodlust, frothing_rage, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(2), titanic_overcharge(5), battle_potion_of_agility
0:23.100 finish P eviscerate Fluffy_Pillow 50.1/100: 50% energy | 4.0/5: 80% combo_points bloodlust, frothing_rage, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power, titanic_overcharge(5)
0:24.104 stealth_cds R shadow_dance Fluffy_Pillow 54.7/100: 55% energy | 0.0/5: 0% combo_points bloodlust, frothing_rage, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge(5)
0:24.104 stealthed V shadowstrike Fluffy_Pillow 55.7/100: 56% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge(5)
0:25.109 stealthed V shadowstrike Fluffy_Pillow 55.4/100: 55% energy | 3.0/5: 60% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(6), resounding_protection, titanic_overcharge(6)
0:26.113 finish P eviscerate Fluffy_Pillow 47.0/100: 47% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(6), resounding_protection, titanic_overcharge(6)
0:27.118 stealthed V shadowstrike Fluffy_Pillow 72.7/100: 73% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, frothing_rage, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(6), resounding_protection, titanic_overcharge(6)
0:28.123 stealthed V shadowstrike Fluffy_Pillow 64.4/100: 64% energy | 3.0/5: 60% combo_points bloodlust, shadow_dance, frothing_rage, quick_navigation(4), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(6), resounding_protection, titanic_overcharge(6)
0:29.126 finish N nightblade Fluffy_Pillow 48.0/100: 48% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage, quick_navigation(4), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(6), resounding_protection, titanic_overcharge(6)
0:30.130 build G backstab Fluffy_Pillow 76.7/100: 77% energy | 1.0/5: 20% combo_points bloodlust, frothing_rage(2), quick_navigation(4), masterful_navigation_final, archive_of_the_titans(7), resounding_protection, titanic_overcharge(6)
0:31.134 build G backstab Fluffy_Pillow 57.4/100: 57% energy | 2.0/5: 40% combo_points bloodlust, frothing_rage(2), quick_navigation(4), masterful_navigation_final, elemental_whirl_mastery, archive_of_the_titans(7), resounding_protection, titanic_overcharge(6)
0:32.137 cds I symbols_of_death Fluffy_Pillow 38.0/100: 38% energy | 3.0/5: 60% combo_points bloodlust, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(7), resounding_protection, titanic_overcharge(6)
0:32.137 build G backstab Fluffy_Pillow 78.0/100: 78% energy | 3.0/5: 60% combo_points bloodlust, symbols_of_death, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(7), resounding_protection, titanic_overcharge(6)
0:33.142 finish P eviscerate Fluffy_Pillow 66.7/100: 67% energy | 5.0/5: 100% combo_points bloodlust, symbols_of_death, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(7), resounding_protection, titanic_overcharge(6)
0:34.146 stealth_cds R shadow_dance Fluffy_Pillow 77.4/100: 77% energy | 0.0/5: 0% combo_points bloodlust, symbols_of_death, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(7), resounding_protection, titanic_overcharge(7)
0:34.146 stealthed V shadowstrike Fluffy_Pillow 78.4/100: 78% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(7), resounding_protection, titanic_overcharge(7)
0:35.151 stealthed V shadowstrike Fluffy_Pillow 70.2/100: 70% energy | 2.0/5: 40% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(8), resounding_protection, titanic_overcharge(7)
0:36.154 finish P eviscerate Fluffy_Pillow 69.9/100: 70% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(8), resounding_protection, titanic_overcharge(7)
0:37.159 stealthed V shadowstrike Fluffy_Pillow 95.7/100: 96% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(8), resounding_protection, titanic_overcharge(7)
0:38.163 stealthed V shadowstrike Fluffy_Pillow 79.4/100: 79% energy | 2.0/5: 40% combo_points bloodlust, shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(8), resounding_protection, titanic_overcharge(7)
0:39.166 finish P eviscerate Fluffy_Pillow 63.1/100: 63% energy | 4.0/5: 80% combo_points bloodlust, symbols_of_death, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(8), resounding_protection, titanic_overcharge(7)
0:40.170 stealth_cds R shadow_dance Fluffy_Pillow 67.9/100: 68% energy | 0.0/5: 0% combo_points bloodlust, symbols_of_death, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(9), resounding_protection, titanic_overcharge(7)
0:40.170 stealthed V shadowstrike Fluffy_Pillow 68.9/100: 69% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(4), elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(9), resounding_protection, titanic_overcharge(7)
0:41.175 stealthed V shadowstrike Fluffy_Pillow 68.0/100: 68% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(4), unstable_flames(3), archive_of_the_titans(9), resounding_protection, titanic_overcharge(7)
0:42.178 finish P eviscerate Fluffy_Pillow 56.1/100: 56% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation(4), masterful_navigation, archive_of_the_titans(9), resounding_protection, titanic_overcharge(7)
0:43.183 stealthed V shadowstrike Fluffy_Pillow 78.8/100: 79% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage(2), quick_navigation_final, masterful_navigation, archive_of_the_titans(9), resounding_protection
0:44.188 stealthed V shadowstrike Fluffy_Pillow 59.1/100: 59% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage(2), quick_navigation_final, masterful_navigation, archive_of_the_titans(9), resounding_protection
0:45.193 finish N nightblade Fluffy_Pillow 39.4/100: 39% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation, unstable_flames, archive_of_the_titans(10), resounding_protection
0:46.198 build G backstab Fluffy_Pillow 58.7/100: 59% energy | 1.0/5: 20% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation, unstable_flames(2), archive_of_the_titans(10), resounding_protection
0:47.203 build G backstab Fluffy_Pillow 36.0/100: 36% energy | 2.0/5: 40% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation, unstable_flames(2), archive_of_the_titans(10), resounding_protection
0:48.208 default F arcane_torrent Fluffy_Pillow 13.3/100: 13% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation, unstable_flames(3), archive_of_the_titans(10), resounding_protection
0:49.214 build G backstab Fluffy_Pillow 40.6/100: 41% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation, unstable_flames(3), archive_of_the_titans(10), resounding_protection
0:50.218 Waiting     0.783 sec 17.9/100: 18% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation, unstable_flames(3), archive_of_the_titans(11), resounding_protection
0:51.001 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation_final, masterful_navigation, unstable_flames(3), archive_of_the_titans(11), resounding_protection
0:52.008 cds K marked_for_death Fluffy_Pillow 42.8/100: 43% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation_final, masterful_navigation, unstable_flames(3), archive_of_the_titans(11), resounding_protection
0:52.008 finish P eviscerate Fluffy_Pillow 42.8/100: 43% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation_final, masterful_navigation, unstable_flames(3), archive_of_the_titans(11), resounding_protection
0:53.012 build G backstab Fluffy_Pillow 49.3/100: 49% energy | 0.0/5: 0% combo_points frothing_rage(3), masterful_navigation(2), unstable_flames(4), archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:54.017 Waiting     0.200 sec 33.8/100: 34% energy | 2.0/5: 40% combo_points frothing_rage(3), masterful_navigation(2), unstable_flames(4), archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:54.217 build G backstab Fluffy_Pillow 36.1/100: 36% energy | 2.0/5: 40% combo_points frothing_rage(3), masterful_navigation(2), unstable_flames(4), archive_of_the_titans(11), resounding_protection, titanic_overcharge
0:55.223 Waiting     1.991 sec 12.5/100: 13% energy | 3.0/5: 60% combo_points frothing_rage(3), masterful_navigation(2), unstable_flames(5), archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:57.214 build G backstab Fluffy_Pillow 35.4/100: 35% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:58.218 Waiting     0.544 sec 19.9/100: 20% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:58.762 finish N nightblade Fluffy_Pillow 26.1/100: 26% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:59.768 stealth_cds Q vanish Fluffy_Pillow 42.7/100: 43% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:59.768 stealthed V shadowstrike Fluffy_Pillow 43.7/100: 44% energy | 0.0/5: 0% combo_points vanish, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(12), resounding_protection, titanic_overcharge
1:00.771 Waiting     0.400 sec 31.2/100: 31% energy | 2.0/5: 40% combo_points master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:01.171 build G backstab Fluffy_Pillow 35.8/100: 36% energy | 2.0/5: 40% combo_points master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:02.175 cds I symbols_of_death Fluffy_Pillow 28.3/100: 28% energy | 4.0/5: 80% combo_points master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(13), resounding_protection, titanic_overcharge(2)
1:02.175 finish P eviscerate Fluffy_Pillow 68.3/100: 68% energy | 4.0/5: 80% combo_points symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(13), resounding_protection, titanic_overcharge(2)
1:03.179 stealth_cds R shadow_dance Fluffy_Pillow 76.9/100: 77% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(13), resounding_protection, titanic_overcharge(2)
1:03.179 stealthed V shadowstrike Fluffy_Pillow 77.9/100: 78% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(13), resounding_protection, titanic_overcharge(2)
1:04.183 stealthed V shadowstrike Fluffy_Pillow 65.5/100: 66% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge(2)
1:05.187 finish P eviscerate Fluffy_Pillow 53.1/100: 53% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(2), archive_of_the_titans(14), resounding_protection, titanic_overcharge(2)
1:06.193 stealthed V shadowstrike Fluffy_Pillow 68.7/100: 69% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage(3), quick_navigation, masterful_navigation(2), archive_of_the_titans(14), resounding_protection, titanic_overcharge(2)
1:07.200 stealthed V shadowstrike Fluffy_Pillow 56.3/100: 56% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage(3), quick_navigation, masterful_navigation(3), archive_of_the_titans(14), resounding_protection, titanic_overcharge(2)
1:08.203 finish P eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(3), quick_navigation, masterful_navigation(3), archive_of_the_titans(14), resounding_protection, titanic_overcharge(2)
1:09.208 stealth_cds R shadow_dance Fluffy_Pillow 42.5/100: 43% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(3), quick_navigation, masterful_navigation(3), archive_of_the_titans(14), resounding_protection, titanic_overcharge(2)
1:09.208 stealthed V shadowstrike Fluffy_Pillow 43.5/100: 44% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(3), archive_of_the_titans(14), resounding_protection, titanic_overcharge(2)
1:10.212 Waiting     0.100 sec 31.1/100: 31% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(15), resounding_protection, titanic_overcharge(2)
1:10.312 stealthed V shadowstrike Fluffy_Pillow 32.3/100: 32% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(15), resounding_protection, titanic_overcharge(2)
1:11.315 Waiting     0.100 sec 27.8/100: 28% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(15), resounding_protection, titanic_overcharge(2)
1:11.415 finish P eviscerate Fluffy_Pillow 29.0/100: 29% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(15), resounding_protection, titanic_overcharge(2)
1:12.419 stealthed V shadowstrike Fluffy_Pillow 50.5/100: 51% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage(3), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(15), resounding_protection
1:13.422 Waiting     0.200 sec 30.0/100: 30% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage(3), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(15), resounding_protection
1:13.622 stealthed V shadowstrike Fluffy_Pillow 32.3/100: 32% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage(3), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(15), resounding_protection
1:14.625 Waiting     1.149 sec 11.8/100: 12% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation, masterful_navigation(4), archive_of_the_titans(15), resounding_protection, titanic_overcharge
1:15.774 finish N nightblade Fluffy_Pillow 33.0/100: 33% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation, masterful_navigation(4), archive_of_the_titans(16), resounding_protection, titanic_overcharge(2)
1:16.777 build G backstab Fluffy_Pillow 49.6/100: 50% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation, masterful_navigation(4), archive_of_the_titans(16), resounding_protection, titanic_overcharge(2)
1:17.781 Waiting     0.800 sec 26.2/100: 26% energy | 1.0/5: 20% combo_points frothing_rage(3), quick_navigation, masterful_navigation(4), archive_of_the_titans(16), resounding_protection, titanic_overcharge(2)
1:18.581 build G backstab Fluffy_Pillow 43.4/100: 43% energy | 2.0/5: 40% combo_points frothing_rage(3), quick_navigation, masterful_navigation(4), archive_of_the_titans(16), resounding_protection, titanic_overcharge(2)
1:19.586 Waiting     1.327 sec 20.0/100: 20% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation(2), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(16), resounding_protection, titanic_overcharge(2)
1:20.913 build G backstab Fluffy_Pillow 35.5/100: 35% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(17), resounding_protection, titanic_overcharge(2)
1:21.919 Waiting     1.993 sec 12.2/100: 12% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(17), resounding_protection, titanic_overcharge(2)
1:23.912 finish P eviscerate Fluffy_Pillow 35.5/100: 36% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(17), resounding_protection, titanic_overcharge(2)
1:24.916 build G backstab Fluffy_Pillow 44.3/100: 44% energy | 1.0/5: 20% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(17), resounding_protection, titanic_overcharge(2)
1:25.921 Waiting     0.954 sec 21.8/100: 22% energy | 2.0/5: 40% combo_points quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(18), resounding_protection, overwhelming_power(24)
1:26.875 build G backstab Fluffy_Pillow 41.7/100: 42% energy | 3.0/5: 60% combo_points quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(18), resounding_protection, overwhelming_power(23)
1:27.878 Waiting     0.576 sec 19.1/100: 19% energy | 4.0/5: 80% combo_points quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(18), resounding_protection, overwhelming_power(22)
1:28.454 finish O nightblade Fluffy_Pillow 26.2/100: 26% energy | 4.0/5: 80% combo_points quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(18), resounding_protection, overwhelming_power(21)
1:29.458 cds K marked_for_death Fluffy_Pillow 37.6/100: 38% energy | 0.0/5: 0% combo_points quick_navigation(4), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(18), resounding_protection, overwhelming_power(20)
1:29.458 finish P eviscerate Fluffy_Pillow 37.6/100: 38% energy | 5.0/5: 100% combo_points quick_navigation(4), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(18), resounding_protection, overwhelming_power(20)
1:30.463 build G backstab Fluffy_Pillow 45.1/100: 45% energy | 0.0/5: 0% combo_points quick_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection, overwhelming_power(19)
1:31.466 Waiting     0.400 sec 30.4/100: 30% energy | 2.0/5: 40% combo_points quick_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection, overwhelming_power(18)
1:31.866 build G backstab Fluffy_Pillow 35.3/100: 35% energy | 2.0/5: 40% combo_points quick_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection, overwhelming_power(18)
1:32.872 cds I symbols_of_death Fluffy_Pillow 12.7/100: 13% energy | 3.0/5: 60% combo_points quick_navigation(4), archive_of_the_titans(19), resounding_protection, overwhelming_power(17)
1:32.872 build G backstab Fluffy_Pillow 52.7/100: 53% energy | 3.0/5: 60% combo_points symbols_of_death, quick_navigation(4), archive_of_the_titans(19), resounding_protection, overwhelming_power(17)
1:33.878 Waiting     0.500 sec 30.1/100: 30% energy | 4.0/5: 80% combo_points symbols_of_death, quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(19), resounding_protection, overwhelming_power(16), titanic_overcharge
1:34.378 finish P eviscerate Fluffy_Pillow 36.2/100: 36% energy | 4.0/5: 80% combo_points symbols_of_death, quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(19), resounding_protection, overwhelming_power(15), titanic_overcharge
1:35.382 stealth_cds R shadow_dance Fluffy_Pillow 37.5/100: 37% energy | 0.0/5: 0% combo_points symbols_of_death, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
1:35.382 stealthed V shadowstrike Fluffy_Pillow 38.5/100: 38% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
1:36.386 stealthed V shadowstrike Fluffy_Pillow 34.7/100: 35% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
1:37.390 Waiting     0.468 sec 23.0/100: 23% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge
1:37.858 finish P eviscerate Fluffy_Pillow 28.6/100: 29% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge
1:38.861 stealthed V shadowstrike Fluffy_Pillow 50.8/100: 51% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
1:39.866 Waiting     0.100 sec 30.9/100: 31% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
1:39.966 stealthed V shadowstrike Fluffy_Pillow 32.1/100: 32% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
1:40.969 Waiting     1.133 sec 20.8/100: 21% energy | 5.0/5: 100% combo_points symbols_of_death, quick_navigation_final, masterful_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
1:42.102 finish P eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/5: 100% combo_points symbols_of_death, quick_navigation_final, masterful_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge
1:43.107 build G backstab Fluffy_Pillow 42.6/100: 43% energy | 0.0/5: 0% combo_points quick_navigation_final, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(6)
1:44.110 Waiting     0.992 sec 20.1/100: 20% energy | 1.0/5: 20% combo_points quick_navigation_final, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(5)
1:45.102 build G backstab Fluffy_Pillow 40.4/100: 40% energy | 2.0/5: 40% combo_points quick_navigation_final, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(4)
1:46.106 Waiting     1.473 sec 17.9/100: 18% energy | 3.0/5: 60% combo_points quick_navigation_final, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
1:47.579 build G backstab Fluffy_Pillow 36.1/100: 36% energy | 3.0/5: 60% combo_points quick_navigation_final, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge
1:48.584 Waiting     1.029 sec 13.5/100: 14% energy | 4.0/5: 80% combo_points quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge
1:49.613 default B nightblade Fluffy_Pillow 26.2/100: 26% energy | 4.0/5: 80% combo_points quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:50.617 build G backstab Fluffy_Pillow 45.0/100: 45% energy | 1.0/5: 20% combo_points masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:51.621 Waiting     1.212 sec 21.4/100: 21% energy | 2.0/5: 40% combo_points masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:52.833 build G backstab Fluffy_Pillow 35.3/100: 35% energy | 2.0/5: 40% combo_points masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:53.837 Waiting     1.339 sec 11.8/100: 12% energy | 3.0/5: 60% combo_points quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:55.176 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 4.0/5: 80% combo_points quick_navigation, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:56.181 build G backstab Fluffy_Pillow 35.9/100: 36% energy | 0.0/5: 0% combo_points quick_navigation, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:57.186 Waiting     1.582 sec 12.5/100: 13% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:58.768 stealth_cds R shadow_dance Fluffy_Pillow 30.8/100: 31% energy | 1.0/5: 20% combo_points frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:58.768 Waiting     0.100 sec 31.8/100: 32% energy | 1.0/5: 20% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:58.868 stealthed V shadowstrike Fluffy_Pillow 40.9/100: 41% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:59.873 finish O nightblade Fluffy_Pillow 28.5/100: 29% energy | 4.0/5: 80% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:00.878 stealthed V shadowstrike Fluffy_Pillow 52.2/100: 52% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:01.885 stealthed V shadowstrike Fluffy_Pillow 39.9/100: 40% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage(2), quick_navigation, masterful_navigation(4), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:02.891 cds I symbols_of_death Fluffy_Pillow 19.5/100: 20% energy | 4.0/5: 80% combo_points shadow_dance, frothing_rage(2), quick_navigation, masterful_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:02.891 finish P eviscerate Fluffy_Pillow 59.5/100: 60% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation, masterful_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:03.895 cds K marked_for_death Fluffy_Pillow 67.2/100: 67% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(2), quick_navigation, masterful_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:03.895 finish P eviscerate Fluffy_Pillow 67.2/100: 67% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), quick_navigation, masterful_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:04.901 stealth_cds R shadow_dance Fluffy_Pillow 81.9/100: 82% energy | 1.0/5: 20% combo_points symbols_of_death, frothing_rage(2), quick_navigation, masterful_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:04.901 stealthed V shadowstrike Fluffy_Pillow 82.9/100: 83% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:05.906 stealthed V shadowstrike Fluffy_Pillow 70.6/100: 71% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(2), masterful_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:06.908 finish P eviscerate Fluffy_Pillow 58.3/100: 58% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(2), masterful_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:07.913 stealthed V shadowstrike Fluffy_Pillow 80.1/100: 80% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation(2), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:08.917 stealthed V shadowstrike Fluffy_Pillow 59.9/100: 60% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation(2), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:09.922 finish P eviscerate Fluffy_Pillow 47.7/100: 48% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), quick_navigation(2), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:10.926 stealth_cds R shadow_dance Fluffy_Pillow 54.4/100: 54% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(2), quick_navigation(2), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:10.926 stealthed V shadowstrike Fluffy_Pillow 55.4/100: 55% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(2), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:11.930 stealthed V shadowstrike Fluffy_Pillow 43.2/100: 43% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(2), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:12.935 finish P eviscerate Fluffy_Pillow 31.0/100: 31% energy | 4.0/5: 80% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:13.941 stealthed V shadowstrike Fluffy_Pillow 46.8/100: 47% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:14.944 Waiting     0.500 sec 26.6/100: 27% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:15.444 stealthed V shadowstrike Fluffy_Pillow 32.5/100: 32% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:16.449 Waiting     1.073 sec 12.3/100: 12% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:17.522 default B nightblade Fluffy_Pillow 33.1/100: 33% energy | 5.0/5: 100% combo_points frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:18.524 build G backstab Fluffy_Pillow 50.0/100: 50% energy | 0.0/5: 0% combo_points frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:19.529 default F arcane_torrent Fluffy_Pillow 34.9/100: 35% energy | 2.0/5: 40% combo_points frothing_rage(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:20.533 build G backstab Fluffy_Pillow 61.8/100: 62% energy | 2.0/5: 40% combo_points frothing_rage(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:21.538 build G backstab Fluffy_Pillow 38.7/100: 39% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:22.543 Waiting     0.987 sec 15.7/100: 16% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:23.530 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/5: 100% combo_points frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:24.534 build G backstab Fluffy_Pillow 42.5/100: 42% energy | 0.0/5: 0% combo_points frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:25.540 Waiting     1.355 sec 19.5/100: 20% energy | 1.0/5: 20% combo_points frothing_rage(2), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:26.895 build G backstab Fluffy_Pillow 35.8/100: 36% energy | 1.0/5: 20% combo_points frothing_rage(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:27.901 Waiting     1.414 sec 12.8/100: 13% energy | 2.0/5: 40% combo_points frothing_rage(2), quick_navigation(3), masterful_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:29.315 build G backstab Fluffy_Pillow 37.8/100: 38% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation(3), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:30.320 Waiting     0.847 sec 14.8/100: 15% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation(3), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:31.167 finish N nightblade Fluffy_Pillow 25.0/100: 25% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation(4), masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:32.170 build G backstab Fluffy_Pillow 36.1/100: 36% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation(4), masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:33.175 cds I symbols_of_death Fluffy_Pillow 21.2/100: 21% energy | 2.0/5: 40% combo_points frothing_rage(3), quick_navigation(4), masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:33.175 build G backstab Fluffy_Pillow 61.2/100: 61% energy | 2.0/5: 40% combo_points symbols_of_death, frothing_rage(3), quick_navigation(4), masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
2:34.180 build G backstab Fluffy_Pillow 38.2/100: 38% energy | 3.0/5: 60% combo_points symbols_of_death, frothing_rage(3), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection
2:35.186 Waiting     1.673 sec 15.5/100: 16% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage(3), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection
2:36.859 finish P eviscerate Fluffy_Pillow 36.0/100: 36% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage(3), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection
2:37.862 cds K marked_for_death Fluffy_Pillow 37.3/100: 37% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(3), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection
2:37.862 finish P eviscerate Fluffy_Pillow 37.3/100: 37% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(3), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection
2:38.867 stealth_cds R shadow_dance Fluffy_Pillow 44.6/100: 45% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(3), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection
2:38.867 stealthed V shadowstrike Fluffy_Pillow 45.6/100: 46% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection
2:39.873 stealthed V shadowstrike Fluffy_Pillow 41.9/100: 42% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, quick_navigation_final, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:40.879 finish P eviscerate Fluffy_Pillow 30.3/100: 30% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, quick_navigation_final, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:41.884 stealthed V shadowstrike Fluffy_Pillow 52.7/100: 53% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, quick_navigation_final, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:42.890 stealthed V shadowstrike Fluffy_Pillow 33.0/100: 33% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, quick_navigation_final, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:43.895 Waiting     1.127 sec 13.3/100: 13% energy | 4.0/5: 80% combo_points masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:45.022 finish N nightblade Fluffy_Pillow 26.1/100: 26% energy | 4.0/5: 80% combo_points masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:46.026 build G backstab Fluffy_Pillow 36.6/100: 37% energy | 0.0/5: 0% combo_points masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:47.031 Waiting     1.245 sec 21.1/100: 21% energy | 2.0/5: 40% combo_points masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:48.276 build G backstab Fluffy_Pillow 35.3/100: 35% energy | 2.0/5: 40% combo_points masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:49.281 Waiting     2.060 sec 11.7/100: 12% energy | 3.0/5: 60% combo_points quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection
2:51.341 build G backstab Fluffy_Pillow 35.3/100: 35% energy | 3.0/5: 60% combo_points quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection
2:52.344 Waiting     1.361 sec 19.7/100: 20% energy | 5.0/5: 100% combo_points quick_navigation, masterful_navigation(3), archive_of_the_titans(20), resounding_protection
2:53.705 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/5: 100% combo_points quick_navigation, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:54.710 build G backstab Fluffy_Pillow 41.9/100: 42% energy | 0.0/5: 0% combo_points quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:55.716 Waiting     1.462 sec 18.5/100: 19% energy | 1.0/5: 20% combo_points quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:57.178 build G backstab Fluffy_Pillow 35.5/100: 35% energy | 1.0/5: 20% combo_points quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:58.182 Waiting     1.110 sec 12.1/100: 12% energy | 2.0/5: 40% combo_points quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:59.292 cds L shadow_blades Fluffy_Pillow 33.0/100: 33% energy | 3.0/5: 60% combo_points quick_navigation, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:00.295 build G backstab Fluffy_Pillow 44.6/100: 45% energy | 3.0/5: 60% combo_points shadow_blades, quick_navigation, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:01.298 Waiting     0.421 sec 21.3/100: 21% energy | 5.0/5: 100% combo_points shadow_blades, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:01.719 default B nightblade Fluffy_Pillow 26.2/100: 26% energy | 5.0/5: 100% combo_points shadow_blades, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:02.723 stealth_cds Q vanish Fluffy_Pillow 42.8/100: 43% energy | 0.0/5: 0% combo_points shadow_blades, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:02.723 cds H potion Fluffy_Pillow 43.8/100: 44% energy | 0.0/5: 0% combo_points vanish, shadow_blades, master_of_shadows, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:02.723 stealthed V shadowstrike Fluffy_Pillow 43.8/100: 44% energy | 0.0/5: 0% combo_points vanish, shadow_blades, master_of_shadows, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
3:03.729 cds I symbols_of_death Fluffy_Pillow 39.5/100: 39% energy | 4.0/5: 80% combo_points shadow_blades, master_of_shadows, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
3:03.729 finish P eviscerate Fluffy_Pillow 79.5/100: 79% energy | 4.0/5: 80% combo_points shadow_blades, symbols_of_death, master_of_shadows, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
3:04.735 stealth_cds R shadow_dance Fluffy_Pillow 88.2/100: 88% energy | 0.0/5: 0% combo_points shadow_blades, symbols_of_death, master_of_shadows, quick_navigation(2), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
3:04.735 stealthed V shadowstrike Fluffy_Pillow 89.2/100: 89% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(2), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
3:05.741 stealthed V shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 3.0/5: 60% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(2), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
3:06.747 finish P eviscerate Fluffy_Pillow 72.8/100: 73% energy | 5.0/5: 100% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(2), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
3:07.753 stealthed V shadowstrike Fluffy_Pillow 94.6/100: 95% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, quick_navigation(2), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
3:08.757 stealthed V shadowstrike Fluffy_Pillow 74.5/100: 74% energy | 3.0/5: 60% combo_points shadow_blades, shadow_dance, symbols_of_death, quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
3:09.762 finish P eviscerate Fluffy_Pillow 54.4/100: 54% energy | 5.0/5: 100% combo_points shadow_blades, symbols_of_death, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
3:10.766 stealth_cds R shadow_dance Fluffy_Pillow 69.4/100: 69% energy | 1.0/5: 20% combo_points shadow_blades, symbols_of_death, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
3:10.766 stealthed V shadowstrike Fluffy_Pillow 70.4/100: 70% energy | 1.0/5: 20% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
3:11.771 finish P eviscerate Fluffy_Pillow 58.4/100: 58% energy | 4.0/5: 80% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
3:12.776 stealthed V shadowstrike Fluffy_Pillow 74.4/100: 74% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
3:13.780 finish P eviscerate Fluffy_Pillow 70.4/100: 70% energy | 4.0/5: 80% combo_points shadow_blades, shadow_dance, quick_navigation(4), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
3:14.785 stealthed V shadowstrike Fluffy_Pillow 78.5/100: 79% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
3:15.791 build G backstab Fluffy_Pillow 58.6/100: 59% energy | 3.0/5: 60% combo_points shadow_blades, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
3:16.796 default B nightblade Fluffy_Pillow 35.6/100: 36% energy | 5.0/5: 100% combo_points shadow_blades, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
3:17.802 cds K marked_for_death Fluffy_Pillow 52.7/100: 53% energy | 0.0/5: 0% combo_points shadow_blades, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
3:17.802 finish P eviscerate Fluffy_Pillow 52.7/100: 53% energy | 5.0/5: 100% combo_points shadow_blades, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
3:18.806 build G backstab Fluffy_Pillow 67.8/100: 68% energy | 1.0/5: 20% combo_points shadow_blades, frothing_rage, quick_navigation(4), masterful_navigation, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
3:19.810 build G backstab Fluffy_Pillow 44.8/100: 45% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation(4), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
3:20.815 Waiting     0.973 sec 22.8/100: 23% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(4), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(6), battle_potion_of_agility
3:21.788 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(4), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(6), battle_potion_of_agility
3:22.792 build G backstab Fluffy_Pillow 37.5/100: 38% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation(4), masterful_navigation, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(6), battle_potion_of_agility
3:23.797 Waiting     0.907 sec 23.6/100: 24% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(4), masterful_navigation, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(21), battle_potion_of_agility
3:24.704 build G backstab Fluffy_Pillow 35.2/100: 35% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(4), masterful_navigation, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), battle_potion_of_agility
3:25.708 Waiting     1.442 sec 13.0/100: 13% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation(4), masterful_navigation, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(19), battle_potion_of_agility
3:27.150 finish P eviscerate Fluffy_Pillow 39.3/100: 39% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(4), masterful_navigation, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(17), battle_potion_of_agility
3:28.154 stealth_cds R shadow_dance Fluffy_Pillow 41.6/100: 42% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation_final, masterful_navigation, elemental_whirl_mastery, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(16)
3:28.154 stealthed V shadowstrike Fluffy_Pillow 42.6/100: 43% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation, elemental_whirl_mastery, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(16)
3:29.159 Waiting     0.100 sec 31.9/100: 32% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation, elemental_whirl_mastery, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(15)
3:29.259 stealthed V shadowstrike Fluffy_Pillow 33.2/100: 33% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation, elemental_whirl_mastery, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(15)
3:30.263 finish O nightblade Fluffy_Pillow 30.4/100: 30% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation, elemental_whirl_mastery, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(14)
3:31.267 stealthed V shadowstrike Fluffy_Pillow 61.6/100: 62% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage, quick_navigation_final, masterful_navigation(2), elemental_whirl_mastery, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, overwhelming_power(13)
3:32.271 stealthed V shadowstrike Fluffy_Pillow 42.5/100: 43% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage, quick_navigation_final, masterful_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(12)
3:33.276 Waiting     0.300 sec 31.3/100: 31% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation_final, masterful_navigation(3), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
3:33.576 cds I symbols_of_death Fluffy_Pillow 35.1/100: 35% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation_final, masterful_navigation(3), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
3:33.729 finish P eviscerate Fluffy_Pillow 77.0/100: 77% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation(3), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
3:34.734 stealth_cds R shadow_dance Fluffy_Pillow 84.7/100: 85% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
3:34.734 stealthed V shadowstrike Fluffy_Pillow 85.7/100: 86% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
3:35.740 stealthed V shadowstrike Fluffy_Pillow 74.5/100: 74% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
3:36.744 finish P eviscerate Fluffy_Pillow 63.1/100: 63% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
3:37.749 stealthed V shadowstrike Fluffy_Pillow 87.2/100: 87% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge
3:38.755 stealthed V shadowstrike Fluffy_Pillow 67.0/100: 67% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge
3:39.759 finish P eviscerate Fluffy_Pillow 46.7/100: 47% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
3:40.763 stealth_cds R shadow_dance Fluffy_Pillow 53.4/100: 53% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge
3:40.763 stealthed V shadowstrike Fluffy_Pillow 54.4/100: 54% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge
3:41.767 stealthed V shadowstrike Fluffy_Pillow 50.1/100: 50% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
3:42.773 finish P eviscerate Fluffy_Pillow 37.7/100: 38% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge
3:43.777 stealthed V shadowstrike Fluffy_Pillow 59.2/100: 59% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage, quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power
3:44.781 stealthed V shadowstrike Fluffy_Pillow 39.3/100: 39% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage, quick_navigation, masterful_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(25)
3:45.787 Waiting     0.600 sec 27.7/100: 28% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation, masterful_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(24)
3:46.387 finish P eviscerate Fluffy_Pillow 35.0/100: 35% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation, masterful_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(23)
3:47.391 build G backstab Fluffy_Pillow 42.3/100: 42% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(22)
3:48.396 Waiting     0.942 sec 19.6/100: 20% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(21)
3:49.338 default F arcane_torrent Fluffy_Pillow 31.1/100: 31% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(20)
3:50.533 build G backstab Fluffy_Pillow 60.6/100: 61% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(19)
3:51.538 build G backstab Fluffy_Pillow 45.8/100: 46% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
3:52.542 Waiting     0.266 sec 23.0/100: 23% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
3:52.808 default B nightblade Fluffy_Pillow 26.2/100: 26% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
3:53.814 cds K marked_for_death Fluffy_Pillow 37.4/100: 37% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
3:53.814 finish P eviscerate Fluffy_Pillow 37.4/100: 37% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
3:54.818 build G backstab Fluffy_Pillow 44.5/100: 44% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge
3:55.822 Waiting     0.500 sec 29.5/100: 30% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
3:56.322 build G backstab Fluffy_Pillow 35.5/100: 35% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation, masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
3:57.327 Waiting     1.248 sec 12.5/100: 13% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge
3:58.575 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
3:59.580 build G backstab Fluffy_Pillow 36.3/100: 36% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
4:00.585 Waiting     1.892 sec 13.3/100: 13% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation(2), masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(9)
4:02.477 build G backstab Fluffy_Pillow 35.6/100: 36% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7)
4:03.481 cds I symbols_of_death Fluffy_Pillow 12.4/100: 12% energy | 2.0/5: 40% combo_points quick_navigation(2), masterful_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(6)
4:03.729 build G backstab Fluffy_Pillow 55.3/100: 55% energy | 2.0/5: 40% combo_points symbols_of_death, quick_navigation(2), masterful_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(6)
4:04.734 finish N nightblade Fluffy_Pillow 40.1/100: 40% energy | 4.0/5: 80% combo_points symbols_of_death, quick_navigation(2), masterful_navigation(4), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(2)
4:05.738 stealth_cds R shadow_dance Fluffy_Pillow 50.9/100: 51% energy | 0.0/5: 0% combo_points symbols_of_death, quick_navigation(2), masterful_navigation(4), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
4:05.738 stealthed V shadowstrike Fluffy_Pillow 51.9/100: 52% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(2), masterful_navigation(4), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
4:06.741 stealthed V shadowstrike Fluffy_Pillow 39.7/100: 40% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(2), masterful_navigation(4), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(2)
4:07.746 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, quick_navigation(2), masterful_navigation(4), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(2)
4:08.752 stealthed V shadowstrike Fluffy_Pillow 57.1/100: 57% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, quick_navigation(2), masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(2)
4:09.757 stealthed V shadowstrike Fluffy_Pillow 36.8/100: 37% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, quick_navigation(2), masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:10.760 Waiting     0.933 sec 16.5/100: 16% energy | 4.0/5: 80% combo_points symbols_of_death, quick_navigation(2), masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:11.693 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/5: 100% combo_points symbols_of_death, quick_navigation(3), masterful_navigation(4), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:12.698 build G backstab Fluffy_Pillow 42.1/100: 42% energy | 0.0/5: 0% combo_points symbols_of_death, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:13.703 Waiting     1.424 sec 18.9/100: 19% energy | 1.0/5: 20% combo_points symbols_of_death, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:15.127 build G backstab Fluffy_Pillow 35.5/100: 35% energy | 1.0/5: 20% combo_points quick_navigation(3), masterful_navigation(4), archive_of_the_titans(20), resounding_protection
4:16.131 Waiting     1.316 sec 12.1/100: 12% energy | 2.0/5: 40% combo_points quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
4:17.447 build G backstab Fluffy_Pillow 35.4/100: 35% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation(4), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:18.452 Waiting     1.094 sec 12.2/100: 12% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(4), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:19.546 finish N nightblade Fluffy_Pillow 25.6/100: 26% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:20.550 build G backstab Fluffy_Pillow 44.9/100: 45% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:21.554 Waiting     1.123 sec 22.3/100: 22% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:22.677 build G backstab Fluffy_Pillow 36.1/100: 36% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:23.682 Waiting     1.142 sec 13.4/100: 13% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:24.824 finish P eviscerate Fluffy_Pillow 35.5/100: 35% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:25.829 cds K marked_for_death Fluffy_Pillow 36.9/100: 37% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:25.829 finish P eviscerate Fluffy_Pillow 36.9/100: 37% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:26.835 build G backstab Fluffy_Pillow 44.3/100: 44% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:27.839 Waiting     0.467 sec 21.7/100: 22% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation_final, masterful_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:28.306 build G backstab Fluffy_Pillow 35.5/100: 35% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation_final, masterful_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:29.311 Waiting     1.915 sec 12.2/100: 12% energy | 3.0/5: 60% combo_points frothing_rage, masterful_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:31.226 finish O nightblade Fluffy_Pillow 42.2/100: 42% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation, masterful_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:32.231 stealth_cds R shadow_dance Fluffy_Pillow 52.9/100: 53% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation, masterful_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:32.231 stealthed V shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:33.237 stealthed V shadowstrike Fluffy_Pillow 41.6/100: 42% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:34.241 cds I symbols_of_death Fluffy_Pillow 29.2/100: 29% energy | 4.0/5: 80% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:34.241 finish P eviscerate Fluffy_Pillow 69.2/100: 69% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:35.244 stealthed V shadowstrike Fluffy_Pillow 92.9/100: 93% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(2), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:36.248 stealthed V shadowstrike Fluffy_Pillow 72.5/100: 72% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:37.253 finish P eviscerate Fluffy_Pillow 52.2/100: 52% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:38.256 stealth_cds R shadow_dance Fluffy_Pillow 58.8/100: 59% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:38.256 stealthed V shadowstrike Fluffy_Pillow 59.8/100: 60% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:39.260 stealthed V shadowstrike Fluffy_Pillow 47.4/100: 47% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:40.265 finish P eviscerate Fluffy_Pillow 35.1/100: 35% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:41.270 stealthed V shadowstrike Fluffy_Pillow 58.8/100: 59% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:42.275 stealthed V shadowstrike Fluffy_Pillow 38.5/100: 39% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:43.280 Waiting     1.077 sec 18.3/100: 18% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:44.357 finish P eviscerate Fluffy_Pillow 38.8/100: 39% energy | 5.0/5: 100% combo_points frothing_rage(2), quick_navigation, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:45.361 stealth_cds S shadow_dance Fluffy_Pillow 45.5/100: 46% energy | 0.0/5: 0% combo_points frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:45.361 stealthed V shadowstrike Fluffy_Pillow 46.5/100: 47% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:46.365 stealthed V shadowstrike Fluffy_Pillow 34.3/100: 34% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:47.369 finish N nightblade Fluffy_Pillow 22.1/100: 22% energy | 4.0/5: 80% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:48.373 stealthed V shadowstrike Fluffy_Pillow 53.8/100: 54% energy | 1.0/5: 20% combo_points shadow_dance, frothing_rage(3), quick_navigation, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:49.377 stealthed V shadowstrike Fluffy_Pillow 33.6/100: 34% energy | 3.0/5: 60% combo_points shadow_dance, frothing_rage(3), quick_navigation, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:50.382 Waiting     1.683 sec 13.4/100: 13% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(2), masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:52.065 finish P eviscerate Fluffy_Pillow 41.3/100: 41% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(2), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:53.069 build G backstab Fluffy_Pillow 48.2/100: 48% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation(2), masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
4:54.075 Waiting     0.900 sec 25.2/100: 25% energy | 1.0/5: 20% combo_points frothing_rage(3), quick_navigation(2), masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:54.975 build G backstab Fluffy_Pillow 35.9/100: 36% energy | 1.0/5: 20% combo_points frothing_rage(3), quick_navigation(2), masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:55.979 Waiting     1.246 sec 20.9/100: 21% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation(2), masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:57.225 build G backstab Fluffy_Pillow 35.7/100: 36% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation(2), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:58.230 Waiting     1.025 sec 12.7/100: 13% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
4:59.255 cds J marked_for_death Fluffy_Pillow 25.0/100: 25% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:59.255 Waiting     0.300 sec 25.0/100: 25% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)
4:59.555 finish P eviscerate Fluffy_Pillow 36.6/100: 37% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(8)

Stats

Level Bonus (120) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 1467 -3 1524 1464 0
Agility 1467 1 6565 6147 4387 (3433)
Stamina 1001 0 9026 8206 7205
Intellect 1467 2 1681 1469 0
Spirit 0 0 0 0 0
Health 180520 164120 0
Energy 100 100 0
Combo Points 5 5 0
Crit 22.83% 22.83% 852
Haste 13.50% 13.50% 918
Damage / Heal Versatility 0.80% 0.80% 68
Attack Power 7222 6147 0
Mastery 59.22% 59.22% 1164
Armor 1897 1897 1897
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Hood of Pestilent Ichor
ilevel: 390, stats: { 260 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Unstable Flames, Resounding Protection, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Usurper's Bloodcaked Spaulders
ilevel: 390, stats: { 240 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Vampiric Speed, Azerite Empowered }
Local Chest Jerkin of the Aberrant Chimera
ilevel: 390, stats: { 320 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Resounding Protection, Azerite Empowered }
Local Waist Bloodstorm Buckle
ilevel: 385, stats: { 174 Armor, +247 AgiInt, +417 Sta, +115 Mastery, +68 Vers }
Local Legs Pathogenic Legwraps
ilevel: 385, stats: { 271 Armor, +329 AgiInt, +556 Sta, +154 Haste, +91 Mastery }
Local Feet Striders of the Putrescent Path
ilevel: 385, stats: { 213 Armor, +247 AgiInt, +417 Sta, +115 Mastery, +68 Crit }
Local Wrists Wristwraps of Coursing Miasma
ilevel: 385, stats: { 135 Armor, +185 AgiInt, +312 Sta, +83 Crit, +54 Haste }
Local Hands Gloves of Descending Madness
ilevel: 385, stats: { 193 Armor, +247 AgiInt, +417 Sta, +115 Haste, +68 Crit }
Local Finger1 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Mastery }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Mastery }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Plasma-Spattered Greatcloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +81 Mastery, +57 Crit }
Local Main Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: quick_navigation
Local Off Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: masterful_navigation

Talents

Level
15 Weaponmaster (Subtlety Rogue) Find Weakness (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus (Subtlety Rogue)
45 Vigor Deeper Stratagem Marked for Death
60 Soothing Darkness (Subtlety Rogue) Cheat Death Elusiveness
75 Shot in the Dark (Subtlety Rogue) Night Terrors (Subtlety Rogue) Prey on the Weak
90 Dark Shadow (Subtlety Rogue) Alacrity (Subtlety Rogue) Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Secret Technique (Subtlety Rogue) Shuriken Tornado (Subtlety Rogue)

Profile

rogue="T22_Rogue_Subtlety"
spec=subtlety
level=120
race=blood_elf
role=attack
position=back
talents=2330031

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Used to define when to use stealth CDs or builders
actions.precombat+=/variable,name=stealth_threshold,value=60+talent.vigor.enabled*35+talent.master_of_shadows.enabled*10
actions.precombat+=/stealth
actions.precombat+=/marked_for_death,precombat_seconds=15
actions.precombat+=/shadow_blades,precombat_seconds=1
actions.precombat+=/potion

# Executed every time the actor is available.
# Check CDs at first
actions=call_action_list,name=cds
# Run fully switches to the Stealthed Rotation (by doing so, it forces pooling if nothing is available).
actions+=/run_action_list,name=stealthed,if=stealthed.all
# Apply Nightblade at 2+ CP during the first 10 seconds, after that 4+ CP if it expires within the next GCD or is not up
actions+=/nightblade,if=target.time_to_die>6&remains<gcd.max&combo_points>=4-(time<10)*2
# Consider using a Stealth CD when reaching the energy threshold and having space for at least 4 CP
actions+=/call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&combo_points.deficit>=4
# Finish at 4+ without DS, 5+ with DS (outside stealth)
actions+=/call_action_list,name=finish,if=combo_points>=4+talent.deeper_stratagem.enabled|target.time_to_die<=1&combo_points>=3
# Use a builder when reaching the energy threshold (minus 40 if none of Alacrity, Shadow Focus, and Master of Shadows is selected)
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold-40*!(talent.alacrity.enabled|talent.shadow_focus.enabled|talent.master_of_shadows.enabled)
# Lowest priority in all of the APL because it causes a GCD
actions+=/arcane_torrent,if=energy.deficit>=15+energy.regen
actions+=/arcane_pulse
actions+=/lights_judgment

# Shuriken Toss at 29+ Sharpened Blades stacks. 1T at Rank 1, up to 4 at Rank 2, up to 5 at Rank 3
actions.build=shuriken_toss,if=buff.sharpened_blades.stack>=29&spell_targets.shuriken_storm<=1+3*azerite.sharpened_blades.rank=2+4*azerite.sharpened_blades.rank=3
actions.build+=/shuriken_storm,if=spell_targets.shuriken_storm>=2|buff.the_dreadlords_deceit.stack>=29
actions.build+=/gloomblade
actions.build+=/backstab

actions.cds=potion,if=buff.bloodlust.react|target.time_to_die<=60|(buff.vanish.up&(buff.shadow_blades.up|cooldown.shadow_blades.remains<=30))
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/fireblood,if=stealthed.rogue
actions.cds+=/ancestral_call,if=stealthed.rogue
actions.cds+=/symbols_of_death,if=dot.nightblade.ticking
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit
actions.cds+=/marked_for_death,if=raid_event.adds.in>30&!stealthed.all&combo_points.deficit>=cp_max_spend
actions.cds+=/shadow_blades,if=combo_points.deficit>=2+stealthed.all
actions.cds+=/shuriken_tornado,if=spell_targets>=3&dot.nightblade.ticking&buff.symbols_of_death.up&buff.shadow_dance.up
actions.cds+=/shadow_dance,if=!buff.shadow_dance.up&target.time_to_die<=5+talent.subterfuge.enabled

# Keep up Nightblade if it is about to run out. Do not use NB during Dance, if talented into Dark Shadow.
actions.finish=nightblade,if=(!talent.dark_shadow.enabled|!buff.shadow_dance.up)&target.time_to_die-remains>6&remains<tick_time*2&(spell_targets.shuriken_storm<4|!buff.symbols_of_death.up)
# Multidotting outside Dance on targets that will live for the duration of Nightblade with refresh during pandemic if you have less than 6 targets or play with Secret Technique.
actions.finish+=/nightblade,cycle_targets=1,if=spell_targets.shuriken_storm>=2&(spell_targets.shuriken_storm<=5|talent.secret_technique.enabled)&!buff.shadow_dance.up&target.time_to_die>=(5+(2*combo_points))&refreshable
# Refresh Nightblade early if it will expire during Symbols. Do that refresh if SoD gets ready in the next 5s.
actions.finish+=/nightblade,if=remains<cooldown.symbols_of_death.remains+10&cooldown.symbols_of_death.remains<=5&target.time_to_die-remains>cooldown.symbols_of_death.remains+5
# Secret Technique during Symbols. With Dark Shadow and multiple targets also only during Shadow Dance (until threshold in next line).
actions.finish+=/secret_technique,if=buff.symbols_of_death.up&(!talent.dark_shadow.enabled|spell_targets.shuriken_storm<2|buff.shadow_dance.up)
# With enough targets always use SecTec on CD.
actions.finish+=/secret_technique,if=spell_targets.shuriken_storm>=2+talent.dark_shadow.enabled+talent.nightstalker.enabled
actions.finish+=/eviscerate

# Helper Variable
actions.stealth_cds=variable,name=shd_threshold,value=cooldown.shadow_dance.charges_fractional>=1.75
# Vanish unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
actions.stealth_cds+=/vanish,if=!variable.shd_threshold&debuff.find_weakness.remains<1
# Pool for Shadowmeld + Shadowstrike unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10&!variable.shd_threshold&debuff.find_weakness.remains<1
# With Dark Shadow only Dance when Nightblade will stay up. Use during Symbols or above threshold.
actions.stealth_cds+=/shadow_dance,if=(!talent.dark_shadow.enabled|dot.nightblade.remains>=5+talent.subterfuge.enabled)&(variable.shd_threshold|buff.symbols_of_death.remains>=1.2|spell_targets>=4&cooldown.symbols_of_death.remains>10)
actions.stealth_cds+=/shadow_dance,if=target.time_to_die<cooldown.symbols_of_death.remains

# If stealth is up, we really want to use Shadowstrike to benefits from the passive bonus, even if we are at max cp (from the precombat MfD).
actions.stealthed=shadowstrike,if=buff.stealth.up
# Finish at 4+ CP without DS, 5+ with DS, and 6 with DS after Vanish
actions.stealthed+=/call_action_list,name=finish,if=combo_points.deficit<=1-(talent.deeper_stratagem.enabled&buff.vanish.up)
# At 2 targets with Secret Technique keep up Find Weakness by cycling Shadowstrike.
actions.stealthed+=/shadowstrike,cycle_targets=1,if=talent.secret_technique.enabled&talent.find_weakness.enabled&debuff.find_weakness.remains<1&spell_targets.shuriken_storm=2&target.time_to_die-remains>6
actions.stealthed+=/shuriken_storm,if=spell_targets.shuriken_storm>=3
actions.stealthed+=/shadowstrike

head=hood_of_pestilent_ichor,id=160623,bonus_id=4824/1507/4775,azerite_powers=4/483/459/15/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=usurpers_bloodcaked_spaulders,id=160620,bonus_id=4824/1507/4775,azerite_powers=4/483/30/44/13
back=plasmaspattered_greatcloak,id=160644,bonus_id=4800/1507
chest=jerkin_of_the_aberrant_chimera,id=160619,bonus_id=4824/1507/4775,azerite_powers=4/483/21/15/13
wrists=wristwraps_of_coursing_miasma,id=160621,bonus_id=4800/1507
hands=gloves_of_descending_madness,id=160618,bonus_id=4800/1507
waist=bloodstorm_buckle,id=160622,bonus_id=4800/1507
legs=pathogenic_legwraps,id=160625,bonus_id=4800/1507
feet=striders_of_the_putrescent_path,id=160729,bonus_id=4800/1507
finger1=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_mastery
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_mastery
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=quick_navigation
off_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=masterful_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=852
# gear_haste_rating=918
# gear_mastery_rating=1164
# gear_versatility_rating=68
# gear_armor=1897

T22_Shaman_Enhancement : 17177 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17176.8 17176.8 20.5 / 0.119% 3556.3 / 20.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 2.48% 55.1 100.0% 100%
Talents
  • 15: Lightning Shield (Enhancement Shaman)
  • 30: Landslide (Enhancement Shaman)
  • 60: Searing Assault (Enhancement Shaman)
  • 90: Sundering (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Shaman_Enhancement 17177
Flametongue 201 (1709) 1.2% (10.0%) 29.0 10.48sec 17661 15634 Direct 29.0 1640 3278 2076 26.6% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.00 29.00 0.00 0.00 1.1297 0.0000 60198.23 60198.23 0.00 15633.76 15633.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.29 73.41% 1640.22 1591 1812 1640.67 1600 1697 34920 34920 0.00
crit 7.71 26.59% 3278.49 3182 3624 3277.39 0 3618 25279 25279 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=0} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage.
 
    Flametongue Attack 783 4.6% 627.0 0.73sec 374 0 Direct 627.0 295 590 374 26.8% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 626.96 626.96 0.00 0.00 0.0000 0.0000 234589.22 234589.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 459.05 73.22% 295.20 286 325 295.29 292 299 135512 135512 0.00
crit 167.92 26.78% 590.04 571 650 590.22 581 602 99077 99077 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=0} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.044000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Searing Assault 725 4.2% 29.0 10.48sec 7496 0 Periodic 85.9 1998 3993 2531 26.7% 0.0% 57.3%

Stats details: searing_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.00 0.00 85.87 85.87 0.0000 2.0000 217374.56 217374.56 0.00 1265.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.9 73.25% 1997.57 1942 2212 1998.02 1970 2029 125657 125657 0.00
crit 23.0 26.75% 3992.93 3885 4424 3993.90 3901 4158 91718 91718 0.00
 
 

Action details: searing_assault

Static Values
  • id:268429
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:268429
  • name:Searing Assault
  • school:fire
  • tooltip:Suffering {$s1=0} Fire damage every $t1 sec.
  • description:{$@spelldesc192087=Flametongue now causes the target to burn for $268429o1 Fire damage over {$268429d=6 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Frenetic Blow (frentic_blow) 312 1.8% 3.6 72.75sec 25862 0 Direct 3.6 20372 40743 25862 27.0% 0.0%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.62 3.62 0.00 0.00 0.0000 0.0000 93591.60 133800.43 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.64 73.05% 20371.63 20372 20372 19898.94 0 20372 53853 76990 29.35
crit 0.98 26.95% 40743.26 40743 40743 26899.57 0 40743 39738 56810 19.84
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Heed My Call 158 (225) 0.9% (1.3%) 7.5 36.82sec 8993 0 Direct 7.5 4971 9943 6293 26.6% 0.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 7.50 0.00 0.00 0.0000 0.0000 47222.84 47222.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.51 73.42% 4971.42 4971 4971 4962.14 0 4971 27392 27392 0.00
crit 1.99 26.58% 9942.84 9943 9943 8742.91 0 9943 19831 19831 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 68 0.4% 7.5 36.82sec 2700 0 Direct 7.5 2131 4261 2700 26.7% 0.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 7.50 0.00 0.00 0.0000 0.0000 20264.50 20264.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.50 73.26% 2130.61 2131 2131 2127.20 0 2131 11713 11713 0.00
crit 2.01 26.74% 4261.22 4261 4261 3731.62 0 4261 8551 8551 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Laser Matrix 1305 7.6% 15.2 19.52sec 25749 0 Direct 15.2 20338 40675 25749 26.6% 0.0%  

Stats details: laser_matrix

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.18 15.18 0.00 0.00 0.0000 0.0000 390946.66 390946.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.14 73.39% 20337.62 20338 20338 20337.62 20338 20338 226624 226624 0.00
crit 4.04 26.61% 40675.25 40675 40675 39942.99 0 40675 164323 164323 0.00
 
 

Action details: laser_matrix

Static Values
  • id:280705
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:280705
  • name:Laser Matrix
  • school:arcane
  • tooltip:
  • description:{$@spelldesc280559=Your spells and abilities have a chance to release a barrage of lasers, dealing {$s1=4508} Arcane damage split among all enemies and restoring {$s2=5635} health split among injured allies. Enables $@spellname280573 within Uldir.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18900.00
  • base_dd_max:18900.00
 
Lava Lash 1372 8.0% 54.5 5.23sec 7558 6605 Direct 54.5 5958 11914 7558 26.9% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.48 54.48 0.00 0.00 1.1444 0.0000 411759.09 411759.09 0.00 6604.63 6604.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.84 73.13% 5957.79 5827 6637 5958.55 5858 6133 237362 237362 0.00
crit 14.64 26.87% 11913.67 11654 13273 11915.12 11678 12603 174397 174397 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Lightning Shield 627 3.7% 221.7 1.96sec 847 0 Direct 220.7 670 1340 851 26.9% 0.0%  

Stats details: lightning_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 221.72 220.72 0.00 0.00 0.0000 0.0000 187769.14 187769.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.26 73.06% 670.21 647 737 670.46 655 692 108076 108076 0.00
crit 59.46 26.94% 1340.32 1295 1475 1340.85 1301 1391 79694 79694 0.00
 
 

Action details: lightning_shield

Static Values
  • id:273324
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:273324
  • name:Lightning Shield
  • school:nature
  • tooltip:
  • description:{$@spelldesc192106=Surround yourself with a shield of lightning for {$d=3600 seconds}. Melee attackers have a chance to suffer {$192109s1=0} Nature damage, and add a charge to your shield. When you Stormstrike, it gains {$s1=2} charges. At {$192106u=20} charges, the shield overcharges, causing you to deal {$273324s1=0} Nature damage with each attack and generate ${{$273323s2=10}*10} Maelstrom over {$273323d=10 seconds}.}
 
main_hand 1363 8.0% 136.3 2.21sec 3003 1543 Direct 136.3 2785 5568 3003 26.8% 19.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.34 136.34 0.00 0.00 1.9458 0.0000 409406.56 585295.84 30.05 1543.28 1543.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.91 54.21% 2785.16 2730 3114 2785.57 2756 2836 205860 294301 30.05
crit 36.55 26.81% 5568.48 5460 6229 5569.31 5492 5719 203547 290995 30.05
miss 25.87 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
offhand 680 4.0% 136.1 2.21sec 1501 769 Direct 136.1 1392 2784 1501 26.8% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.09 136.09 0.00 0.00 1.9510 0.0000 204286.58 292052.20 30.05 769.41 769.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.77 54.21% 1392.35 1365 1557 1392.54 1376 1422 102712 146839 30.05
crit 36.49 26.81% 2783.85 2730 3114 2784.26 2747 2884 101575 145213 30.05
miss 25.83 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Rockbiter 1007 5.9% 63.5 4.75sec 4753 4187 Direct 63.5 3752 7499 4753 26.7% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.53 63.53 0.00 0.00 1.1353 0.0000 301993.55 301993.55 0.00 4186.91 4186.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.56 73.28% 3752.28 3646 4152 3753.11 3693 3827 174701 174701 0.00
crit 16.97 26.72% 7499.23 7291 8304 7500.74 7322 7906 127292 127292 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormstrike 0 (4973) 0.0% (29.0%) 81.3 3.65sec 18359 16008

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.31 0.00 0.00 0.00 1.1469 0.0000 0.00 0.00 0.00 16007.91 16007.91
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:9.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:azerite.lightning_conduit.enabled&!debuff.lightning_conduit.up&active_enemies>1&(buff.stormbringer.up|(variable.OCPool70&variable.furyCheck35))
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 3314 19.3% 81.3 3.65sec 12237 0 Direct 81.3 9651 19264 12237 26.9% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.31 81.31 0.00 0.00 0.0000 0.0000 994970.03 1422429.14 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.44 73.10% 9651.26 6171 17571 9644.37 7387 12834 573656 820110 30.05
crit 21.87 26.90% 19264.25 12343 35143 19259.61 13240 26729 421314 602319 30.05
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Stormstrike Off-Hand 1658 9.7% 81.3 3.65sec 6122 0 Direct 81.3 4822 9652 6122 26.9% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.31 81.31 0.00 0.00 0.0000 0.0000 497799.15 711663.66 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.42 73.08% 4822.04 3086 8786 4818.46 3664 6511 286514 409606 30.05
crit 21.89 26.92% 9651.63 6171 17571 9644.73 6741 13509 211285 302058 30.05
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Sundering 654 3.8% 7.4 41.92sec 26434 23301 Direct 7.4 20861 41711 26434 26.7% 0.0%  

Stats details: sundering

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.43 7.43 0.00 0.00 1.1345 0.0000 196288.19 196288.19 0.00 23301.07 23301.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 73.27% 20861.42 20201 23007 20865.50 0 23007 113501 113501 0.00
crit 1.98 26.73% 41710.76 40402 46013 37446.68 0 46013 82787 82787 0.00
 
 

Action details: sundering

Static Values
  • id:197214
  • school:flamestrike
  • resource:maelstrom
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:40.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.
 
Windfury Attack 325 1.9% 119.6 4.94sec 814 0 Direct 119.6 642 1284 814 26.8% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.58 119.58 0.00 0.00 0.0000 0.0000 97383.01 139220.71 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.52 73.19% 642.29 621 707 642.50 628 662 56212 80362 30.05
crit 32.06 26.81% 1284.09 1241 1414 1284.53 1249 1355 41171 58859 30.05
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=25}% chance to trigger two extra attacks, dealing $25504sw1 Physical damage each.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Windlash 341 2.0% 18.4 11.24sec 5498 3777 Direct 18.4 4355 8708 5498 26.3% 0.0%  

Stats details: windlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.37 18.37 0.00 0.00 1.4556 0.0000 101027.73 101027.73 0.00 3777.44 3777.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.55 73.73% 4354.74 3903 4452 4353.93 4030 4436 59000 59000 0.00
crit 4.83 26.27% 8708.46 7806 8905 8676.61 0 8905 42028 42028 0.00
 
 

Action details: windlash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Windlash Off-Hand 169 1.0% 18.1 11.38sec 2752 1890 Direct 18.1 2177 4353 2752 26.4% 0.0%  

Stats details: windlash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.13 18.13 0.00 0.00 1.4557 0.0000 49894.25 49894.25 0.00 1890.36 1890.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.34 73.58% 2177.10 1952 2226 2176.86 2001 2218 29047 29047 0.00
crit 4.79 26.42% 4352.65 3903 4452 4335.63 0 4452 20847 20847 0.00
 
 

Action details: windlash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Windstrike 0 (1729) 0.0% (9.9%) 17.8 11.56sec 28675 29945

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.84 0.00 0.00 0.00 0.9576 0.0000 0.00 0.00 0.00 29944.81 29944.81
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:9.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 1153 6.6% 17.8 11.56sec 19123 0 Direct 17.8 15142 30266 19124 26.3% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.84 17.84 0.00 0.00 0.0000 0.0000 341108.65 341108.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.14 73.67% 15141.70 8823 25121 15055.05 9622 22683 198967 198967 0.00
crit 4.70 26.33% 30265.87 17646 50241 29922.37 0 50241 142142 142142 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Windstrike Off-Hand 576 3.3% 17.8 11.56sec 9552 0 Direct 17.8 7572 15124 9552 26.2% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.84 17.84 0.00 0.00 0.0000 0.0000 170378.61 170378.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.16 73.78% 7572.49 4411 12560 7531.95 4798 11289 99659 99659 0.00
crit 4.68 26.22% 15123.65 8823 25121 14971.78 0 25121 70719 70719 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - greater_earth_elemental 288 / 69
melee 288 0.4% 54.2 3.38sec 385 290 Direct 54.2 304 607 385 26.8% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.18 54.18 0.00 0.00 1.3269 0.0000 20862.61 29825.60 30.05 290.22 290.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.63 73.15% 303.74 290 330 304.13 297 312 12037 17209 30.05
crit 14.55 26.85% 606.72 580 661 607.43 583 645 8825 12617 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - spirit_wolf 2156 / 316
melee 2156 1.8% 81.5 6.28sec 1154 1120 Direct 81.5 915 1827 1154 26.2% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.51 81.51 0.00 0.00 1.0307 0.0000 94056.01 134464.36 30.05 1119.54 1119.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.18 73.83% 915.14 862 982 915.44 898 951 55075 78736 30.05
crit 21.33 26.17% 1827.27 1724 1963 1827.98 1752 1930 38981 55729 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
T22_Shaman_Enhancement
Ascendance 2.0 181.77sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9959 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.strike.remains>0
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=66}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Shaman_Enhancement
  • harmful:false
  • if_expr:
 
Berserking 2.0 191.61sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Earth Elemental 1.5 300.45sec

Stats details: earth_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: earth_elemental

Static Values
  • id:188616
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:188616
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:{$@spelldesc198103=Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}.}
 
Feral Spirit 3.0 120.43sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.1012 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Shaman_Enhancement
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Shaman_Enhancement
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Wind Shear 11.4 27.18sec

Stats details: wind_shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wind_shear

Static Values
  • id:57994
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57994
  • name:Wind Shear
  • school:nature
  • tooltip:
  • description:Disrupts the target's concentration with a burst of wind, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.8sec 181.8sec 10.14% 94.51% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=66}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Battle Potion of Agility 2.0 0.0 194.7sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 191.6sec 191.6sec 6.74% 7.55% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Deadly Navigation 6.2 23.1 52.2sec 10.4sec 68.91% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_deadly_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:50.00

Stack Uptimes

  • deadly_navigation_1:18.05%
  • deadly_navigation_2:17.48%
  • deadly_navigation_3:16.86%
  • deadly_navigation_4:16.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268905
  • name:Deadly Navigation
  • tooltip:Increases Critical Strike by $w1.
  • description:{$@spelldesc268907=Permanently enchant a weapon to sometimes increase Critical Strike by $268905s for {$268905d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268904s Critical Strike for {$268904d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Deadly Navigation (_final) 5.5 0.0 52.3sec 52.3sec 18.08% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_deadly_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:600.00

Stack Uptimes

  • deadly_navigation_final_1:18.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268904
  • name:Deadly Navigation
  • tooltip:Increases Critical Strike by $w1.
  • description:{$@spelldesc268907=Permanently enchant a weapon to sometimes increase Critical Strike by $268905s for {$268905d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268904s Critical Strike for {$268904d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Earthlink 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_earthlink
  • max_stacks:6
  • duration:900.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:agility
  • amount:24.00

Stack Uptimes

  • earthlink_1:16.67%
  • earthlink_2:16.67%
  • earthlink_3:16.67%
  • earthlink_4:16.67%
  • earthlink_5:16.67%
  • earthlink_6:16.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279928
  • name:Earthlink
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by $w1.
  • description:{$@spelldesc279926=Azerite energy courses through you, reaching ${{$s1=11}*6} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] and then diminishing down to {$s1=11} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat], cycling every 6 sec.}
  • max_stacks:6
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Flametongue 1.1 27.9 101.8sec 10.5sec 99.51% 99.52% 27.9(27.9) 0.1

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • flametongue_1:99.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=0} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 5.0 12.1 64.1sec 17.3sec 75.48% 0.00% 0.0(0.0) 0.6

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:27.44%
  • frothing_rage_2:25.15%
  • frothing_rage_3:22.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Landslide 9.6 3.1 30.6sec 22.7sec 37.38% 39.02% 3.1(3.1) 9.2

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • landslide_1:37.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Your next Stormstrike will deal {$s1=100}% increased damage.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] has a {$h=20}% chance to increase the damage of your next Stormstrike by {$202004s1=100}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Lightning Shield 10.5 198.3 29.8sec 1.4sec 100.00% 100.00% 9.5(9.5) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_lightning_shield
  • max_stacks:20
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lightning_shield_1:10.72%
  • lightning_shield_3:9.94%
  • lightning_shield_5:10.00%
  • lightning_shield_7:10.07%
  • lightning_shield_9:10.06%
  • lightning_shield_11:10.01%
  • lightning_shield_13:9.86%
  • lightning_shield_15:9.85%
  • lightning_shield_17:9.77%
  • lightning_shield_19:9.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192106
  • name:Lightning Shield
  • tooltip:Chance to deal {$192109s1=0} Nature damage when you take melee damage.
  • description:Surround yourself with a shield of lightning for {$d=3600 seconds}. Melee attackers have a chance to suffer {$192109s1=0} Nature damage, and add a charge to your shield. When you Stormstrike, it gains {$s1=2} charges. At {$192106u=20} charges, the shield overcharges, causing you to deal {$273324s1=0} Nature damage with each attack and generate ${{$273323s2=10}*10} Maelstrom over {$273323d=10 seconds}.
  • max_stacks:20
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Lightning Shield Overcharge 9.5 0.0 31.3sec 31.3sec 31.10% 33.76% 93.1(93.1) 9.2

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_lightning_shield_overcharge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stack Uptimes

  • lightning_shield_overcharge_1:31.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:273323
  • name:Lightning Shield Overcharge
  • tooltip:Melee attacks are causing an extra {$273324s1=0} Nature damage to the target. Generating {$s2=10} Maelstrom every $t2 sec.
  • description:{$@spelldesc192106=Surround yourself with a shield of lightning for {$d=3600 seconds}. Melee attackers have a chance to suffer {$192109s1=0} Nature damage, and add a charge to your shield. When you Stormstrike, it gains {$s1=2} charges. At {$192106u=20} charges, the shield overcharges, causing you to deal {$273324s1=0} Nature damage with each attack and generate ${{$273323s2=10}*10} Maelstrom over {$273323d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Natural Harmony: Fire 1.0 716.9 0.0sec 0.4sec 99.58% 0.00% 716.9(716.9) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_natural_harmony_fire
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:88.00

Stack Uptimes

  • natural_harmony_fire_1:99.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279028
  • name:Natural Harmony: Fire
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc278697=Dealing Fire damage grants {$s1=0} critical strike for {$279028d=12 seconds}. Dealing Frost damage grants {$s2=0} mastery for {$279029d=12 seconds}. Dealing Nature damage grants {$s3=0} haste for {$279033d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Natural Harmony: Nature 1.0 283.2 0.0sec 1.0sec 100.00% 0.00% 283.2(283.2) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_natural_harmony_nature
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:88.00

Stack Uptimes

  • natural_harmony_nature_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279033
  • name:Natural Harmony: Nature
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc278697=Dealing Fire damage grants {$s1=0} critical strike for {$279028d=12 seconds}. Dealing Frost damage grants {$s2=0} mastery for {$279029d=12 seconds}. Dealing Nature damage grants {$s3=0} haste for {$279033d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.9 0.0 59.4sec 37.3sec 37.90% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.48%
  • overwhelming_power_2:1.49%
  • overwhelming_power_3:1.50%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.51%
  • overwhelming_power_6:1.51%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.52%
  • overwhelming_power_10:1.53%
  • overwhelming_power_11:1.53%
  • overwhelming_power_12:1.54%
  • overwhelming_power_13:1.54%
  • overwhelming_power_14:1.55%
  • overwhelming_power_15:1.55%
  • overwhelming_power_16:1.56%
  • overwhelming_power_17:1.56%
  • overwhelming_power_18:1.57%
  • overwhelming_power_19:1.57%
  • overwhelming_power_20:1.58%
  • overwhelming_power_21:1.58%
  • overwhelming_power_22:1.59%
  • overwhelming_power_23:1.60%
  • overwhelming_power_24:1.63%
  • overwhelming_power_25:0.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.1sec 10.4sec 68.95% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.98%
  • quick_navigation_2:17.59%
  • quick_navigation_3:16.96%
  • quick_navigation_4:16.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.08% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 41.1 2.7 7.1sec 6.7sec 14.24% 41.06% 4.0(4.1) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stormbringer_1:14.24%

Trigger Attempt Success

  • trigger_pct:96.99%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown, deals {$s4=25}% increased damage, and its cost is reduced by {$s3=100}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to deal {$201846s4=25}% increased damage, cost {$201846s3=100}% less Maelstrom, and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Titanic Overcharge 12.2 33.1 25.1sec 6.6sec 85.43% 0.00% 3.6(3.6) 11.4

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:40.51

Stack Uptimes

  • titanic_overcharge_1:23.07%
  • titanic_overcharge_2:16.83%
  • titanic_overcharge_3:12.32%
  • titanic_overcharge_4:8.96%
  • titanic_overcharge_5:6.59%
  • titanic_overcharge_6:4.81%
  • titanic_overcharge_7:3.47%
  • titanic_overcharge_8:9.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=36} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Flametongue: Windfury Attack 119.0 5.0sec
Lightning Shield Overcharge: Windfury Attack 41.4 13.2sec
Maelstrom Weapon: Windfury Attack 119.6 5.0sec
Stormbringer: Windfury Attack 7.5 35.5sec
Flametongue: main_hand 109.6 2.7sec
Lightning Shield Overcharge: main_hand 33.7 8.1sec
Maelstrom Weapon: main_hand 110.5 2.7sec
Stormbringer: main_hand 7.0 36.0sec
Windfury: main_hand 29.0 10.0sec
Flametongue: Windlash 18.3 11.3sec
Lightning Shield Overcharge: Windlash 6.2 30.9sec
Maelstrom Weapon: Windlash 18.4 11.2sec
Stormbringer: Windlash 1.1 81.2sec
Windfury: Windlash 4.8 42.9sec
Flametongue: offhand 109.4 2.7sec
Lightning Shield Overcharge: offhand 33.7 8.1sec
Maelstrom Weapon: offhand 110.3 2.7sec
Stormbringer: offhand 6.9 36.2sec
Flametongue: Windlash Off-Hand 18.0 11.5sec
Lightning Shield Overcharge: Windlash Off-Hand 6.2 30.5sec
Maelstrom Weapon: Windlash Off-Hand 18.1 11.4sec
Stormbringer: Windlash Off-Hand 1.1 83.6sec
Stormbringer: Rockbiter 4.0 55.1sec
Lightning Shield Overcharge: Windstrike 7.1 28.1sec
Flametongue: Windstrike 17.7 11.6sec
Stormbringer: Windstrike 1.1 73.9sec
Windfury: Windstrike 4.7 43.5sec
Flametongue: Windstrike Off-Hand 17.7 11.6sec
Lightning Shield Overcharge: Windstrike Off-Hand 7.1 28.1sec
Stormbringer: Windstrike Off-Hand 1.1 75.6sec
Stormbringer: Flametongue 1.8 80.3sec
Lightning Shield Overcharge: Sundering 2.2 82.5sec
Lightning Shield Overcharge: Stormstrike 32.1 8.5sec
Flametongue: Stormstrike 81.3 3.7sec
Stormbringer: Stormstrike 5.1 43.7sec
Windfury: Stormstrike 21.3 13.2sec
Flametongue: Stormstrike Off-Hand 81.3 3.7sec
Lightning Shield Overcharge: Stormstrike Off-Hand 32.1 8.5sec
Stormbringer: Stormstrike Off-Hand 5.0 43.6sec
Flametongue: Lava Lash 54.5 5.2sec
Lightning Shield Overcharge: Lava Lash 19.0 14.4sec
Stormbringer: Lava Lash 3.4 58.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Wind Shear15.3750.00136.621158.232115.946220.587
Rockbiter1.2090.0017.86617.2930.31052.240
Windstrike1.1790.0013.71714.2851.99329.369
Flametongue1.6360.00120.90640.98211.55682.079
Feral Spirit0.5700.0013.1880.8590.0004.744
Ascendance2.0750.00135.1361.7710.00035.136
Sundering2.2150.00141.03812.3620.55060.981
Stormstrike1.3660.0018.042106.05442.965184.579

Resources

Resource Usage Type Count Total Average RPE APR
T22_Shaman_Enhancement
lava_lash Maelstrom 54.5 2179.2 40.0 40.0 189.0
stormstrike Maelstrom 81.3 1371.5 16.9 16.9 1088.5
sundering Maelstrom 7.4 148.5 20.0 20.0 1321.7
windstrike Maelstrom 17.8 127.2 7.1 7.1 4020.5
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 119.58 478.29 (12.32%) 4.00 119.60 20.00%
Main Hand Maelstrom 110.47 493.16 (12.70%) 4.46 59.17 10.71%
Windlash Maelstrom 18.37 46.88 (1.21%) 2.55 44.99 48.97%
Off-Hand Maelstrom 110.26 486.86 (12.54%) 4.42 64.42 11.68%
Windlash Off-Hand Maelstrom 18.13 43.91 (1.13%) 2.42 46.74 51.56%
Rockbiter Maelstrom 63.53 1355.76 (34.91%) 21.34 232.55 14.64%
Feral Spirit Maelstrom 81.51 273.87 (7.05%) 3.36 133.70 32.80%
mana_regen Mana 194.01 0.00 (0.00%) 0.00 190832.24 100.00%
Lightning Shield Overcharge Maelstrom 93.07 704.74 (18.15%) 7.57 225.96 24.28%
Resource RPS-Gain RPS-Loss
Maelstrom 12.95 12.75
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Maelstrom 57.23 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T22_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Shaman_Enhancement Damage Per Second
Count 7499
Mean 17176.82
Minimum 14329.17
Maximum 20893.48
Spread ( max - min ) 6564.31
Range [ ( max - min ) / 2 * 100% ] 19.11%
Standard Deviation 904.9022
5th Percentile 15762.34
95th Percentile 18737.59
( 95th Percentile - 5th Percentile ) 2975.24
Mean Distribution
Standard Deviation 10.4496
95.00% Confidence Intervall ( 17156.34 - 17197.30 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10662
0.1 Scale Factor Error with Delta=300 6991
0.05 Scale Factor Error with Delta=300 27961
0.01 Scale Factor Error with Delta=300 699016
Priority Target DPS
Sample Data T22_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 17176.82
Minimum 14329.17
Maximum 20893.48
Spread ( max - min ) 6564.31
Range [ ( max - min ) / 2 * 100% ] 19.11%
Standard Deviation 904.9022
5th Percentile 15762.34
95th Percentile 18737.59
( 95th Percentile - 5th Percentile ) 2975.24
Mean Distribution
Standard Deviation 10.4496
95.00% Confidence Intervall ( 17156.34 - 17197.30 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10662
0.1 Scale Factor Error with Delta=300 6991
0.05 Scale Factor Error with Delta=300 27961
0.01 Scale Factor Error with Delta=300 699016
DPS(e)
Sample Data T22_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 17176.82
Minimum 14329.17
Maximum 20893.48
Spread ( max - min ) 6564.31
Range [ ( max - min ) / 2 * 100% ] 19.11%
Damage
Sample Data T22_Shaman_Enhancement Damage
Count 7499
Mean 5028252.13
Minimum 3554462.32
Maximum 6567852.13
Spread ( max - min ) 3013389.81
Range [ ( max - min ) / 2 * 100% ] 29.96%
DTPS
Sample Data T22_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
6 11.44 wind_shear
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck35,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>35))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool80,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>80)))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>70)))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>60)))
7 1.00 auto_attack
0.00 use_items
8 0.00 call_action_list,name=opener
9 0.00 call_action_list,name=asc,if=buff.ascendance.up
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=cds
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.asc
# count action,conditions
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
E 5.24 rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
F 17.84 windstrike
actions.buffs
# count action,conditions
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
G 20.27 rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
0.00 fury_of_air,if=!ticking&maelstrom>=20
H 1.09 flametongue,if=!buff.flametongue.up
0.00 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck25
I 2.17 flametongue,if=buff.flametongue.remains<4.8+gcd
0.00 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8+gcd&variable.furyCheck25
0.00 totem_mastery,if=buff.resonance_totem.remains<2
actions.cds
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
J 2.00 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
K 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
L 2.97 feral_spirit
M 2.00 ascendance,if=cooldown.strike.remains>0
N 1.47 earth_elemental
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 sundering,if=active_enemies>=3
0.00 stormstrike,cycle_targets=1,if=azerite.lightning_conduit.enabled&!debuff.lightning_conduit.up&active_enemies>1&(buff.stormbringer.up|(variable.OCPool70&variable.furyCheck35))
O 35.57 stormstrike,if=buff.stormbringer.up|(buff.gathering_storms.up&variable.OCPool70&variable.furyCheck35)
0.00 crash_lightning,if=active_enemies>=3&variable.furyCheck25
0.00 lightning_bolt,if=talent.overcharge.enabled&active_enemies=1&variable.furyCheck45&maelstrom>=40
P 45.74 stormstrike,if=variable.OCPool70&variable.furyCheck35
Q 7.43 sundering
0.00 crash_lightning,if=talent.forceful_winds.enabled&active_enemies>1&variable.furyCheck25
R 25.74 flametongue,if=talent.searing_assault.enabled
0.00 lava_lash,if=buff.hot_hand.react
0.00 crash_lightning,if=active_enemies>1&variable.furyCheck25
actions.filler
# count action,conditions
S 37.02 rockbiter,if=maelstrom<70
0.00 crash_lightning,if=talent.crashing_storm.enabled&variable.OCPool60
T 54.48 lava_lash,if=variable.OCPool80&variable.furyCheck45
0.00 rockbiter
0.00 flametongue
actions.opener
# count action,conditions
U 1.00 rockbiter,if=maelstrom<15&time<gcd

Sample Sequence

012457UH6LGJNOPMEFFFFFFFFIFQFEFTEFRTTGPSTSRTPSTTSPRST6PSRTSOPSTTQRPSTSTTSOOPRSTTSP6TRSTSPTSRTSPQSRTSOPSRTPS6TTSRPTLTSTPOOOGPITGOPQTSOPRGTTSP6TOPRGTSTPSTR6SOPTSTRSPTSQPMFF6EFFFFEFFEFHOPGT6OPGROPGOPGTRSQPST6TSROPOPSTTRSKPTLJOPTRT6STOOGOPGRTSOP6QSTOPRTGTTGPTRSTSPTSTOPRSTSPR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Shaman_Enhancement 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom
Pre precombat 1 food T22_Shaman_Enhancement 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom
Pre precombat 2 augmentation T22_Shaman_Enhancement 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom battle_potion_of_agility
Pre precombat 5 lightning_shield Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom battle_potion_of_agility
0:00.000 default 7 auto_attack Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom battle_potion_of_agility
0:00.000 opener U rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom quick_navigation, deadly_navigation, titanic_overcharge, battle_potion_of_agility
0:01.248 buffs H flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom bloodlust, natural_harmony_nature, quick_navigation, deadly_navigation, overwhelming_power(24), titanic_overcharge, battle_potion_of_agility
0:02.134 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, flametongue, quick_navigation, deadly_navigation, overwhelming_power(23), titanic_overcharge, battle_potion_of_agility
0:02.134 cds L feral_spirit Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, flametongue, quick_navigation, deadly_navigation, overwhelming_power(23), titanic_overcharge, battle_potion_of_agility
0:03.022 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, flametongue, quick_navigation, deadly_navigation, overwhelming_power(22), titanic_overcharge, battle_potion_of_agility
0:03.913 cds J berserking Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, quick_navigation, deadly_navigation, overwhelming_power(22), titanic_overcharge(2), battle_potion_of_agility
0:03.913 cds N earth_elemental Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, quick_navigation, deadly_navigation, overwhelming_power(22), titanic_overcharge(2), battle_potion_of_agility
0:03.913 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, quick_navigation, deadly_navigation, overwhelming_power(22), titanic_overcharge(2), battle_potion_of_agility
0:04.685 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, flametongue, quick_navigation, deadly_navigation, overwhelming_power(21), titanic_overcharge(3), battle_potion_of_agility
0:05.456 cds M ascendance Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, flametongue, quick_navigation, deadly_navigation, overwhelming_power(20), titanic_overcharge(3), battle_potion_of_agility
0:06.229 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, quick_navigation, deadly_navigation, overwhelming_power(19), titanic_overcharge(3), battle_potion_of_agility
0:07.005 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, landslide, quick_navigation, deadly_navigation, overwhelming_power(18), titanic_overcharge(3), battle_potion_of_agility
0:07.781 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, landslide, stormbringer, quick_navigation, deadly_navigation, overwhelming_power(18), titanic_overcharge(3), battle_potion_of_agility
0:08.559 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, landslide, quick_navigation, deadly_navigation, overwhelming_power(17), titanic_overcharge(3), battle_potion_of_agility
0:09.338 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, landslide, stormbringer, quick_navigation, deadly_navigation, overwhelming_power(16), titanic_overcharge(4), battle_potion_of_agility
0:10.116 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, landslide, quick_navigation(2), deadly_navigation, overwhelming_power(15), titanic_overcharge(4), battle_potion_of_agility
0:10.889 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, landslide, stormbringer, quick_navigation(2), deadly_navigation, overwhelming_power(15), titanic_overcharge(4), battle_potion_of_agility
0:11.663 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, landslide, stormbringer, quick_navigation(2), deadly_navigation, overwhelming_power(14), titanic_overcharge(4), battle_potion_of_agility
0:12.440 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, landslide, quick_navigation(2), deadly_navigation(2), overwhelming_power(13), titanic_overcharge(4), battle_potion_of_agility
0:13.219 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, quick_navigation(2), deadly_navigation(2), overwhelming_power(12), titanic_overcharge(4), battle_potion_of_agility
0:14.001 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, quick_navigation(3), deadly_navigation(2), overwhelming_power(11), titanic_overcharge(4), battle_potion_of_agility
0:14.932 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, quick_navigation(3), deadly_navigation(2), overwhelming_power(11), titanic_overcharge(5), battle_potion_of_agility
0:15.825 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, quick_navigation(3), deadly_navigation(2), overwhelming_power(10), titanic_overcharge(5), battle_potion_of_agility
0:16.745 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(9), titanic_overcharge(5), battle_potion_of_agility
0:17.643 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(8), titanic_overcharge(5), battle_potion_of_agility
0:18.574 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(7), titanic_overcharge(5), battle_potion_of_agility
0:19.476 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(6), titanic_overcharge(5), battle_potion_of_agility
0:20.382 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(5), titanic_overcharge(5), battle_potion_of_agility
0:21.291 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(4), titanic_overcharge(5), battle_potion_of_agility
0:22.200 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(3), titanic_overcharge(5), battle_potion_of_agility
0:23.113 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation(3), deadly_navigation(3), overwhelming_power(2), titanic_overcharge(6)
0:24.024 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation(3), deadly_navigation(3), overwhelming_power, titanic_overcharge(6)
0:24.936 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation(3), deadly_navigation(3), overwhelming_power, titanic_overcharge(6)
0:25.851 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(3), deadly_navigation(3), titanic_overcharge(7)
0:26.765 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(3), titanic_overcharge(7)
0:27.678 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(3), titanic_overcharge(7)
0:28.590 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(3), titanic_overcharge(7)
0:29.500 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(3), titanic_overcharge(7)
0:30.413 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(3), titanic_overcharge(8)
0:31.320 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(3), titanic_overcharge(8)
0:32.225 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(3), titanic_overcharge(8)
0:33.130 Waiting     1.300 sec 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(3), titanic_overcharge(8)
0:34.430 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(3), titanic_overcharge(8)
0:35.333 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), titanic_overcharge(8)
0:36.238 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), titanic_overcharge(8)
0:37.141 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), titanic_overcharge(8)
0:38.044 Waiting     0.200 sec 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), titanic_overcharge(8)
0:38.244 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), titanic_overcharge(8)
0:39.380 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), titanic_overcharge(8)
0:40.283 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4)
0:40.283 Waiting     1.400 sec 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4)
0:41.683 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4)
0:43.147 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(23)
0:44.287 Waiting     0.900 sec 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation(4), overwhelming_power(22)
0:45.187 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation(4), overwhelming_power(21)
0:46.486 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(4), overwhelming_power(20), titanic_overcharge
0:47.582 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(4), overwhelming_power(18), titanic_overcharge
0:48.682 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation_final, deadly_navigation(4), overwhelming_power(17), titanic_overcharge
0:49.787 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(4), overwhelming_power(16), titanic_overcharge
0:50.894 Waiting     0.300 sec 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(4), overwhelming_power(15), titanic_overcharge(2)
0:51.194 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(4), overwhelming_power(14), titanic_overcharge(2)
0:52.481 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation_final, overwhelming_power(12), titanic_overcharge(2)
0:53.597 Waiting     0.200 sec 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation_final, overwhelming_power(10), titanic_overcharge(3)
0:53.797 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation_final, overwhelming_power(10), titanic_overcharge(3)
0:54.913 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation_final, overwhelming_power(9), titanic_overcharge(4)
0:56.047 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), deadly_navigation_final, overwhelming_power(7), titanic_overcharge(4)
0:57.246 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), deadly_navigation_final, overwhelming_power(6), titanic_overcharge(4)
0:58.449 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), deadly_navigation_final, overwhelming_power(5), titanic_overcharge(5)
0:59.646 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), deadly_navigation_final, overwhelming_power(4), titanic_overcharge(5)
1:00.849 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, landslide, frothing_rage(2), deadly_navigation_final, overwhelming_power(3), titanic_overcharge(6)
1:02.050 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage(2), quick_navigation, overwhelming_power, titanic_overcharge(6)
1:03.252 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage(2), quick_navigation, titanic_overcharge(7)
1:04.451 Waiting     0.700 sec 20000.0/20000: 100% mana | 10.0/100: 10% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage(2), quick_navigation, titanic_overcharge(7)
1:05.151 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 10.0/100: 10% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage(2), quick_navigation, titanic_overcharge(7)
1:06.592 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, stormbringer, frothing_rage(2), quick_navigation(3), deadly_navigation, titanic_overcharge(7)
1:07.778 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, stormbringer, frothing_rage(2), quick_navigation(3), deadly_navigation, titanic_overcharge(7)
1:08.966 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(2), quick_navigation(3), deadly_navigation, titanic_overcharge(7)
1:10.152 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(2), quick_navigation(3), deadly_navigation, titanic_overcharge(7)
1:11.336 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(2), quick_navigation(3), deadly_navigation, titanic_overcharge(7)
1:12.521 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation
1:13.747 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation(2), overwhelming_power(24), titanic_overcharge
1:14.886 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation(2), overwhelming_power(23), titanic_overcharge
1:16.027 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation(2), overwhelming_power(21), titanic_overcharge
1:17.174 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation(2), overwhelming_power(20), titanic_overcharge
1:17.174 Waiting     1.400 sec 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation(2), overwhelming_power(20), titanic_overcharge
1:18.574 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(19), titanic_overcharge(2)
1:19.724 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(18), titanic_overcharge(2)
1:20.878 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(4), deadly_navigation(2), overwhelming_power(17), titanic_overcharge(2)
1:22.026 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(4), deadly_navigation(3), overwhelming_power(15), titanic_overcharge(2)
1:23.183 Waiting     0.500 sec 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(4), deadly_navigation(3), overwhelming_power(14), titanic_overcharge(3)
1:23.683 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, quick_navigation(4), deadly_navigation(4), overwhelming_power(14), titanic_overcharge(3)
1:25.078 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, quick_navigation(4), deadly_navigation(4), overwhelming_power(12), titanic_overcharge(3)
1:26.238 Waiting     0.300 sec 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(4), deadly_navigation_final, overwhelming_power(11), titanic_overcharge(3)
1:26.538 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(11), titanic_overcharge(3)
1:27.651 Waiting     0.600 sec 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(10), titanic_overcharge(3)
1:28.251 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(9), titanic_overcharge(3)
1:29.581 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(8), titanic_overcharge(3)
1:30.703 Waiting     0.600 sec 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(7), titanic_overcharge(3)
1:31.303 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(6), titanic_overcharge(3)
1:32.431 Waiting     0.300 sec 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(5), titanic_overcharge(3)
1:32.731 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(5)
1:34.101 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(3)
1:35.256 Waiting     1.000 sec 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation_final, overwhelming_power(2), titanic_overcharge
1:36.256 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation_final, deadly_navigation(2), overwhelming_power, titanic_overcharge
1:37.410 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, deadly_navigation(2), titanic_overcharge
1:38.865 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, deadly_navigation(2), titanic_overcharge
1:40.107 Waiting     0.500 sec 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, deadly_navigation(2), titanic_overcharge
1:40.607 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, deadly_navigation(2), titanic_overcharge
1:41.847 Waiting     0.500 sec 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, deadly_navigation(3), titanic_overcharge
1:42.347 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, deadly_navigation(3), titanic_overcharge
1:43.817 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, stormbringer, frothing_rage, quick_navigation, deadly_navigation(3), titanic_overcharge
1:45.052 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(3), titanic_overcharge
1:46.278 Waiting     1.000 sec 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(3)
1:47.278 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(3), titanic_overcharge
1:48.713 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(3), titanic_overcharge
1:49.939 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(3), titanic_overcharge
1:51.164 Waiting     1.000 sec 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(4), titanic_overcharge
1:52.164 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(4), titanic_overcharge
1:53.621 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(4), titanic_overcharge
1:54.848 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(4), titanic_overcharge
1:54.848 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(4), titanic_overcharge
1:56.075 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(4), titanic_overcharge(2)
1:57.295 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(4), titanic_overcharge(2)
1:58.516 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation_final, titanic_overcharge(2)
1:59.736 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation_final, titanic_overcharge(2)
2:00.957 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation_final, titanic_overcharge(3)
2:02.173 cds L feral_spirit Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation_final, titanic_overcharge(3)
2:03.388 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage, quick_navigation(2), deadly_navigation_final, titanic_overcharge(3)
2:04.602 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage, quick_navigation(2), deadly_navigation_final, titanic_overcharge(3)
2:05.817 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage, quick_navigation(2), deadly_navigation_final, overwhelming_power(24), titanic_overcharge(3)
2:06.950 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage, quick_navigation(2), deadly_navigation_final, overwhelming_power(23), titanic_overcharge(3)
2:08.088 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation, overwhelming_power(21), titanic_overcharge(3)
2:09.224 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation, overwhelming_power(20), titanic_overcharge(3)
2:10.365 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, stormbringer, frothing_rage, quick_navigation(4), deadly_navigation(2), overwhelming_power(19), titanic_overcharge(3)
2:11.501 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(2), overwhelming_power(18)
2:12.659 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(2), overwhelming_power(17)
2:13.819 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation(3), overwhelming_power(16), titanic_overcharge
2:14.976 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(3), overwhelming_power(15), titanic_overcharge
2:16.086 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(3), overwhelming_power(13), titanic_overcharge
2:17.204 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation_final, deadly_navigation(3), overwhelming_power(12), titanic_overcharge
2:18.323 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(3), overwhelming_power(10), titanic_overcharge
2:19.449 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(3), overwhelming_power(9), titanic_overcharge
2:20.577 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(3), overwhelming_power(8), titanic_overcharge
2:21.709 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(3), overwhelming_power(7), titanic_overcharge
2:22.845 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation_final, deadly_navigation(3), overwhelming_power(6)
2:23.988 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(3), overwhelming_power(5)
2:25.133 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), deadly_navigation(3), overwhelming_power(3)
2:26.371 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), deadly_navigation(3), overwhelming_power(2)
2:27.611 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), deadly_navigation(4), overwhelming_power, titanic_overcharge
2:28.848 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), deadly_navigation(4), titanic_overcharge
2:30.090 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), deadly_navigation(4), titanic_overcharge
2:31.330 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), deadly_navigation(4), titanic_overcharge
2:32.582 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), deadly_navigation(4), overwhelming_power(24), titanic_overcharge(2)
2:32.582 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, frothing_rage(3), deadly_navigation(4), overwhelming_power(24), titanic_overcharge(2)
2:33.734 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(3), deadly_navigation(4), overwhelming_power(23), titanic_overcharge(3)
2:34.885 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, landslide, frothing_rage(3), deadly_navigation(4), overwhelming_power(22), titanic_overcharge(3)
2:36.039 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(3), deadly_navigation(4), overwhelming_power(20), titanic_overcharge(3)
2:37.199 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(3), quick_navigation, deadly_navigation(4), overwhelming_power(19), titanic_overcharge(3)
2:38.356 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(3), quick_navigation, deadly_navigation(4), overwhelming_power(18), titanic_overcharge(3)
2:39.518 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(3), quick_navigation, deadly_navigation(4), overwhelming_power(17), titanic_overcharge(3)
2:40.681 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(3), quick_navigation, deadly_navigation(4), overwhelming_power(16), titanic_overcharge(3)
2:41.846 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(3), quick_navigation, deadly_navigation(4), overwhelming_power(15), titanic_overcharge(3)
2:43.016 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), quick_navigation, deadly_navigation(4), overwhelming_power(12)
2:44.212 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), quick_navigation(2), deadly_navigation(4), overwhelming_power(11)
2:45.406 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), quick_navigation(2), deadly_navigation_final, overwhelming_power(10)
2:46.603 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), quick_navigation(2), deadly_navigation_final, overwhelming_power(9)
2:46.603 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage(3), quick_navigation(2), deadly_navigation_final, overwhelming_power(9)
2:47.804 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, stormbringer, frothing_rage(3), quick_navigation(2), deadly_navigation_final, overwhelming_power(8)
2:49.007 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(3), quick_navigation(2), deadly_navigation_final, overwhelming_power(6)
2:50.218 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), quick_navigation(2), deadly_navigation_final, overwhelming_power(5)
2:51.432 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), quick_navigation(2), deadly_navigation_final, overwhelming_power(4), titanic_overcharge
2:52.645 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), quick_navigation(2), deadly_navigation_final, overwhelming_power(3), titanic_overcharge
2:53.860 Waiting     1.000 sec 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation_final, overwhelming_power(2), titanic_overcharge
2:54.860 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation_final, overwhelming_power, titanic_overcharge
2:56.263 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), quick_navigation(4), titanic_overcharge
2:57.474 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), quick_navigation(4), titanic_overcharge
2:58.687 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation(4), titanic_overcharge
2:59.899 Waiting     1.000 sec 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation(4), titanic_overcharge
3:00.899 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation(4), titanic_overcharge(2)
3:02.267 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation(4), titanic_overcharge(2)
3:03.473 Waiting     1.000 sec 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation(4), deadly_navigation, titanic_overcharge(2)
3:04.473 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation(4), deadly_navigation, titanic_overcharge(2)
3:05.909 cds M ascendance Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(3), quick_navigation_final, deadly_navigation, titanic_overcharge(2)
3:07.064 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(3), quick_navigation_final, deadly_navigation, titanic_overcharge(2)
3:08.216 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 19.8/100: 20% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, stormbringer, frothing_rage(3), quick_navigation_final, deadly_navigation, titanic_overcharge(2)
3:09.367 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 34.8/100: 35% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(3), quick_navigation_final, deadly_navigation, titanic_overcharge(2)
3:09.367 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 34.8/100: 35% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(3), quick_navigation_final, deadly_navigation, titanic_overcharge(2)
3:10.520 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 74.8/100: 75% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(3), quick_navigation_final, deadly_navigation, titanic_overcharge(2)
3:11.674 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 79.6/100: 80% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, stormbringer, quick_navigation_final, deadly_navigation
3:12.836 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 94.6/100: 95% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, quick_navigation_final, deadly_navigation
3:14.000 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, quick_navigation_final, deadly_navigation, titanic_overcharge
3:15.157 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation_final, deadly_navigation, titanic_overcharge(2)
3:16.309 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, stormbringer, frothing_rage, deadly_navigation, titanic_overcharge(2)
3:17.542 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, frothing_rage, deadly_navigation, titanic_overcharge(2)
3:18.776 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), frothing_rage, deadly_navigation, titanic_overcharge(2)
3:20.012 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), frothing_rage, deadly_navigation, titanic_overcharge(2)
3:21.291 buffs H flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), stormbringer, frothing_rage, deadly_navigation, titanic_overcharge(2)
3:22.525 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, stormbringer, frothing_rage, deadly_navigation(2), overwhelming_power(24), titanic_overcharge(2)
3:23.679 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage, quick_navigation, deadly_navigation(3), overwhelming_power(23), titanic_overcharge(2)
3:24.828 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation, deadly_navigation(3), overwhelming_power(22), titanic_overcharge(2)
3:25.980 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(3), overwhelming_power(21)
3:27.140 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, stormbringer, frothing_rage, quick_navigation(2), deadly_navigation(3), overwhelming_power(19)
3:27.140 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation(3), overwhelming_power(19)
3:28.300 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(3), overwhelming_power(18)
3:29.456 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(3), overwhelming_power(17)
3:30.617 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, deadly_navigation(3), overwhelming_power(16)
3:31.729 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation_final, deadly_navigation(3), overwhelming_power(15)
3:32.844 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, deadly_navigation(3), overwhelming_power(13), titanic_overcharge
3:33.960 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, deadly_navigation(3), overwhelming_power(12), titanic_overcharge(2)
3:35.075 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation_final, deadly_navigation(3), overwhelming_power(10), titanic_overcharge(2)
3:36.196 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, deadly_navigation(4), overwhelming_power(9), titanic_overcharge(2)
3:37.321 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation_final, deadly_navigation(4), overwhelming_power(8), titanic_overcharge(2)
3:38.449 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation_final, deadly_navigation(4), overwhelming_power(6), titanic_overcharge(2)
3:39.582 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, deadly_navigation(4), overwhelming_power(5), titanic_overcharge(2)
3:40.799 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, deadly_navigation(4), overwhelming_power(4), titanic_overcharge(2)
3:42.018 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, deadly_navigation(4), overwhelming_power(2), titanic_overcharge(2)
3:43.497 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, deadly_navigation(4), overwhelming_power, titanic_overcharge(3)
3:44.722 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, deadly_navigation(4), titanic_overcharge(3)
3:45.952 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation, deadly_navigation(4), titanic_overcharge(4)
3:47.167 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(4), titanic_overcharge(4)
3:47.167 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(4), titanic_overcharge(4)
3:48.377 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(4), titanic_overcharge(4)
3:49.580 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(4), titanic_overcharge(4)
3:50.781 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, stormbringer, frothing_rage, quick_navigation(4), deadly_navigation(4), titanic_overcharge(5)
3:51.969 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, titanic_overcharge(5)
3:53.105 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, stormbringer, frothing_rage, quick_navigation_final, deadly_navigation_final, titanic_overcharge(5)
3:54.241 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(24), titanic_overcharge(5)
3:55.309 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(23), titanic_overcharge(5)
3:56.378 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(22), titanic_overcharge(5)
3:57.450 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(21), titanic_overcharge(6)
3:58.520 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(20), titanic_overcharge(6)
3:59.592 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(19), titanic_overcharge(6)
4:00.667 cds K potion Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(18), titanic_overcharge(6)
4:00.667 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, quick_navigation_final, deadly_navigation_final, overwhelming_power(18), titanic_overcharge(6), battle_potion_of_agility
4:01.745 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, overwhelming_power(17), titanic_overcharge(7), battle_potion_of_agility
4:02.893 cds L feral_spirit Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, overwhelming_power(16), titanic_overcharge(7), battle_potion_of_agility
4:04.045 cds J berserking Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, quick_navigation, overwhelming_power(14), titanic_overcharge(7), battle_potion_of_agility
4:04.045 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, quick_navigation, overwhelming_power(14), titanic_overcharge(7), battle_potion_of_agility
4:05.048 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, landslide, quick_navigation, overwhelming_power(13), titanic_overcharge(7), battle_potion_of_agility
4:06.052 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, quick_navigation, overwhelming_power(12), titanic_overcharge(7), battle_potion_of_agility
4:07.059 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, quick_navigation, overwhelming_power(11), titanic_overcharge(7), battle_potion_of_agility
4:08.069 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage, quick_navigation, overwhelming_power(10), titanic_overcharge(7), battle_potion_of_agility
4:09.083 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage, quick_navigation, overwhelming_power(9), titanic_overcharge(7), battle_potion_of_agility
4:09.083 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage, quick_navigation, overwhelming_power(9), titanic_overcharge(7), battle_potion_of_agility
4:10.100 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation, overwhelming_power(8), titanic_overcharge(7), battle_potion_of_agility
4:11.119 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, stormbringer, frothing_rage, quick_navigation(2), overwhelming_power(7), battle_potion_of_agility
4:12.168 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, stormbringer, frothing_rage, quick_navigation(2), overwhelming_power(6), battle_potion_of_agility
4:13.221 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, stormbringer, frothing_rage, quick_navigation(2), overwhelming_power(5), titanic_overcharge, battle_potion_of_agility
4:14.275 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, stormbringer, frothing_rage, quick_navigation(2), overwhelming_power(4), titanic_overcharge(2), battle_potion_of_agility
4:15.483 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation(2), deadly_navigation, overwhelming_power(3), titanic_overcharge(2), battle_potion_of_agility
4:16.694 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation(2), deadly_navigation, overwhelming_power(2), titanic_overcharge(2), battle_potion_of_agility
4:17.907 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage, quick_navigation(2), deadly_navigation, overwhelming_power, titanic_overcharge(3), battle_potion_of_agility
4:19.118 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage, quick_navigation(3), deadly_navigation, titanic_overcharge(3), battle_potion_of_agility
4:20.325 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage, quick_navigation(4), deadly_navigation, titanic_overcharge(4), battle_potion_of_agility
4:21.521 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, stormbringer, frothing_rage, quick_navigation(4), deadly_navigation(2), titanic_overcharge(4), battle_potion_of_agility
4:22.716 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage, quick_navigation(4), deadly_navigation(2), titanic_overcharge(4), battle_potion_of_agility
4:23.914 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage, quick_navigation(4), deadly_navigation(3), titanic_overcharge(4), battle_potion_of_agility
4:23.914 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage, quick_navigation(4), deadly_navigation(3), titanic_overcharge(4), battle_potion_of_agility
4:25.109 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(24), titanic_overcharge(4), battle_potion_of_agility
4:26.226 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(23), titanic_overcharge(4)
4:27.347 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, stormbringer, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(22), titanic_overcharge(4)
4:28.472 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(21), titanic_overcharge(4)
4:29.599 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(20), titanic_overcharge(5)
4:30.723 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(19), titanic_overcharge(5)
4:31.851 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(18), titanic_overcharge(5)
4:32.982 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(17), titanic_overcharge(5)
4:34.114 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(15), titanic_overcharge(5)
4:35.254 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(14), titanic_overcharge(5)
4:36.397 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation_final, overwhelming_power(12), titanic_overcharge(5)
4:37.546 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, frothing_rage, quick_navigation(4), deadly_navigation_final, overwhelming_power(11), titanic_overcharge(5)
4:38.697 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(10), titanic_overcharge(5)
4:39.804 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(9)
4:40.938 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, landslide, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(8)
4:42.075 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, landslide, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(6), titanic_overcharge
4:43.212 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, landslide, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(5), titanic_overcharge(2)
4:44.347 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(4), titanic_overcharge(2)
4:45.487 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage, quick_navigation_final, overwhelming_power(3), titanic_overcharge(2)
4:46.629 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage, quick_navigation_final, overwhelming_power(2), titanic_overcharge(2)
4:47.774 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation_final, overwhelming_power, titanic_overcharge(3)
4:48.917 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, landslide, frothing_rage(2), titanic_overcharge(3)
4:50.146 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, frothing_rage(2), titanic_overcharge(3)
4:51.374 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, frothing_rage(3), titanic_overcharge(4)
4:52.597 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(3), titanic_overcharge(4)
4:53.821 Waiting     1.000 sec 20000.0/20000: 100% mana | 10.0/100: 10% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(3), titanic_overcharge(4)
4:54.821 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(3), titanic_overcharge(4)
4:56.235 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(3), titanic_overcharge(4)
4:57.464 Waiting     2.200 sec 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), titanic_overcharge(4)
4:59.664 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(3), titanic_overcharge(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 6566 6148 4387 (3433)
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 1676 1464 0
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 20000 20000 0
Maelstrom 100 100 0
Spell Power 8540 7341 0
Crit 22.86% 22.86% 926
Haste 19.31% 19.31% 1313
Damage / Heal Versatility 2.48% 2.48% 211
ManaReg per Second 640 640 0
Attack Power 7223 6148 0
Mastery 31.36% 31.36% 553
Armor 2738 2738 2738
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Crest of the Undying Visionary
ilevel: 390, stats: { 381 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Natural Harmony, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Spaulders of Coagulated Viscera
ilevel: 390, stats: { 352 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Laser Matrix, Heed My Call, Azerite Empowered }
Local Chest C'thraxxi General's Hauberk
ilevel: 390, stats: { 469 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Laser Matrix, Earthlink, Azerite Empowered }
Local Waist Titanspark Energy Girdle
ilevel: 385, stats: { 255 Armor, +247 AgiInt, +417 Sta, +96 Haste, +88 Crit }
Local Legs Blighted Anima Greaves
ilevel: 385, stats: { 397 Armor, +329 AgiInt, +556 Sta, +149 Haste, +96 Vers }
Local Feet Fused Monstrosity Stompers
ilevel: 385, stats: { 312 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Wrists Rubywrought Sparkguards
ilevel: 385, stats: { 198 Armor, +185 AgiInt, +312 Sta, +78 Haste, +60 Mastery }
Local Hands Oblivion Crushers
ilevel: 385, stats: { 283 Armor, +247 AgiInt, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Mother's Twin Gaze
ilevel: 385, weapon: { 424 - 547, 2.6 }, stats: { +164 Agi, +277 Sta, +69 Haste, +53 Crit }, enchant: quick_navigation
Local Off Hand Mother's Twin Gaze
ilevel: 385, weapon: { 424 - 547, 2.6 }, stats: { +164 Agi, +277 Sta, +69 Haste, +53 Crit }, enchant: deadly_navigation

Talents

Level
15 Boulderfist (Enhancement Shaman) Hot Hand (Enhancement Shaman) Lightning Shield (Enhancement Shaman)
30 Landslide (Enhancement Shaman) Forceful Winds (Enhancement Shaman) Totem Mastery (Enhancement Shaman)
45 Spirit Wolf (Enhancement Shaman) Earth Shield (Enhancement Shaman) Static Charge (Enhancement Shaman)
60 Searing Assault (Enhancement Shaman) Hailstorm (Enhancement Shaman) Overcharge (Enhancement Shaman)
75 Nature's Guardian Feral Lunge (Enhancement Shaman) Wind Rush Totem
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Elemental Spirits (Enhancement Shaman) Earthen Spike (Enhancement Shaman) Ascendance (Enhancement Shaman)

Profile

shaman="T22_Shaman_Enhancement"
spec=enhancement
level=120
race=troll
role=attack
position=back
talents=3101033

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck35,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>35))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool80,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>80)))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>70)))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>60)))
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/call_action_list,name=asc,if=buff.ascendance.up
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.asc=crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
actions.asc+=/rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
actions.asc+=/windstrike

actions.buffs=crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
actions.buffs+=/rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
actions.buffs+=/fury_of_air,if=!ticking&maelstrom>=20
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck25
actions.buffs+=/flametongue,if=buff.flametongue.remains<4.8+gcd
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8+gcd&variable.furyCheck25
actions.buffs+=/totem_mastery,if=buff.resonance_totem.remains<2

# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions.cds=bloodlust,if=target.health.pct<25|time>0.500
actions.cds+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.cds+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.cds+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.cds+=/feral_spirit
actions.cds+=/ascendance,if=cooldown.strike.remains>0
actions.cds+=/earth_elemental

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/stormstrike,cycle_targets=1,if=azerite.lightning_conduit.enabled&!debuff.lightning_conduit.up&active_enemies>1&(buff.stormbringer.up|(variable.OCPool70&variable.furyCheck35))
actions.core+=/stormstrike,if=buff.stormbringer.up|(buff.gathering_storms.up&variable.OCPool70&variable.furyCheck35)
actions.core+=/crash_lightning,if=active_enemies>=3&variable.furyCheck25
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&active_enemies=1&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=variable.OCPool70&variable.furyCheck35
actions.core+=/sundering
actions.core+=/crash_lightning,if=talent.forceful_winds.enabled&active_enemies>1&variable.furyCheck25
actions.core+=/flametongue,if=talent.searing_assault.enabled
actions.core+=/lava_lash,if=buff.hot_hand.react
actions.core+=/crash_lightning,if=active_enemies>1&variable.furyCheck25

actions.filler=rockbiter,if=maelstrom<70
actions.filler+=/crash_lightning,if=talent.crashing_storm.enabled&variable.OCPool60
actions.filler+=/lava_lash,if=variable.OCPool80&variable.furyCheck45
actions.filler+=/rockbiter
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<gcd

head=crest_of_the_undying_visionary,id=160630,bonus_id=4824/1507/4775,azerite_powers=416/30/0/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=spaulders_of_coagulated_viscera,id=160731,bonus_id=4824/1507/4775,azerite_powers=485/22/0/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=cthraxxi_generals_hauberk,id=160725,bonus_id=4824/1507/4775,azerite_powers=485/461/0/13
wrists=rubywrought_sparkguards,id=160629,bonus_id=4800/1507
hands=oblivion_crushers,id=160721,bonus_id=4800/1507
waist=titanspark_energy_girdle,id=160633,bonus_id=4800/1507
legs=blighted_anima_greaves,id=160716,bonus_id=4800/1507
feet=fused_monstrosity_stompers,id=160628,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=mothers_twin_gaze,id=160682,bonus_id=4800/1507,enchant=quick_navigation
off_hand=mothers_twin_gaze,id=160682,bonus_id=4800/1507,enchant=deadly_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=926
# gear_haste_rating=1313
# gear_mastery_rating=553
# gear_versatility_rating=211
# gear_armor=2738

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 274702568
Max Event Queue: 407
Sim Seconds: 2250297
CPU Seconds: 520.9691
Physical Seconds: 262.0227
Speed Up: 4319

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
T22_Death_Knight_Blood T22_Death_Knight_Blood augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood auto_attack_mh 0 746744 2489 25.08 4783 9561 125.4 125.4 24.9% 0.0% 0.0% 3.0% 2.40sec 1077192 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood blood_boil 50842 326291 1088 11.24 4625 9248 56.2 56.2 25.5% 0.0% 0.0% 0.0% 5.34sec 326291 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood blood_plague ticks -55078 118755 396 19.75 956 1912 56.2 98.8 25.8% 0.0% 0.0% 0.0% 5.34sec 118755 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood blood_shield 77535 6640 22 31.47 42 0 44.4 157.4 0.0% 0.0% 0.0% 0.0% 6.55sec 3670499 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood dancing_rune_weapon 49028 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.29sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood death_and_decay 43265 114319 381 32.89 553 1106 15.2 164.4 25.7% 0.0% 0.0% 0.0% 19.47sec 114319 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood death_strike 49998 546482 1822 8.89 9874 19745 44.4 44.4 24.9% 0.0% 0.0% 3.0% 6.55sec 788374 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood death_strike_heal 45470 12972 43 8.89 292 0 44.4 44.4 0.0% 0.0% 0.0% 0.0% 6.55sec 1089393 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood heart_strike 206930 282958 943 17.44 2607 5215 87.2 87.2 24.8% 0.0% 0.0% 3.0% 3.38sec 408228 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood marrowrend 195182 119241 397 4.73 4070 8119 23.7 23.7 24.3% 0.0% 0.0% 3.0% 12.85sec 171996 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood mind_freeze 47528 0 0 0.00 0 0 10.6 0.0 0.0% 0.0% 0.0% 0.0% 29.34sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood rune_strike 210764 65850 220 1.61 6608 13195 8.0 8.0 24.5% 0.0% 0.0% 2.9% 38.23sec 94965 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood touch_of_the_grave 127802 68937 230 3.59 3058 6114 18.0 18.0 25.5% 0.0% 0.0% 0.0% 17.03sec 68937 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood unholy_strength 53365 4768 16 4.74 201 0 23.7 23.7 0.0% 0.0% 0.0% 0.0% 12.63sec 451936 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood wasting_infection ticks -278110 31180 104 8.54 581 1162 7.7 42.7 25.7% 0.0% 0.0% 0.0% 35.70sec 31180 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon blood_boil 50842 7042 297 8.64 1654 3308 3.4 3.4 24.8% 0.0% 0.0% 0.0% 76.92sec 7042 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon blood_plague ticks -55078 9241 31 4.49 328 655 3.4 22.4 25.7% 0.0% 0.0% 0.0% 76.92sec 9241 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon death_strike 49998 15794 667 9.68 3282 6561 3.8 3.8 25.9% 0.0% 0.0% 0.0% 42.49sec 22579 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon heart_strike 206930 8929 377 19.62 915 1830 7.7 7.7 26.0% 0.0% 0.0% 0.0% 35.38sec 12765 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon main_hand 0 17041 719 20.05 1724 3444 7.9 7.9 24.9% 0.0% 0.0% 0.0% 34.86sec 24362 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon marrowrend 195182 6685 282 9.50 1452 2896 3.8 3.8 22.8% 0.0% 0.0% 0.0% 44.39sec 9558 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon rune_strike 210764 5925 250 5.07 2369 4735 2.0 2.0 25.0% 0.0% 0.0% 0.0% 2.65sec 8470 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_bloodworm main_hand 0 245982 1249 122.46 487 974 401.8 401.8 25.7% 0.0% 0.0% 0.0% 0.74sec 351661 196.87sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery a_murder_of_crows ticks -131894 394041 1313 17.05 3426 7372 5.5 85.3 30.3% 0.0% 0.0% 0.0% 60.59sec 563328 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery aspect_of_the_wild 193530 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.79sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery auto_shot 75 569825 1899 23.91 3721 7581 119.8 119.5 27.1% 0.0% 0.0% 0.0% 2.51sec 814634 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery azerite_globules 279958 39606 132 2.66 2387 4774 13.3 13.3 24.9% 0.0% 0.0% 0.0% 22.32sec 39606 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery barbed_shot ticks -217200 89911 300 26.23 686 0 37.1 131.2 0.0% 0.0% 0.0% 0.0% 8.07sec 128538 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery_cat stomp 201754 179314 598 7.43 3677 7866 37.1 37.1 27.5% 0.0% 0.0% 0.0% 8.07sec 256351 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery bestial_wrath 19574 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 37.88sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.91sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery chimaera_shot 53209 0 0 0.00 0 0 23.2 0.0 0.0% 0.0% 0.0% 0.0% 13.09sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery chimaera_shot_frost 171454 128119 427 2.32 8619 17612 0.0 11.6 27.2% 0.0% 0.0% 0.0% 0.00sec 128119 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery chimaera_shot_nature 171457 127965 427 2.32 8610 17626 0.0 11.6 27.1% 0.0% 0.0% 0.0% 0.00sec 127965 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery cobra_shot 193455 467895 1560 17.21 4219 8627 86.3 86.0 27.7% 0.0% 0.0% 0.0% 3.43sec 668912 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery frentic_blow 278148 76127 254 0.59 20441 40888 3.0 3.0 25.3% 0.0% 0.0% 0.0% 80.98sec 108832 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery heed_my_call 271685 84142 280 1.34 10048 20085 6.7 6.7 25.1% 0.0% 0.0% 0.0% 40.70sec 84142 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery heed_my_call_aoe 271686 36030 120 1.34 4306 8610 6.7 6.7 25.0% 0.0% 0.0% 0.0% 40.70sec 36030 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery kill_command 34026 0 0 0.00 0 0 55.3 0.0 0.0% 0.0% 0.0% 0.0% 5.42sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery_cat kill_command 83381 935243 3117 11.05 12928 27571 55.3 55.3 27.3% 0.0% 0.0% 0.0% 5.42sec 1337042 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery_cat claw 16827 924498 3082 16.77 8446 17965 83.8 83.8 27.1% 0.0% 0.0% 0.0% 3.60sec 1321680 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery_cat melee 0 901847 3006 57.83 2390 5084 289.2 289.2 27.1% 0.0% 0.0% 0.0% 1.03sec 1289299 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship aimed_shot 19434 1672187 5574 7.21 31254 62454 35.1 36.1 48.5% 0.0% 0.0% 0.0% 8.43sec 2390593 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship arcane_shot 185358 868121 2894 10.94 13552 27111 54.8 54.7 17.1% 0.0% 0.0% 0.0% 5.42sec 868121 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship auto_shot 75 493061 1644 21.19 3975 7949 106.2 105.9 17.1% 0.0% 0.0% 0.0% 2.84sec 704889 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship frentic_blow 278148 84785 283 0.65 22092 44185 3.3 3.3 17.4% 0.0% 0.0% 0.0% 77.88sec 121210 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship heed_my_call 271685 134142 447 1.41 16174 32348 7.1 7.1 17.2% 0.0% 0.0% 0.0% 38.56sec 134142 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship heed_my_call_aoe 271686 57348 191 1.41 6932 13864 7.1 7.1 17.0% 0.0% 0.0% 0.0% 38.56sec 57348 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship hunters_mark 257284 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship kul_tiran_cannonball_runner 271197 83285 278 10.38 1370 2740 51.9 51.9 17.1% 0.0% 0.0% 0.0% 5.18sec 83285 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship lights_judgment 255647 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 150.51sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship lights_judgment_damage 256893 93992 313 0.49 32609 65227 2.5 2.5 16.9% 0.0% 0.0% 0.0% 150.52sec 93992 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship rapid_fire ticks -257044 496787 1656 29.77 2593 5175 14.9 148.8 29.3% 0.0% 0.0% 0.0% 20.66sec 710216 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship serpent_sting 271788 62930 210 5.04 2134 4267 25.3 25.2 17.1% 0.0% 0.0% 0.0% 11.95sec 364792 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship serpent_sting ticks -271788 301862 1006 24.65 2093 4184 25.3 123.2 17.1% 0.0% 0.0% 0.0% 11.95sec 364792 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship steady_shot 56641 472382 1575 13.57 5951 11905 68.0 67.8 17.0% 0.0% 0.0% 0.0% 4.26sec 675327 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship trueshot 193526 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.30sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival auto_attack_mh 0 660650 2202 24.44 4453 8907 122.2 122.2 21.4% 0.0% 0.0% 0.0% 2.45sec 944479 300.00sec
T22_Hunter_Survival T22_Hunter_Survival azerite_globules 279958 43310 144 2.97 2405 4811 14.8 14.8 21.4% 0.0% 0.0% 0.0% 20.01sec 43310 300.00sec
T22_Hunter_Survival T22_Hunter_Survival coordinated_assault 266779 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.35sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival flanking_strike 269751 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 41.47sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival flanking_strike_damage 269752 78456 262 1.54 8404 16805 0.0 7.7 21.6% 0.0% 0.0% 0.0% 0.00sec 112162 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat flanking_strike 259516 64364 215 1.54 6914 13839 7.7 7.7 21.2% 0.0% 0.0% 0.0% 41.47sec 92015 300.00sec
T22_Hunter_Survival T22_Hunter_Survival flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival frentic_blow 278148 93387 311 0.74 20699 41398 3.7 3.7 21.9% 0.0% 0.0% 0.0% 72.07sec 133508 300.00sec
T22_Hunter_Survival T22_Hunter_Survival harpoon 190925 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival kill_command 259489 0 0 0.00 0 0 77.8 0.0 0.0% 0.0% 0.0% 0.0% 3.80sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat kill_command 259277 327703 1092 15.56 3471 6941 77.8 77.8 21.3% 0.0% 0.0% 0.0% 3.80sec 662405 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat kill_command ticks -259277 193915 646 39.01 819 1638 77.8 195.0 21.4% 0.0% 0.0% 0.0% 3.80sec 662405 300.00sec
T22_Hunter_Survival T22_Hunter_Survival potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival raptor_strike 186270 1128314 3761 19.61 9469 18942 98.1 98.1 21.5% 0.0% 0.0% 0.0% 3.03sec 1613060 300.00sec
T22_Hunter_Survival T22_Hunter_Survival serpent_sting 259491 304049 1013 8.28 6046 12070 41.4 41.4 21.6% 0.0% 0.0% 0.0% 7.29sec 785911 300.00sec
T22_Hunter_Survival T22_Hunter_Survival serpent_sting ticks -259491 481863 1606 26.66 2979 5961 41.4 133.3 21.3% 0.0% 0.0% 0.0% 7.29sec 785911 300.00sec
T22_Hunter_Survival T22_Hunter_Survival latent_poison 273289 442485 1475 17.52 4160 8330 87.6 87.6 21.4% 0.0% 0.0% 0.0% 3.40sec 442485 300.00sec
T22_Hunter_Survival T22_Hunter_Survival summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival wildfire_bomb 259495 0 0 0.00 0 0 30.9 0.0 0.0% 0.0% 0.0% 0.0% 9.77sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival wildfire_bomb_impact 265157 342219 1141 6.18 9116 18235 0.0 30.9 21.4% 0.0% 0.0% 0.0% 0.00sec 342219 300.00sec
T22_Hunter_Survival T22_Hunter_Survival wildfire_bomb_dot ticks -269747 333014 1110 36.38 1508 3016 0.0 181.9 21.4% 0.0% 0.0% 0.0% 0.00sec 333014 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat claw 16827 328821 1096 16.74 3232 6472 83.7 83.7 21.5% 0.0% 0.0% 0.0% 3.60sec 470089 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat melee 0 412688 1376 48.42 1404 2807 242.1 242.1 21.4% 0.0% 0.0% 0.0% 1.24sec 589987 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution avenging_wrath 31884 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.33sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution blade_of_justice 184575 474024 1580 9.04 8154 17065 45.2 45.2 26.2% 0.0% 0.0% 0.0% 6.67sec 677674 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution crusader_strike 35395 336788 1123 12.35 4263 8881 61.8 61.8 25.8% 0.0% 0.0% 0.0% 4.66sec 481479 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution hammer_of_wrath 24275 260682 869 3.59 10566 22329 18.0 18.0 33.5% 0.0% 0.0% 0.0% 17.01sec 260682 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution heed_my_call 271685 50113 167 1.57 5060 10121 7.8 7.8 26.4% 0.0% 0.0% 0.0% 35.49sec 50113 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution heed_my_call_aoe 271686 21526 72 1.57 2169 4338 7.8 7.8 26.7% 0.0% 0.0% 0.0% 35.49sec 21526 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution inquisition 84963 0 0 0.00 0 0 7.3 0.0 0.0% 0.0% 0.0% 0.0% 43.88sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution judgment 20271 409833 1366 6.65 9596 20044 33.3 33.3 26.1% 0.0% 0.0% 0.0% 9.08sec 409833 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution laser_matrix 280705 412610 1375 3.15 20702 41404 15.8 15.8 26.5% 0.0% 0.0% 0.0% 18.68sec 412610 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution melee 0 603310 2011 23.09 4113 8325 115.5 115.5 26.4% 0.0% 0.0% 0.0% 2.59sec 862504 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution rebuke 96231 0 0 0.00 0 0 10.4 0.0 0.0% 0.0% 0.0% 0.0% 30.01sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution shield_of_vengeance 184662 0 0 0.60 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 120.32sec 145228 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution shield_of_vengeance_proc 184689 139419 465 0.57 48574 0 3.0 2.9 0.0% 0.0% 0.0% 0.0% 119.82sec 139419 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution templars_verdict 85256 2357059 7857 14.04 25852 54282 70.2 70.2 27.2% 0.0% 0.0% 0.0% 4.21sec 2357059 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution voided_sectors 278153 115973 387 1.96 9354 18708 9.8 9.8 26.3% 0.0% 0.0% 0.0% 29.00sec 115973 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution wake_of_ashes 255937 195491 652 1.34 22583 47244 6.7 6.7 26.9% 0.0% 0.0% 0.0% 47.79sec 195491 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution wasting_infection ticks -278110 31509 105 8.64 577 1155 7.8 43.2 26.4% 0.0% 0.0% 0.0% 35.23sec 31509 300.00sec
T22_Priest_Shadow T22_Priest_Shadow augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow dark_ascension 280711 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.39sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow dark_ascension_damage 280800 136379 455 2.18 8602 25640 5.5 10.9 22.9% 0.0% 0.0% 0.0% 60.39sec 136379 300.00sec
T22_Priest_Shadow T22_Priest_Shadow flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow heed_my_call 271685 43188 144 1.47 4823 9650 7.4 7.4 21.8% 0.0% 0.0% 0.0% 37.39sec 43188 300.00sec
T22_Priest_Shadow T22_Priest_Shadow heed_my_call_aoe 271686 18536 62 1.47 2067 4134 7.4 7.4 22.0% 0.0% 0.0% 0.0% 37.39sec 18536 300.00sec
T22_Priest_Shadow T22_Priest_Shadow mind_blast 205351 767248 2557 10.05 12481 24850 49.2 50.2 22.6% 0.0% 0.0% 0.0% 5.99sec 767248 300.00sec
T22_Priest_Shadow T22_Priest_Shadow mind_flay ticks -15407 735328 2451 39.67 3024 6012 76.4 198.4 22.9% 0.0% 0.0% 0.0% 3.82sec 735328 300.00sec
T22_Priest_Shadow T22_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.69sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 14.8 0.0 0.0% 0.0% 0.0% 0.0% 20.76sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_crash_damage 205386 163755 546 2.95 9176 18280 14.7 14.7 21.3% 0.0% 0.0% 0.0% 20.76sec 163755 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_word_pain 589 18205 61 1.51 1981 3953 7.5 7.5 22.1% 0.0% 0.0% 0.0% 41.41sec 465277 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_word_pain ticks -589 447072 1490 38.50 1904 3794 7.5 192.5 22.1% 0.0% 0.0% 0.0% 41.41sec 465277 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadowy_apparitions 78203 0 0 0.00 0 0 42.6 0.0 0.0% 0.0% 0.0% 0.0% 6.80sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadowy_apparition 148859 76797 256 8.40 1827 0 42.0 42.0 0.0% 0.0% 0.0% 0.0% 6.79sec 76797 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow vampiric_touch ticks -34914 382265 1274 25.43 2465 4908 5.8 127.1 22.2% 0.0% 0.0% 0.0% 54.20sec 382265 300.00sec
T22_Priest_Shadow T22_Priest_Shadow void_bolt 205448 832012 2773 12.73 10822 21601 63.8 63.7 20.8% 0.0% 0.0% 0.0% 4.70sec 832012 300.00sec
T22_Priest_Shadow T22_Priest_Shadow void_eruption 228260 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 60.08sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow void_eruption_damage 228360 118055 394 1.94 8403 25130 4.9 9.7 22.6% 0.0% 0.0% 0.0% 60.08sec 118055 300.00sec
T22_Priest_Shadow T22_Priest_Shadow volatile_blood_explosion 278057 103757 346 1.46 11645 23305 7.4 7.3 21.9% 0.0% 0.0% 0.0% 37.43sec 103757 300.00sec
T22_Priest_Shadow T22_Priest_Shadow_mindbender melee 0 351750 4433 52.89 4179 8360 70.0 70.0 20.3% 0.0% 0.0% 0.0% 4.04sec 351750 79.35sec
T22_Rogue_Assassination T22_Rogue_Assassination augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination auto_attack_mh 0 569045 1897 44.47 2373 4737 222.4 222.4 26.9% 19.0% 0.0% 0.0% 1.35sec 813518 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination auto_attack_oh 1 281622 939 44.06 1184 2366 220.3 220.3 26.9% 19.0% 0.0% 0.0% 1.36sec 402613 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 240.19sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination deadly_poison_dot ticks -2818 327075 1090 39.59 1303 2603 504.6 197.9 26.9% 0.0% 0.0% 0.0% 0.77sec 327075 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination deadly_poison_instant 113780 609237 2031 100.72 954 1904 503.6 503.6 27.0% 0.0% 0.0% 0.0% 0.77sec 609237 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination envenom 32645 795032 2650 7.92 15816 31579 39.6 39.6 27.0% 0.0% 0.0% 0.0% 7.49sec 795032 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination frentic_blow 278148 92409 308 0.71 20388 40770 3.6 3.6 27.1% 0.0% 0.0% 0.0% 73.05sec 132110 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination garrote ticks -703 684081 2280 39.66 2723 5426 16.9 198.3 26.9% 0.0% 0.0% 0.0% 18.11sec 684081 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination mutilate 1329 0 0 0.00 0 0 93.8 0.0 0.0% 0.0% 0.0% 0.0% 3.20sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination mutilate_mh 5374 434227 1447 18.76 3647 7288 93.8 93.8 27.0% 0.0% 0.0% 0.0% 3.20sec 620780 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination mutilate_oh 27576 217070 724 18.76 1824 3642 93.8 93.8 27.0% 0.0% 0.0% 0.0% 3.20sec 310328 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination poison_bomb 255546 121170 404 7.90 2419 4825 39.5 39.5 27.0% 0.0% 0.0% 0.0% 6.50sec 121170 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination rupture ticks -1943 580197 1934 39.31 2327 4648 13.3 196.5 26.9% 0.0% 0.0% 0.0% 22.55sec 580197 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination toxic_blade 245388 153564 512 2.44 9928 19797 12.2 12.2 26.9% 0.0% 0.0% 0.0% 25.17sec 153564 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 127.76sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination vendetta 79140 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.10sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw adrenaline_rush 13750 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 72.59sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw ambush 8676 72204 241 1.33 8490 17280 6.6 6.6 27.2% 0.0% 0.0% 0.0% 57.28sec 103225 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw auto_attack_mh 0 741036 2470 42.86 3110 6344 214.3 214.3 29.0% 19.0% 0.0% 0.0% 1.41sec 1059400 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw auto_attack_oh 1 365732 1219 42.29 1555 3172 211.5 211.5 29.0% 19.0% 0.0% 0.0% 1.42sec 522858 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw between_the_eyes 199804 220353 735 1.63 7593 31252 8.1 8.1 82.3% 0.0% 0.0% 0.0% 24.71sec 315020 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw dispatch 2098 1105625 3685 11.71 14536 29690 58.6 58.6 28.7% 0.0% 0.0% 0.0% 5.00sec 1580624 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw frentic_blow 278148 110614 369 0.80 21099 43027 4.0 4.0 30.1% 0.0% 0.0% 0.0% 66.85sec 158135 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw killing_spree 51690 0 0 0.00 0 0 5.7 0.0 0.0% 0.0% 0.0% 0.0% 49.91sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw killing_spree_mh ticks -57841 96907 323 0.00 2191 4466 33.8 0.0 29.7% 0.0% 0.0% 0.0% 7.14sec 138541 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw killing_spree_oh ticks -57842 96863 323 0.00 2191 4467 33.8 0.0 29.7% 0.0% 0.0% 0.0% 7.14sec 138477 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw main_gauche 86392 633602 2112 23.46 4130 8424 117.3 117.3 29.6% 0.0% 0.0% 0.0% 2.64sec 905810 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw pistol_shot 185763 525004 1750 10.26 7829 15912 51.3 51.3 29.7% 0.0% 0.0% 0.0% 5.76sec 750556 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw roll_the_bones 193316 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 20.14sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw sinister_strike 193315 965406 3218 36.62 4026 8186 131.5 183.1 30.0% 0.0% 0.0% 0.0% 2.27sec 1380164 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw vanish 1856 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 57.28sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety arcane_torrent 25046 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 91.07sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety auto_attack_mh 0 530009 1767 42.02 2391 4782 210.1 210.1 24.5% 18.9% 0.0% 0.0% 1.43sec 683115 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety auto_attack_oh 1 262830 876 41.69 1196 2391 208.5 208.5 24.5% 19.0% 0.0% 0.0% 1.44sec 338806 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety backstab 53 464601 1549 13.49 5539 11075 67.4 67.4 24.4% 0.0% 0.0% 0.0% 4.19sec 608244 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety eviscerate 196819 1917714 6392 12.17 25324 50692 60.9 60.9 24.4% 0.0% 0.0% 0.0% 4.92sec 2454228 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety frentic_blow 278148 80943 270 0.65 20093 40187 3.2 3.2 24.2% 0.0% 0.0% 0.0% 77.31sec 115717 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety marked_for_death 137619 0 0 0.00 0 0 9.8 0.0 0.0% 0.0% 0.0% 0.0% 34.27sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety nightblade ticks -195452 634442 2115 36.83 2768 5536 19.8 184.2 24.5% 0.0% 0.0% 0.0% 15.07sec 634442 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadow_blades 121471 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.03sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadow_blades_attack 279043 118534 395 4.49 5279 0 22.5 22.5 0.0% 0.0% 0.0% 0.0% 9.60sec 118534 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadow_dance 185313 0 0 0.00 0 0 22.7 0.0 0.0% 0.0% 0.0% 0.0% 13.48sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadowstrike 185438 968450 3228 17.67 8818 17639 88.3 88.3 24.3% 0.0% 0.0% 0.0% 3.42sec 1234220 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety symbols_of_death 212283 0 0 0.00 0 0 10.3 0.0 0.0% 0.0% 0.0% 0.0% 30.28sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety vanish 1856 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 129.48sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.77sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 191.61sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement earth_elemental 188616 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.45sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.43sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement flametongue 193796 60198 201 5.80 1640 3278 29.0 29.0 26.6% 0.0% 0.0% 0.0% 10.48sec 60198 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement flametongue_attack 10444 234589 782 125.39 295 590 627.0 627.0 26.8% 0.0% 0.0% 0.0% 0.73sec 234589 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement searing_assault ticks -268429 217375 725 17.17 1998 3993 29.0 85.9 26.7% 0.0% 0.0% 0.0% 10.48sec 217375 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement frentic_blow 278148 93592 312 0.72 20372 40743 3.6 3.6 27.0% 0.0% 0.0% 0.0% 72.75sec 133800 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement heed_my_call 271685 47223 157 1.50 4971 9943 7.5 7.5 26.6% 0.0% 0.0% 0.0% 36.82sec 47223 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement heed_my_call_aoe 271686 20265 68 1.50 2131 4261 7.5 7.5 26.7% 0.0% 0.0% 0.0% 36.82sec 20265 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement laser_matrix 280705 390947 1303 3.04 20338 40675 15.2 15.2 26.6% 0.0% 0.0% 0.0% 19.52sec 390947 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement lava_lash 60103 411759 1373 10.90 5958 11914 54.5 54.5 26.9% 0.0% 0.0% 0.0% 5.23sec 411759 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement lightning_shield 273324 187769 626 44.14 670 1340 221.7 220.7 26.9% 0.0% 0.0% 0.0% 1.96sec 187769 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement main_hand 0 409407 1365 27.27 2785 5568 136.3 136.3 26.8% 19.0% 0.0% 0.0% 2.21sec 585296 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement offhand 1 204287 681 27.22 1392 2784 136.1 136.1 26.8% 19.0% 0.0% 0.0% 2.21sec 292052 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement rockbiter 193786 301994 1007 12.71 3752 7499 63.5 63.5 26.7% 0.0% 0.0% 0.0% 4.75sec 301994 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 81.3 0.0 0.0% 0.0% 0.0% 0.0% 3.65sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement stormstrike_mh 32175 994970 3317 16.26 9651 19264 81.3 81.3 26.9% 0.0% 0.0% 0.0% 3.65sec 1422429 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement stormstrike_offhand 32176 497799 1659 16.26 4822 9652 81.3 81.3 26.9% 0.0% 0.0% 0.0% 3.65sec 711664 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement sundering 197214 196288 654 1.49 20861 41711 7.4 7.4 26.7% 0.0% 0.0% 0.0% 41.92sec 196288 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement wind_shear 57994 0 0 0.00 0 0 11.4 0.0 0.0% 0.0% 0.0% 0.0% 27.18sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windfury_attack 25504 97383 325 23.92 642 1284 119.6 119.6 26.8% 0.0% 0.0% 0.0% 4.94sec 139221 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windlash 114089 101028 337 3.67 4355 8708 18.4 18.4 26.3% 0.0% 0.0% 0.0% 11.24sec 101028 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windlash_offhand 114093 49894 166 3.63 2177 4353 18.1 18.1 26.4% 0.0% 0.0% 0.0% 11.38sec 49894 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windstrike 115356 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 11.56sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windstrike_mh 115357 341109 1137 3.57 15142 30266 17.8 17.8 26.3% 0.0% 0.0% 0.0% 11.56sec 341109 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windstrike_offhand 115360 170379 568 3.57 7572 15124 17.8 17.8 26.2% 0.0% 0.0% 0.0% 11.56sec 170379 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement_greater_earth_elemental melee 0 20863 286 44.50 304 607 54.2 54.2 26.8% 0.0% 0.0% 0.0% 3.38sec 29826 73.05sec
T22_Shaman_Enhancement T22_Shaman_Enhancement_spirit_wolf melee 0 94056 2153 111.98 915 1827 81.5 81.5 26.2% 0.0% 0.0% 0.0% 6.28sec 134464 43.68sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
156593.0 0.0 Health 84.10% 5.6 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.41% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.45% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.47% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.96% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.44% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.39% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.42% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.09% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.37% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.37%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Azerite Globules 14.0 26.9 22.1sec 7.4sec 67.37% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_azerite_globules
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • azerite_globules_1:34.05%
  • azerite_globules_2:33.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279956
  • name:Azerite Globules
  • tooltip:Accumulating unstable globules.
  • description:
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Azerite Globules 15.5 30.0 19.8sec 6.6sec 67.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_azerite_globules
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • azerite_globules_1:33.73%
  • azerite_globules_2:33.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279956
  • name:Azerite Globules
  • tooltip:Accumulating unstable globules.
  • description:
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Find Weakness 9.4 78.9 33.6sec 3.4sec 78.20% 79.69% 78.9(78.9) 8.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • find_weakness_1:78.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:$w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Shadowstrike and Cheap Shot reveal a flaw in your target's defenses, causing all your attacks to bypass $91021s1% of that enemy's armor for {$91021d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hunter's Mark 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • hunters_mark_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:257284
  • name:Hunter's Mark
  • tooltip:Damage taken from the Hunter increased by $s1%. Can always be seen and tracked by the Hunter.
  • description:Apply Hunter's Mark to the target, increasing all damage you deal to the marked target by $s1%. If the target dies while affected by Hunter's Mark, you instantly gain $259558s1 Focus. The target can always be seen and tracked by the Hunter. Only one Hunter's Mark can be applied at a time.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 32.9 0.4 9.2sec 9.1sec 25.37% 46.55% 0.4(0.4) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • judgment_1:25.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's next Holy Power spender.
  • description:{$@spelldesc20271=Judges the target, dealing $s1 Holy damage{$?s231663=false}[, and causing them to take $197277s1% increased damage from your next ability that costs Holy Power.][]{$?s137027=false}[ |cFFFFFFFFGenerates $220637s1 Holy Power.][]}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Latent Poison 88.3 86.4 3.4sec 1.7sec 66.65% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_latent_poison
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:2100.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • latent_poison_1:37.32%
  • latent_poison_2:17.00%
  • latent_poison_3:9.88%
  • latent_poison_4:2.21%
  • latent_poison_5:0.23%
  • latent_poison_6:0.01%
  • latent_poison_7:0.00%
  • latent_poison_8:0.00%
  • latent_poison_9:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:273286
  • name:Latent Poison
  • tooltip:The Hunter's next Raptor Strike will consume all stacks of Latent Poison to deal additional Nature damage.
  • description:{$@spelldesc273283=Serpent Sting damage applies Latent Poison, stacking up to {$273286u=10} times. Your {$?s259387=false}[Mongoose Bite][Raptor Strike] consumes all applications of Latent Poison to deal $s1 Nature damage per stack.}
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:273283
  • name:Latent Poison
  • tooltip:
  • description:Serpent Sting damage applies Latent Poison, stacking up to {$273286u=10} times. Your {$?s259387=false}[Mongoose Bite][Raptor Strike] consumes all applications of Latent Poison to deal $s1 Nature damage per stack.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Marked for Death 1.0 8.8 132.3sec 34.3sec 100.00% 0.00% 8.8(8.8) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • marked_for_death_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Steady Aim 31.3 36.5 9.3sec 4.3sec 52.68% 85.22% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_steady_aim
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:2400.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • steady_aim_1:26.31%
  • steady_aim_2:16.06%
  • steady_aim_3:8.12%
  • steady_aim_4:1.97%
  • steady_aim_5:0.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:277959
  • name:Steady Aim
  • tooltip:The Hunter's next Aimed Shot will deal $w1 more damage.
  • description:{$@spelldesc277651=Steady Shot increases the damage of your next Aimed Shot against the target by $s1, stacking up to {$277959u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:277651
  • name:Steady Aim
  • tooltip:
  • description:Steady Shot increases the damage of your next Aimed Shot against the target by $s1, stacking up to {$277959u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Toxic Blade 12.2 0.0 25.2sec 25.2sec 36.16% 39.31% 0.0(0.0) 11.9

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_toxic_blade
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • toxic_blade_1:36.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:245389
  • name:Toxic Blade
  • tooltip:$s1% increased damage taken from poisons from the casting Rogue.
  • description:{$@spelldesc245388=Stab your enemy with a toxic poisoned blade, dealing $s2 Nature damage. Your Nature damage done against the target is increased by $245389s1% for {$245389d=9 seconds}. |cFFFFFFFFAwards $s3 combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:9.00
  • cooldown:0.00
  • default_chance:0.00%
Vendetta 3.0 0.0 120.1sec 120.1sec 19.35% 16.48% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vendetta_1:19.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility. Generates ${$256495s1*{$256495d=3 seconds}/5} Energy over {$256495d=3 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your $?c1[Chaos][Fire] damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 156593.02
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 157770.68
Minimum 150302.03
Maximum 165975.67
Spread ( max - min ) 15673.64
Range [ ( max - min ) / 2 * 100% ] 4.97%
Standard Deviation 2422.9885
5th Percentile 153947.75
95th Percentile 161838.89
( 95th Percentile - 5th Percentile ) 7891.15
Mean Distribution
Standard Deviation 27.9801
95.00% Confidence Intervall ( 157715.84 - 157825.52 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 907
0.1 Scale Factor Error with Delta=300 50118
0.05 Scale Factor Error with Delta=300 200469
0.01 Scale Factor Error with Delta=300 5011716
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 3737
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=102.749,attack_speed=2,aoe_tanks=1
2 7.77 spell_dot,damage=410.997,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 8.50 spell_nuke,damage=154.124,cooldown=35,attack_speed=2,aoe_tanks=1
4 10.68 melee_nuke,damage=308.248,cooldown=27,attack_speed=2,aoe_tanks=1

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 56746319 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste inf% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 3336 3336
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=102.749,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=410.997,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=154.124,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=308.248,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.