close

SimulationCraft 801-01

for World of Warcraft 8.0.1 Live (wow build level 26095, git build 20d8338)

Beta Release

Current simulator hotfixes

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

T22_Death_Knight_Blood : 9140 dps, 0 dtps, 82 hps (22 aps), 52.2k TMI, 61.0k ETMI

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR   HPS HPS(e) HPS Error HPS Range HPR   APS APS Error APS Range APR
9139.6 9139.6 5.4 / 0.059% 930.4 / 10.2% 1353.3       59.9 59.9 0.16 / 0.27% 23 / 38.9% 9.9       22.1 0.03 / 0.13% 4 / 16.8% 9.9
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max   Window Bin Size
0.0 0.00 / 0.00% 0 / 0.0%       52.2k 9 / 0.02% 50.6k 53.7k 1.6k / 3.0%       0.0% -0.0% 0.0%       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.0 6.0 Runic Power 13.10% 50.1 100.0% 100%
Talents
  • 15: Rune Strike (Blood Death Knight)
  • 30: Hemostasis (Blood Death Knight)
  • 45: Ossuary (Blood Death Knight)
  • 60: Anti-Magic Barrier (Blood Death Knight)
  • 90: Bloodworms (Blood Death Knight)
  • 100: Red Thirst (Blood Death Knight)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
T22_Death_Knight_Blood 9140
auto_attack_mh 2489 27.2% 125.4 2.40sec 5951 2495 Direct 125.4 4740 9479 5951 25.6% 3.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.38 125.38 0.00 0.00 2.3854 0.0000 746122.75 1076252.83 30.67 2494.76 2494.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.54 72.21% 4782.46 4174 5995 4783.86 4602 5003 432987 619007 30.05
hit (blocked) 2.79 2.23% 3347.85 2922 4197 3138.98 0 4093 9356 19109 47.87
crit 31.11 24.81% 9563.40 8347 11991 9566.38 8925 10181 297499 425310 30.05
crit (blocked) 0.94 0.75% 6687.17 5843 8393 4095.03 0 8186 6281 12827 31.24
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Blood Boil 1090 11.9% 56.2 5.34sec 5812 5366 Direct 56.2 4626 9246 5812 25.7% 0.0%  

Stats details: blood_boil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.22 56.22 0.00 0.00 1.0831 0.0000 326737.03 326737.03 0.00 5366.20 5366.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.79 74.33% 4626.45 4034 5812 4627.83 4420 4885 193322 193322 0.00
crit 14.43 25.67% 9246.42 8069 11624 9249.34 8375 10312 133415 133415 0.00
 
 

Action details: blood_boil

Static Values
  • id:50842
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:7.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges_fractional>=1.8&(buff.hemostasis.stack<=(5-spell_targets.blood_boil)|spell_targets.blood_boil>2)
Spelldata
  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within $A1 yds.][ and infects all enemies within $A1 yds with Blood Plague. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {$@spelldesc55078=A shadowy disease that drains $o1 health from the target over {$d=24 seconds}. }]
 
Blood Plague 395 4.3% 56.2 5.34sec 2110 0 Periodic 98.8 956 1912 1201 25.6% 0.0% 98.8%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.22 0.00 98.75 98.75 0.0000 3.0000 118614.15 118614.15 0.00 400.37 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.4 74.36% 955.93 837 1206 956.20 919 1012 70194 70194 0.00
crit 25.3 25.64% 1912.07 1674 2412 1912.59 1803 2039 48420 48420 0.00
 
 

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining $w1 health from the target every $t1 sec.
  • description:A shadowy disease that drains $o1 health from the target over {$d=24 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.062244
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Death and Decay 381 4.2% 15.2 19.48sec 7512 6872 Direct 164.2 553 1106 695 25.7% 0.0%  

Stats details: death_and_decay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 164.16 0.00 0.00 1.0931 0.0000 114143.27 114143.27 0.00 6871.96 6871.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.93 74.28% 552.98 485 698 553.18 528 584 67426 67426 0.00
crit 42.22 25.72% 1106.40 969 1396 1106.79 1037 1190 46717 46717 0.00
 
 

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:rune
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.death_and_decay>=3
Spelldata
  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:
  • description:Corrupts the targeted ground, causing ${$52212m1*11} Shadow damage over {$d=10 seconds} to targets within the area. While you remain within the area, your $?c1[Heart Strike will hit up to $188290m3 additional targets.]?s207311[Clawing Shadows will hit all enemies near the target.][Scourge Strike will hit all enemies near the target.]
 
Death Strike 1825 20.0% 44.4 6.55sec 12309 11228 Direct 44.4 9782 19585 12309 25.8% 3.0%  

Stats details: death_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.44 44.44 0.00 0.00 1.0963 0.0000 546988.99 789093.82 30.68 11227.89 11227.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.98 71.96% 9871.43 7861 14948 9873.84 9313 10533 315671 451290 30.05
hit (blocked) 1.00 2.26% 6926.13 5502 10162 4405.30 0 10162 6958 14211 32.44
crit 11.12 25.02% 19758.76 15721 29895 19764.55 17608 24361 219718 314113 30.05
crit (blocked) 0.34 0.76% 13829.68 11005 20324 3920.97 0 20324 4642 9480 14.47
 
 

Action details: death_strike

Static Values
  • id:49998
  • school:physical
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power.deficit<=10
Spelldata
  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of ${{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$s2=25}% of all damage taken in the last {$s4=5} sec, minimum {$s3=7}% of maximum health.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Heart Strike 944 10.3% 87.2 3.38sec 3247 2983 Direct 87.2 2584 5168 3247 25.7% 3.0%  

Stats details: heart_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.15 87.15 0.00 0.00 1.0885 0.0000 282982.30 408217.69 30.68 2982.91 2982.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.87 72.14% 2607.45 2278 3282 2608.22 2494 2745 163927 234354 30.05
hit (blocked) 1.93 2.21% 1827.06 1595 2297 1562.09 0 2233 3523 7195 43.64
crit 21.69 24.88% 5214.65 4556 6564 5216.56 4846 5655 113081 161662 30.05
crit (blocked) 0.67 0.77% 3650.92 3189 4466 1785.53 0 4466 2452 5007 24.93
 
 

Action details: heart_strike

Static Values
  • id:206930
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.dancing_rune_weapon.up|rune.time_to_4<gcd
Spelldata
  • id:206930
  • name:Heart Strike
  • school:physical
  • tooltip:Movement speed reduced by {$s5=20}%.
  • description:Instantly strike the target and 1 other nearby enemy, causing {$s2=0} Physical damage, and reducing enemies' movement speed by {$s5=20}% for {$d=8 seconds}. |cFFFFFFFFGenerates {$?s221536=false}[${{$s3=5}+{$221536s1=0}}][{$s3=5}] bonus Runic Power{$?s221536=false}[, plus ${{$210738s1=20}/10} Runic Power per additional enemy struck][].|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Marrowrend 398 4.4% 23.7 12.85sec 5037 4695 Direct 23.7 4034 8054 5037 25.0% 3.0%  

Stats details: marrowrend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.67 23.67 0.00 0.00 1.0728 0.0000 119240.00 172009.25 30.68 4695.41 4695.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.23 72.79% 4070.53 3533 5089 4071.67 3802 4402 70143 100278 30.05
hit (blocked) 0.53 2.25% 2849.87 2473 3563 1185.41 0 3463 1519 3103 21.24
crit 5.73 24.22% 8125.20 7066 10179 8105.29 0 9885 46581 66593 29.97
crit (blocked) 0.17 0.74% 5707.81 4946 6925 914.39 0 6925 996 2035 8.17
 
 

Action details: marrowrend

Static Values
  • id:195182
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bone_shield.remains<=rune.time_to_3|buff.bone_shield.remains<=(gcd+cooldown.blooddrinker.ready*talent.blooddrinker.enabled*2)|buff.bone_shield.stack<3)&runic_power.deficit>=20
Spelldata
  • id:195182
  • name:Marrowrend
  • school:physical
  • tooltip:
  • description:Smash the target, dealing {$s2=0} Physical damage and generating {$s3=3} charges of Bone Shield. |Tinterface\icons\ability_deathknight_boneshield.blp:24|t |cFFFFFFFFBone Shield|r {$@spelldesc195181=Surrounds you with a barrier of whirling bones, increasing Armor by ${{$s1=40}*$STR/100}, and your Haste by {$s4=10}%. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Rune Strike 221 2.4% 8.0 38.21sec 8224 7722 Direct 8.0 6548 13096 8224 25.6% 3.0%  

Stats details: rune_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.04 8.04 0.00 0.00 1.0650 0.0000 66116.00 95372.78 30.68 7722.03 7722.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.81 72.22% 6606.43 5644 8131 6607.20 0 7626 38359 54839 30.04
hit (blocked) 0.18 2.19% 4614.37 3951 5532 747.76 0 5532 812 1659 8.27
crit 1.99 24.81% 13216.49 11288 16261 11845.40 0 16261 26366 37693 26.92
crit (blocked) 0.06 0.78% 9249.17 7901 11064 563.29 0 11064 578 1181 3.11
 
 

Action details: rune_strike

Static Values
  • id:210764
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges_fractional>=1.8|buff.dancing_rune_weapon.up)&rune.time_to_3>=gcd
Spelldata
  • id:210764
  • name:Rune Strike
  • school:physical
  • tooltip:
  • description:Strike the target for {$s1=0} Physical damage. Cooldown reduced by {$s2=1} sec for every Rune you spend. |cFFFFFFFFGenerates {$s2=1} Rune.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Touch of the Grave 230 2.5% 18.0 17.04sec 3842 0 Direct 18.0 3059 6109 3842 25.7% 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.97 17.97 0.00 0.00 0.0000 0.0000 69038.27 69038.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.35 74.32% 3058.75 2598 3939 3060.23 2838 3405 40845 40845 0.00
crit 4.62 25.68% 6108.98 5196 7878 6082.32 0 7544 28193 28193 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing $<damage> Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.312500
  • spell_power_mod.direct:0.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Wasting Infection 105 1.2% 7.8 35.40sec 4025 0 Periodic 43.2 581 1162 730 25.6% 0.0% 28.4%

Stats details: wasting_infection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.83 0.00 43.16 43.16 0.0000 1.9769 31500.93 31500.93 0.00 369.19 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.1 74.36% 580.65 0 603 581.11 541 595 18635 18635 0.00
crit 11.1 25.64% 1162.42 1 1207 1163.02 0 1207 12866 12866 0.00
 
 

Action details: wasting_infection

Static Values
  • id:278110
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278110
  • name:Wasting Infection
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. The caster's attacks will grant them Critical Strike.
  • description:
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:533.46
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - dancing_rune_weapon 2984 / 238
Blood Boil 298 0.3% 3.4 76.39sec 2059 0 Direct 3.4 1655 3302 2059 24.6% 0.0%  

Stats details: blood_boil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.42 3.42 0.00 0.00 0.0000 0.0000 7038.36 7038.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.58 75.43% 1654.64 1345 1937 1638.92 0 1909 4266 4266 0.00
crit 0.84 24.57% 3302.10 2690 3875 2026.37 0 3875 2773 2773 0.00
 
 

Action details: blood_boil

Static Values
  • id:50842
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50842
  • name:Blood Boil
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage$?s212744[ to all enemies within $A1 yds.][ and infects all enemies within $A1 yds with Blood Plague. |Tinterface\icons\spell_deathknight_bloodplague.blp:24|t |cFFFFFFFFBlood Plague|r {$@spelldesc55078=A shadowy disease that drains $o1 health from the target over {$d=24 seconds}. }]
 
Blood Plague 392 0.3% 3.4 76.39sec 2713 0 Periodic 22.5 328 655 412 25.8% 0.0% 22.1%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.42 0.00 22.50 22.50 0.0000 2.9406 9271.07 9271.07 0.00 140.12 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.7 74.20% 327.66 34 402 327.78 284 375 5471 5471 0.00
crit 5.8 25.80% 654.74 71 804 652.86 0 781 3800 3800 0.00
 
 

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Draining $w1 health from the target every $t1 sec.
  • description:A shadowy disease that drains $o1 health from the target over {$d=24 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.062244
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Death Strike 662 0.6% 3.8 42.35sec 4115 0 Direct 3.8 3275 6557 4115 25.6% 0.0%  

Stats details: death_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.82 3.82 0.00 0.00 0.0000 0.0000 15731.62 22490.25 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.85 74.42% 3275.36 2620 4379 3246.40 0 4256 9319 13323 29.75
crit 0.98 25.58% 6557.30 5240 8512 4403.83 0 8512 6412 9167 20.17
 
 

Action details: death_strike

Static Values
  • id:49998
  • school:physical
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49998
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of ${{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$s2=25}% of all damage taken in the last {$s4=5} sec, minimum {$s3=7}% of maximum health.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Heart Strike 376 0.3% 7.8 35.24sec 1150 0 Direct 7.8 914 1826 1150 25.9% 0.0%  

Stats details: heart_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.75 7.75 0.00 0.00 0.0000 0.0000 8915.55 12745.84 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.74 74.11% 913.97 759 1094 914.34 0 1062 5250 7505 30.05
crit 2.01 25.89% 1826.46 1519 2188 1638.69 0 2127 3666 5240 26.95
 
 

Action details: heart_strike

Static Values
  • id:206930
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:206930
  • name:Heart Strike
  • school:physical
  • tooltip:Movement speed reduced by {$s5=20}%.
  • description:Instantly strike the target and 1 other nearby enemy, causing {$s2=0} Physical damage, and reducing enemies' movement speed by {$s5=20}% for {$d=8 seconds}. |cFFFFFFFFGenerates {$?s221536=false}[${{$s3=5}+{$221536s1=0}}][{$s3=5}] bonus Runic Power{$?s221536=false}[, plus ${{$210738s1=20}/10} Runic Power per additional enemy struck][].|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
main_hand 721 0.6% 7.9 34.77sec 2157 861 Direct 7.9 1723 3442 2157 25.3% 0.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.92 7.92 0.00 0.00 2.5054 0.0000 17082.61 24421.64 30.05 861.06 861.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.92 74.74% 1723.05 1418 2043 1723.76 1476 2004 10198 14580 30.05
crit 2.00 25.26% 3442.34 2836 4085 3081.82 0 4085 6884 9842 26.90
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Marrowrend 283 0.2% 3.7 42.64sec 1790 0 Direct 3.7 1452 2903 1790 23.3% 0.0%  

Stats details: marrowrend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.74 3.74 0.00 0.00 0.0000 0.0000 6690.30 9564.59 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.87 76.72% 1452.27 1178 1696 1443.70 0 1681 4164 5954 29.85
crit 0.87 23.28% 2902.76 2355 3393 1816.82 0 3393 2526 3611 18.79
 
 

Action details: marrowrend

Static Values
  • id:195182
  • school:physical
  • resource:rune
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195182
  • name:Marrowrend
  • school:physical
  • tooltip:
  • description:Smash the target, dealing {$s2=0} Physical damage and generating {$s3=3} charges of Bone Shield. |Tinterface\icons\ability_deathknight_boneshield.blp:24|t |cFFFFFFFFBone Shield|r {$@spelldesc195181=Surrounds you with a barrier of whirling bones, increasing Armor by ${{$s1=40}*$STR/100}, and your Haste by {$s4=10}%. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Rune Strike 252 0.2% 2.0 2.53sec 2973 0 Direct 2.0 2370 4739 2973 25.5% 0.0%  

Stats details: rune_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 5948.67 8504.34 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.49 74.53% 2369.91 2089 2710 2217.40 0 2710 3534 5052 28.12
crit 0.51 25.47% 4739.38 3763 5420 2109.22 0 5420 2415 3452 13.38
 
 

Action details: rune_strike

Static Values
  • id:210764
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210764
  • name:Rune Strike
  • school:physical
  • tooltip:
  • description:Strike the target for {$s1=0} Physical damage. Cooldown reduced by {$s2=1} sec for every Rune you spend. |cFFFFFFFFGenerates {$s2=1} Rune.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bloodworm 1256 / 823
main_hand 1256 9.0% 402.9 0.73sec 613 606 Direct 402.9 487 974 613 25.7% 0.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 402.91 402.91 0.00 0.00 1.0103 0.0000 246794.07 352821.76 30.05 606.28 606.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 299.31 74.29% 487.33 425 613 487.44 464 520 145862 208528 30.05
crit 103.60 25.71% 974.21 851 1226 974.42 922 1037 100932 144294 30.05
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
T22_Death_Knight_Blood 60
Blood Shield 22 27.2% 44.4 6.55sec 149 0 Direct 157.3 42 0 42 0.0%  

Stats details: blood_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 44.44 157.34 0.00 0.00 0.0000 0.0000 6639.99 3666981.88 99.82 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 157.34 100.00% 42.20 0 170 42.17 39 44 6640 3666982 99.79
 
 

Action details: blood_shield

Static Values
  • id:77535
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:true
  • if_expr:
Spelldata
  • id:77535
  • name:Blood Shield
  • school:shadow
  • tooltip:Absorbs $w1 Physical damage.
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:128740.25
  • base_dd_max:128740.25
 
Death Strike (_heal) 44 53.0% 44.4 6.55sec 291 0 Direct 44.4 291 0 291 0.0%  

Stats details: death_strike_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 44.44 44.44 0.00 0.00 0.0000 0.0000 12929.81 1089480.18 98.81 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.44 100.00% 290.96 0 2660 294.59 120 468 12930 1089480 98.80
 
 

Action details: death_strike_heal

Static Values
  • id:45470
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:true
  • if_expr:
Spelldata
  • id:45470
  • name:Death Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc49998=Focuses dark power into a strike{$?s137006=false}[ with both weapons, that deals a total of ${{$s1=0}+{$66188s1=0}}][ that deals {$s1=0}] Physical damage and heals you for {$s2=25}% of all damage taken in the last {$s4=5} sec, minimum {$s3=7}% of maximum health.}
 
Unholy Strength 16 19.7% 23.7 12.62sec 203 0 Direct 23.7 203 0 203 0.0%  

Stats details: unholy_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 23.68 23.68 0.00 0.00 0.0000 0.0000 4810.19 451277.35 98.93 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.68 100.00% 203.16 0 2660 206.93 0 559 4810 451277 98.91
 
 

Action details: unholy_strength

Static Values
  • id:53365
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:true
  • if_expr:
Spelldata
  • id:53365
  • name:Unholy Strength
  • school:physical
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
 
Simple Action Stats Execute Interval
T22_Death_Knight_Blood
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:false
  • if_expr:
 
Dancing Rune Weapon 3.0 120.30sec

Stats details: dancing_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 1.1765 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dancing_rune_weapon

Static Values
  • id:49028
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.blooddrinker.enabled|!cooldown.blooddrinker.ready
Spelldata
  • id:49028
  • name:Dancing Rune Weapon
  • school:physical
  • tooltip:
  • description:Summons a rune weapon for {$s4=8} sec that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=40}% parry chance.
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Death_Knight_Blood
  • harmful:false
  • if_expr:
 
Mind Freeze 10.6 29.37sec

Stats details: mind_freeze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mind_freeze

Static Values
  • id:47528
  • school:frost
  • resource:runic_power
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47528
  • name:Mind Freeze
  • school:frost
  • tooltip:
  • description:Smash the target's mind with cold, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:stamina
  • amount:24.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=6}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Strength 2.0 0.0 121.5sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_battle_potion_of_strength
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:900.00

Stack Uptimes

  • battle_potion_of_strength_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279153
  • name:Battle Potion of Strength
  • tooltip:Strength increased by $w1.
  • description:Increases your Strength by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Shield 4.4 40.0 65.4sec 6.5sec 94.85% 100.00% 40.0(40.0) 3.4

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_blood_shield
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_shield_1:94.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:77535
  • name:Blood Shield
  • tooltip:Absorbs $w1 Physical damage.
  • description:When you deal damage with Death Strike while in Blood Presence, you gain a percentage of your health gained as a physical absorption shield.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bone Shield 1.0 21.7 184.6sec 13.4sec 99.57% 99.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_bone_shield
  • max_stacks:10
  • duration:30.00
  • cooldown:2.50
  • default_chance:100.00%
  • default_value:0.91
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bone_shield_1:0.00%
  • bone_shield_2:0.00%
  • bone_shield_3:0.94%
  • bone_shield_4:4.80%
  • bone_shield_5:33.13%
  • bone_shield_6:32.88%
  • bone_shield_7:27.82%
  • bone_shield_8:0.00%
  • bone_shield_9:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:195181
  • name:Bone Shield
  • tooltip:Armor increased by ${$w1*$STR/100}. Haste increased by $w4%.
  • description:Surrounds you with a barrier of whirling bones, increasing Armor by ${{$s1=40}*$STR/100}, and your Haste by {$s4=10}%. Each melee attack against you consumes a charge. Lasts {$d=30 seconds} or until all charges are consumed.
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Scourge 15.3 1.1 19.6sec 18.3sec 6.69% 0.00% 1.1(1.1) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_crimson_scourge
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • crimson_scourge_1:6.69%

Trigger Attempt Success

  • trigger_pct:25.57%

Spelldata details

  • id:81141
  • name:Crimson Scourge
  • tooltip:Your next Death and Decay costs no Runes and generates no Runic Power.
  • description:{$@spelldesc81136=Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spell details

  • id:81136
  • name:Crimson Scourge
  • tooltip:
  • description:Your auto attacks on targets infected with your Blood Plague have a chance to make your next Death and Decay cost no runes and reset its cooldown.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
Critical Prowess 1.0 151.6 0.0sec 2.0sec 100.00% 0.00% 147.6(147.6) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_critical_prowess
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Syringe of Bloodborne Infirmity

Stat Buff details

  • stat:crit_rating
  • amount:101.29

Stack Uptimes

  • critical_prowess_1:0.43%
  • critical_prowess_2:0.62%
  • critical_prowess_3:0.45%
  • critical_prowess_4:0.44%
  • critical_prowess_5:98.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278108
  • name:Critical Prowess
  • tooltip:Increases your Critical Strike by $w1.
  • description:
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Dancing Rune Weapon 3.0 0.0 120.3sec 120.3sec 7.98% 9.38% 0.0(0.0) 2.9

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_dancing_rune_weapon
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dancing_rune_weapon_1:7.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81256
  • name:Dancing Rune Weapon
  • tooltip:Parry chance increased by {$s1=40}%.
  • description:{$@spelldesc49028=Summons a rune weapon for {$s4=8} sec that mirrors your melee attacks and bolsters your defenses. While active, you gain {$81256s1=40}% parry chance.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.7 0.2 73.9sec 65.7sec 9.07% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:9.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.2sec 65.9sec 8.98% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:8.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 74.5sec 65.9sec 8.89% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:8.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 74.8sec 66.6sec 9.03% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Undertow 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_flask_of_the_undertow
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:238.00

Stack Uptimes

  • flask_of_the_undertow_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251839
  • name:Flask of the Undertow
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Hemostasis 39.6 16.6 7.6sec 5.3sec 67.20% 87.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_hemostasis
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.08
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • hemostasis_1:50.22%
  • hemostasis_2:15.73%
  • hemostasis_3:0.90%
  • hemostasis_4:0.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:273947
  • name:Hemostasis
  • tooltip:Damage and healing done by your next Death Strike increased by {$s1=8}%.
  • description:{$@spelldesc273946=Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:273946
  • name:Hemostasis
  • tooltip:
  • description:Each enemy hit by Blood Boil increases the damage and healing done by your next Death Strike by {$273947s1=8}%, stacking up to {$273947u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Incite the Pack 4.1 1.5 67.4sec 45.8sec 31.06% 0.00% 1.5(1.5) 3.8

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_incite_the_pack
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:665.00

Stack Uptimes

  • incite_the_pack_1:31.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280412
  • name:Incite the Pack
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc280410=You occasionally loose a tremendous roar, increasing your Mastery by {$s1=0} and granting {$s2=0} Mastery to up to $280413i nearby allies. Lasts {$280412d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 5.1 0.0 58.0sec 35.9sec 39.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.53%
  • overwhelming_power_2:1.53%
  • overwhelming_power_3:1.54%
  • overwhelming_power_4:1.55%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.55%
  • overwhelming_power_7:1.56%
  • overwhelming_power_8:1.57%
  • overwhelming_power_9:1.57%
  • overwhelming_power_10:1.57%
  • overwhelming_power_11:1.58%
  • overwhelming_power_12:1.59%
  • overwhelming_power_13:1.59%
  • overwhelming_power_14:1.60%
  • overwhelming_power_15:1.60%
  • overwhelming_power_16:1.61%
  • overwhelming_power_17:1.61%
  • overwhelming_power_18:1.62%
  • overwhelming_power_19:1.62%
  • overwhelming_power_20:1.63%
  • overwhelming_power_21:1.63%
  • overwhelming_power_22:1.64%
  • overwhelming_power_23:1.65%
  • overwhelming_power_24:1.68%
  • overwhelming_power_25:0.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 100.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (swamp_fish_n_chips) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_swamp_fish_n_chips
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:70.00

Stack Uptimes

  • swamp_fish_n_chips_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:257415
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=70} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Unholy Strength 8.7 15.0 35.6sec 12.6sec 73.78% 72.03% 15.0(15.0) 8.0

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_unholy_strength
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • unholy_strength_1:73.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:53365
  • name:Unholy Strength
  • tooltip:Strength increased by {$s1=15}%.
  • description:Affixes your rune weapon with a rune that has a chance to heal you for {$53365s2=6}% and increase total Strength by {$53365s1=15}% for {$53365d=15 seconds}.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 25.6 27.4 11.9sec 5.7sec 66.30% 0.00% 2.0(2.0) 24.9

Buff details

  • buff initial source:T22_Death_Knight_Blood
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:32.06%
  • unstable_flames_2:16.50%
  • unstable_flames_3:8.51%
  • unstable_flames_4:4.44%
  • unstable_flames_5:4.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
parry_haste 33.1 8.7sec
Rune ready 130.2 2.6sec
Bloodworms 28.4 10.6sec

Rune waste details (experimental)

In the table below, "Seconds per Rune" denotes the time in seconds an individual rune is wasting regeneration. The "Total Seconds per Iteration" denotes the cumulative time in seconds all runes wasted during a single iteration.

Seconds per Rune (n=36040)
Minimum 5th percentile Mean / Median 95th percentile Maximum
0.0010.0051.397 / 1.2653.1275.075
Total Seconds per Iteration (n=7501)
Minimum 5th percentile Mean / Median 95th percentile Maximum
5.4775.6036.712 / 6.5278.48714.149

Resources

Resource Usage Type Count Total Average RPE APR
T22_Death_Knight_Blood
death_strike Runic Power 44.4 1789.3 40.3 40.3 305.7
heart_strike Rune 87.2 87.2 1.0 1.0 3247.0
marrowrend Rune 23.7 47.3 2.0 2.0 2518.5
pet - dancing_rune_weapon
death_strike Runic Power 3.8 172.0 45.0 45.0 91.4
heart_strike Rune 7.8 7.8 1.0 1.0 1150.2
marrowrend Rune 3.7 7.5 2.0 2.0 895.0
Resource Gains Type Count Total Average Overflow
death_strike_heal Health 44.44 12929.91 (72.89%) 290.96 1076550.42 98.81%
marrowrend Runic Power 23.67 467.23 (25.77%) 19.74 6.23 1.32%
heart_strike Runic Power 87.15 1307.30 (72.10%) 15.00 0.00 0.00%
unholy_strength Health 23.68 4810.09 (27.11%) 203.16 446486.62 98.93%
Rune Regeneration Rune 122.20 122.20 (93.83%) 1.00 0.00 0.00%
Rune Weapon Heart Strike Runic Power 7.75 38.76 (2.14%) 5.00 0.00 0.00%
Rune Strike Rune 8.04 8.04 (6.17%) 1.00 0.00 0.00%
pet - dancing_rune_weapon
rune_strike Rune 2.00 0.00 (0.00%) 0.00 2.00 100.00%
Resource RPS-Gain RPS-Loss
Health 59.13 0.00
Runic Power 6.04 5.96
Rune 0.43 0.45
Combat End Resource Mean Min Max
Runic Power 24.31 0.00 75.00
Rune 1.73 0.00 4.00

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 1.1%

Statistics & Data Analysis

Fight Length
Sample Data T22_Death_Knight_Blood Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Death_Knight_Blood Damage Per Second
Count 7499
Mean 9139.56
Minimum 8302.30
Maximum 10114.58
Spread ( max - min ) 1812.28
Range [ ( max - min ) / 2 * 100% ] 9.91%
Standard Deviation 238.1844
5th Percentile 8762.16
95th Percentile 9544.09
( 95th Percentile - 5th Percentile ) 781.93
Mean Distribution
Standard Deviation 2.7505
95.00% Confidence Intervall ( 9134.17 - 9144.95 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2609
0.1 Scale Factor Error with Delta=300 485
0.05 Scale Factor Error with Delta=300 1938
0.01 Scale Factor Error with Delta=300 48430
Priority Target DPS
Sample Data T22_Death_Knight_Blood Priority Target Damage Per Second
Count 7499
Mean 9139.56
Minimum 8302.30
Maximum 10114.58
Spread ( max - min ) 1812.28
Range [ ( max - min ) / 2 * 100% ] 9.91%
Standard Deviation 238.1844
5th Percentile 8762.16
95th Percentile 9544.09
( 95th Percentile - 5th Percentile ) 781.93
Mean Distribution
Standard Deviation 2.7505
95.00% Confidence Intervall ( 9134.17 - 9144.95 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2609
0.1 Scale Factor Error with Delta=300 485
0.05 Scale Factor Error with Delta=300 1938
0.01 Scale Factor Error with Delta=300 48430
DPS(e)
Sample Data T22_Death_Knight_Blood Damage Per Second (Effective)
Count 7499
Mean 9139.56
Minimum 8302.30
Maximum 10114.58
Spread ( max - min ) 1812.28
Range [ ( max - min ) / 2 * 100% ] 9.91%
Damage
Sample Data T22_Death_Knight_Blood Damage
Count 7499
Mean 2421483.70
Minimum 1837882.61
Maximum 3026785.03
Spread ( max - min ) 1188902.42
Range [ ( max - min ) / 2 * 100% ] 24.55%
DTPS
Sample Data T22_Death_Knight_Blood Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS
Sample Data T22_Death_Knight_Blood Healing Per Second
Count 7499
Mean 59.94
Minimum 49.28
Maximum 73.91
Spread ( max - min ) 24.63
Range [ ( max - min ) / 2 * 100% ] 20.55%
Standard Deviation 7.0350
5th Percentile 50.11
95th Percentile 72.11
( 95th Percentile - 5th Percentile ) 22.00
Mean Distribution
Standard Deviation 0.0812
95.00% Confidence Intervall ( 59.78 - 60.10 )
Normalized 95.00% Confidence Intervall ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 530
0.1% Error 52915
0.1 Scale Factor Error with Delta=300 1
0.05 Scale Factor Error with Delta=300 2
0.01 Scale Factor Error with Delta=300 43
HPS(e)
Sample Data T22_Death_Knight_Blood Healing Per Second (Effective)
Count 7499
Mean 59.94
Minimum 49.28
Maximum 73.91
Spread ( max - min ) 24.63
Range [ ( max - min ) / 2 * 100% ] 20.55%
Heal
Sample Data T22_Death_Knight_Blood Heal
Count 7499
Mean 17740.00
Minimum 17740.00
Maximum 17740.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Death_Knight_Blood Healing Taken Per Second
Count 7499
Mean 59.94
Minimum 49.28
Maximum 73.91
Spread ( max - min ) 24.63
Range [ ( max - min ) / 2 * 100% ] 20.55%
TMI
Sample Data T22_Death_Knight_Blood Theck-Meloree Index
Count 7499
Mean 52211.79
Minimum 50569.22
Maximum 53699.58
Spread ( max - min ) 3130.36
Range [ ( max - min ) / 2 * 100% ] 3.00%
Standard Deviation 394.8836
5th Percentile 51513.32
95th Percentile 52822.47
( 95th Percentile - 5th Percentile ) 1309.15
Mean Distribution
Standard Deviation 4.5600
95.00% Confidence Intervall ( 52202.85 - 52220.72 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 3
0.1% Error 220
0.1 Scale Factor Error with Delta=300 1332
0.05 Scale Factor Error with Delta=300 5325
0.01 Scale Factor Error with Delta=300 133114
ETMI
Sample Data T22_Death_Knight_BloodTheck-Meloree Index (Effective)
Count 7499
Mean 60981.52
Minimum 60932.67
Maximum 61015.55
Spread ( max - min ) 82.88
Range [ ( max - min ) / 2 * 100% ] 0.07%
MSD
Sample Data T22_Death_Knight_Blood Max Spike Value
Count 3825
Mean 0.00
Minimum -0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 383.67%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 10.59 mind_freeze
0.00 blood_fury,if=cooldown.dancing_rune_weapon.ready&(!cooldown.blooddrinker.ready|!talent.blooddrinker.enabled)
0.00 berserking
0.00 use_items
7 1.00 potion,if=buff.dancing_rune_weapon.up
8 2.99 dancing_rune_weapon,if=!talent.blooddrinker.enabled|!cooldown.blooddrinker.ready
0.00 tombstone,if=buff.bone_shield.stack>=7
9 0.00 call_action_list,name=standard
actions.standard
# count action,conditions
A 28.71 death_strike,if=runic_power.deficit<=10
0.00 blooddrinker,if=!buff.dancing_rune_weapon.up
B 1.24 marrowrend,if=(buff.bone_shield.remains<=rune.time_to_3|buff.bone_shield.remains<=(gcd+cooldown.blooddrinker.ready*talent.blooddrinker.enabled*2)|buff.bone_shield.stack<3)&runic_power.deficit>=20
C 4.44 blood_boil,if=charges_fractional>=1.8&(buff.hemostasis.stack<=(5-spell_targets.blood_boil)|spell_targets.blood_boil>2)
D 22.43 marrowrend,if=buff.bone_shield.stack<5&talent.ossuary.enabled&runic_power.deficit>=15
0.00 bonestorm,if=runic_power>=100&!buff.dancing_rune_weapon.up
E 15.73 death_strike,if=runic_power.deficit<=(15+buff.dancing_rune_weapon.up*5+spell_targets.heart_strike*talent.heartbreaker.enabled*2)|target.time_to_die<10
0.00 death_and_decay,if=spell_targets.death_and_decay>=3
F 2.00 rune_strike,if=(charges_fractional>=1.8|buff.dancing_rune_weapon.up)&rune.time_to_3>=gcd
G 22.59 heart_strike,if=buff.dancing_rune_weapon.up|rune.time_to_4<gcd
H 0.58 blood_boil,if=buff.dancing_rune_weapon.up
I 15.20 death_and_decay,if=buff.crimson_scourge.up|talent.rapid_decomposition.enabled|spell_targets.death_and_decay>=2
0.00 consumption
J 51.20 blood_boil
K 64.56 heart_strike,if=rune.time_to_3<gcd|buff.bone_shield.stack>6
L 6.04 rune_strike
0.00 arcane_torrent,if=runic_power.deficit>20

Sample Sequence

012458B6CDDFCGFGICDAJKKJKAKJKEGJKKAJDIKEJGKJKA6DJKEIKJLGKAJKDEKJIGJKAKDEJKIJ6GKADJKJKALJIDKAJKGKAJKDAJKKKA6JK87DAHGGAGICJKELDJKKAJGKDAJK6JKAJGKKADIJKEJGJKDAKJLKEKJ6DKAJGIJGDAJK6KAJGIJGDAKJKAL6JKGKAJKGDAJ8GEGGEGC6IJKKADJJK6GAJGKEDIJKLJKAGKEDJKJ6EEKEJGKKD

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Death_Knight_Blood 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune
Pre precombat 1 food T22_Death_Knight_Blood 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune
Pre precombat 2 augmentation T22_Death_Knight_Blood 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune
Pre precombat 4 potion Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/303400: 100% health | 6.0/6: 100% rune battle_potion_of_strength
0:00.000 default 5 auto_attack Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/304280: 100% health | 6.0/6: 100% rune resounding_protection, archive_of_the_titans, battle_potion_of_strength
0:00.000 default 8 dancing_rune_weapon Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/304280: 100% health | 6.0/6: 100% rune resounding_protection, archive_of_the_titans, critical_prowess, battle_potion_of_strength
0:01.265 standard B marrowrend Fluffy_Pillow 0.0/125: 0% runic_power | 303400.0/304280: 100% health | 6.0/6: 100% rune bloodlust, dancing_rune_weapon, resounding_protection, archive_of_the_titans, critical_prowess, battle_potion_of_strength
0:02.241 default 6 mind_freeze Fluffy_Pillow 20.0/125: 16% runic_power | 304280.0/304280: 100% health | 4.0/6: 67% rune bloodlust, bone_shield(3), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(24), archive_of_the_titans, critical_prowess(2), battle_potion_of_strength
0:02.241 standard C blood_boil Fluffy_Pillow 20.0/125: 16% runic_power | 304280.0/304280: 100% health | 4.0/6: 67% rune bloodlust, bone_shield(3), dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(24), archive_of_the_titans, critical_prowess(2), battle_potion_of_strength
0:03.066 standard D marrowrend Fluffy_Pillow 20.0/125: 16% runic_power | 304280.0/304280: 100% health | 4.0/6: 67% rune bloodlust, bone_shield(3), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(23), archive_of_the_titans, critical_prowess(2), battle_potion_of_strength
0:03.893 standard D marrowrend Fluffy_Pillow 40.0/125: 32% runic_power | 304280.0/304280: 100% health | 2.0/6: 33% rune bloodlust, bone_shield(3), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(23), archive_of_the_titans, critical_prowess(3), battle_potion_of_strength
0:04.721 standard F rune_strike Fluffy_Pillow 60.0/125: 48% runic_power | 304280.0/304280: 100% health | 0.0/6: 0% rune bloodlust, bone_shield(6), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(22), archive_of_the_titans, critical_prowess(4), battle_potion_of_strength
0:05.552 standard C blood_boil Fluffy_Pillow 60.0/125: 48% runic_power | 304280.0/305160: 100% health | 1.0/6: 17% rune bloodlust, bone_shield(6), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(21), archive_of_the_titans(2), critical_prowess(4), battle_potion_of_strength
0:06.385 standard G heart_strike Fluffy_Pillow 60.0/125: 48% runic_power | 305160.0/305160: 100% health | 1.0/6: 17% rune bloodlust, bone_shield(5), crimson_scourge, dancing_rune_weapon, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(20), archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:07.219 standard F rune_strike Fluffy_Pillow 80.0/125: 64% runic_power | 305160.0/305160: 100% health | 2.0/6: 33% rune bloodlust, bone_shield(5), crimson_scourge, dancing_rune_weapon, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(19), archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:08.056 standard G heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 305160.0/305160: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(5), crimson_scourge, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(18), archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:08.893 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 305160.0/305160: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(5), crimson_scourge, hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, elemental_whirl_mastery, overwhelming_power(18), archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:09.732 standard C blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 305160.0/305160: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, elemental_whirl_mastery, overwhelming_power(17), archive_of_the_titans(2), critical_prowess(5), battle_potion_of_strength
0:10.575 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 305160.0/306060: 100% health | 3.0/6: 50% rune bloodlust, bone_shield(4), hemostasis(3), unholy_strength, resounding_protection, elemental_whirl_versatility, elemental_whirl_mastery, overwhelming_power(16), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:11.420 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 305160.0/306060: 100% health | 1.0/6: 17% rune bloodlust, bone_shield(7), hemostasis(3), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(15), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:12.267 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 306060.0/306060: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(14), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:13.117 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 306060.0/306060: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(13), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:13.971 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 306060.0/306060: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), overwhelming_power(13), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:14.823 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 306060.0/306060: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), overwhelming_power(12), archive_of_the_titans(3), critical_prowess(5), battle_potion_of_strength
0:15.678 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 306060.0/306940: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), overwhelming_power(11), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:16.535 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 306060.0/306940: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), overwhelming_power(10), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:17.394 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 306940.0/306940: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), overwhelming_power(9), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:18.256 Waiting     0.600 sec 95.0/125: 76% runic_power | 306940.0/306940: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(8), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:18.856 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 306940.0/306940: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames(2), overwhelming_power(8), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:19.926 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 306940.0/306940: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, overwhelming_power(7), archive_of_the_titans(4), critical_prowess(5), battle_potion_of_strength
0:20.793 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 306940.0/307820: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, overwhelming_power(6), archive_of_the_titans(5), critical_prowess(5), battle_potion_of_strength
0:21.664 Waiting     1.300 sec 70.0/125: 56% runic_power | 307820.0/307820: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), resounding_protection, overwhelming_power(5), archive_of_the_titans(5), critical_prowess(5), battle_potion_of_strength
0:22.964 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 307820.0/307820: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), resounding_protection, overwhelming_power(4), archive_of_the_titans(5), critical_prowess(5), battle_potion_of_strength
0:23.839 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 307820.0/307820: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(6), resounding_protection, unstable_flames, overwhelming_power(3), archive_of_the_titans(5), critical_prowess(5)
0:24.716 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 307820.0/307820: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames, overwhelming_power(2), archive_of_the_titans(5), critical_prowess(5)
0:25.597 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 307820.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames, overwhelming_power, archive_of_the_titans(6), critical_prowess(5)
0:26.480 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 307820.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(6), critical_prowess(5)
0:27.366 Waiting     0.200 sec 75.0/125: 60% runic_power | 308720.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), resounding_protection, unstable_flames, archive_of_the_titans(6), critical_prowess(5)
0:27.566 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 308720.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), resounding_protection, unstable_flames, archive_of_the_titans(6), critical_prowess(5)
0:28.678 standard D marrowrend Fluffy_Pillow 75.0/125: 60% runic_power | 308720.0/308720: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(4), hemostasis, resounding_protection, unstable_flames(2), archive_of_the_titans(6), critical_prowess(5)
0:29.565 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 308720.0/308720: 100% health | 0.0/6: 0% rune bloodlust, blood_shield, bone_shield(7), crimson_scourge, hemostasis, resounding_protection, unstable_flames(2), archive_of_the_titans(6), critical_prowess(5)
0:30.451 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 308720.0/309600: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames(3), archive_of_the_titans(7), critical_prowess(5)
0:31.336 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 309600.0/309600: 100% health | 1.0/6: 17% rune bloodlust, blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(7), critical_prowess(5)
0:32.224 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 309600.0/309600: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(7), critical_prowess(5)
0:33.110 Waiting     1.600 sec 70.0/125: 56% runic_power | 309600.0/309600: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(7), critical_prowess(5)
0:34.710 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 309600.0/309600: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(7), critical_prowess(5)
0:35.597 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 309600.0/310500: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(8), critical_prowess(5)
0:36.455 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 309600.0/310500: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(8), critical_prowess(5)
0:37.432 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 309600.0/310500: 100% health | 3.0/6: 50% rune bloodlust, blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(8), critical_prowess(5)
0:38.290 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 309600.0/310500: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(8), critical_prowess(5)
0:39.149 Waiting     0.900 sec 75.0/125: 60% runic_power | 310500.0/310500: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(8), critical_prowess(5)
0:40.049 default 6 mind_freeze Fluffy_Pillow 75.0/125: 60% runic_power | 310500.0/311380: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(4), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(9), critical_prowess(5)
0:40.049 standard D marrowrend Fluffy_Pillow 75.0/125: 60% runic_power | 310500.0/311380: 100% health | 2.0/6: 33% rune bloodlust, blood_shield, bone_shield(4), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(9), critical_prowess(5)
0:40.907 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 310500.0/311380: 100% health | 0.0/6: 0% rune bloodlust, blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(9), critical_prowess(5)
0:41.767 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 310500.0/311380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(9), critical_prowess(5)
0:42.883 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 310500.0/311380: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, archive_of_the_titans(9), critical_prowess(5)
0:43.996 standard I death_and_decay Fluffy_Pillow 70.0/125: 56% runic_power | 311380.0/311380: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), crimson_scourge, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, archive_of_the_titans(9), critical_prowess(5)
0:45.112 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 311380.0/312260: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, archive_of_the_titans(10), critical_prowess(5)
0:46.226 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 311380.0/312260: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(10), critical_prowess(5)
0:47.538 standard L rune_strike Fluffy_Pillow 85.0/125: 68% runic_power | 311380.0/312260: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(10), critical_prowess(5)
0:48.689 standard G heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 311380.0/312260: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(10), critical_prowess(5)
0:49.841 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 311380.0/312260: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(10), critical_prowess(5)
0:50.991 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 311380.0/313160: 99% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(11), critical_prowess(5)
0:52.143 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 313160.0/313160: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(11), critical_prowess(5)
0:53.295 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 313160.0/313160: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(11), critical_prowess(5)
0:54.446 standard D marrowrend Fluffy_Pillow 90.0/125: 72% runic_power | 313160.0/313160: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(11), critical_prowess(5)
0:55.598 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 313160.0/314040: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(12), critical_prowess(5)
0:56.750 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 314040.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, archive_of_the_titans(12), critical_prowess(5)
0:57.900 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 314040.0/314040: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, archive_of_the_titans(12), critical_prowess(5)
0:59.049 Waiting     2.100 sec 85.0/125: 68% runic_power | 314040.0/314040: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, archive_of_the_titans(12), critical_prowess(5)
1:01.149 standard I death_and_decay Fluffy_Pillow 85.0/125: 68% runic_power | 314040.0/314920: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(13), critical_prowess(5)
1:02.301 Waiting     0.700 sec 85.0/125: 68% runic_power | 314040.0/314920: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(13), critical_prowess(5)
1:03.001 standard G heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 314040.0/314920: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(13), critical_prowess(5)
1:04.152 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 314040.0/314920: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(13), critical_prowess(5)
1:05.303 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 314040.0/315820: 99% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(14), critical_prowess(5)
1:06.455 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 315820.0/315820: 100% health | 2.0/6: 33% rune bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(14), critical_prowess(5)
1:07.607 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 315820.0/315820: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_crit, archive_of_the_titans(14), critical_prowess(5)
1:08.761 standard D marrowrend Fluffy_Pillow 90.0/125: 72% runic_power | 315820.0/315820: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(14), critical_prowess(5)
1:09.912 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 315820.0/315820: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(14), critical_prowess(5)
1:11.064 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 315820.0/316700: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(15), critical_prowess(5)
1:12.214 Waiting     1.000 sec 70.0/125: 56% runic_power | 315820.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(15), critical_prowess(5)
1:13.214 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 315820.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(15), critical_prowess(5)
1:14.365 Waiting     0.500 sec 85.0/125: 68% runic_power | 315820.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(15), critical_prowess(5)
1:14.865 standard I death_and_decay Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/316700: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(15), critical_prowess(5)
1:16.013 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(16), critical_prowess(5)
1:17.163 default 6 mind_freeze Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(16), critical_prowess(5)
1:17.163 Waiting     1.200 sec 85.0/125: 68% runic_power | 316700.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), archive_of_the_titans(16), critical_prowess(5)
1:18.363 standard G heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 316700.0/317580: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(16), critical_prowess(5)
1:19.514 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 316700.0/317580: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(16), critical_prowess(5)
1:20.665 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 316700.0/318480: 99% health | 2.0/6: 33% rune bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(17), critical_prowess(5)
1:21.816 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 318480.0/318480: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(17), critical_prowess(5)
1:22.968 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 318480.0/318480: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(17), critical_prowess(5)
1:24.120 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 318480.0/318480: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(17), critical_prowess(5)
1:25.272 Waiting     1.100 sec 105.0/125: 84% runic_power | 318480.0/319360: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(18), critical_prowess(5)
1:26.372 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 318480.0/319360: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(18), critical_prowess(5)
1:27.686 Waiting     0.800 sec 105.0/125: 84% runic_power | 319360.0/319360: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(18), critical_prowess(5)
1:28.486 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 319360.0/319360: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(2), archive_of_the_titans(18), critical_prowess(5)
1:29.639 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 319360.0/319360: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), overwhelming_power(24), archive_of_the_titans(18), critical_prowess(5)
1:30.710 standard L rune_strike Fluffy_Pillow 80.0/125: 64% runic_power | 319360.0/320240: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, incite_the_pack, unstable_flames(3), overwhelming_power(23), archive_of_the_titans(19), critical_prowess(5)
1:31.797 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 319360.0/320240: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames(3), overwhelming_power(22), archive_of_the_titans(19), critical_prowess(5)
1:33.094 standard I death_and_decay Fluffy_Pillow 80.0/125: 64% runic_power | 319360.0/320240: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, unholy_strength, resounding_protection, unstable_flames(3), overwhelming_power(20), archive_of_the_titans(19), critical_prowess(5)
1:34.178 standard D marrowrend Fluffy_Pillow 80.0/125: 64% runic_power | 319360.0/320240: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, overwhelming_power(18), archive_of_the_titans(19), critical_prowess(5)
1:35.267 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 320240.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
1:36.359 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 320240.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
1:37.456 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
1:38.557 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
1:39.661 Waiting     0.900 sec 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
1:40.561 standard G heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
1:41.671 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
1:42.782 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
1:43.897 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5)
1:45.017 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
1:46.146 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
1:47.277 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(5), archive_of_the_titans(20), critical_prowess(5)
1:48.412 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5)
1:49.711 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5)
1:50.851 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5)
1:51.996 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, overwhelming_power, archive_of_the_titans(20), critical_prowess(5)
1:53.144 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
1:54.296 default 6 mind_freeze Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), resounding_protection, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
1:54.296 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), resounding_protection, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
1:55.448 Waiting     2.700 sec 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
1:58.148 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
1:59.300 Waiting     0.500 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
1:59.800 default 8 dancing_rune_weapon Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
2:01.154 default 7 potion Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), dancing_rune_weapon, hemostasis, resounding_protection, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
2:01.154 standard D marrowrend Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), dancing_rune_weapon, hemostasis, resounding_protection, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:02.305 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), dancing_rune_weapon, hemostasis, resounding_protection, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:03.457 standard H blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), dancing_rune_weapon, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:04.609 standard G heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:05.724 standard G heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:06.839 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:07.953 standard G heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:09.068 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), crimson_scourge, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:10.183 standard C blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:11.297 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:12.411 Waiting     0.700 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:13.111 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:14.226 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:15.378 standard L rune_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:16.529 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:17.681 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:18.832 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:19.984 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:21.134 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:22.285 Waiting     0.100 sec 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_mastery, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:22.385 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_mastery, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:23.786 Waiting     2.100 sec 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:25.886 standard G heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5), battle_potion_of_strength
2:27.038 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
2:28.190 standard D marrowrend Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:29.340 standard A death_strike Fluffy_Pillow 125.0/125: 100% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:30.490 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:31.640 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
2:32.792 default 6 mind_freeze Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
2:32.792 Waiting     1.100 sec 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:33.892 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
2:35.256 Waiting     0.700 sec 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), resounding_protection, unstable_flames, overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
2:35.956 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), resounding_protection, unstable_flames, overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
2:37.029 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), resounding_protection, unstable_flames, overwhelming_power(22), archive_of_the_titans(20), critical_prowess(5)
2:38.107 Waiting     1.200 sec 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), resounding_protection, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
2:39.307 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
2:40.545 Waiting     0.200 sec 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
2:40.745 standard G heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
2:41.800 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(18), archive_of_the_titans(20), critical_prowess(5)
2:42.858 Waiting     0.200 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
2:43.058 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, unstable_flames, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
2:44.122 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
2:45.190 standard D marrowrend Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
2:46.260 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), crimson_scourge, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
2:47.334 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
2:48.410 Waiting     0.500 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
2:48.910 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, incite_the_pack, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
2:49.989 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, incite_the_pack, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
2:51.107 standard J blood_boil Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5)
2:52.230 Waiting     3.000 sec 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, unstable_flames, overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
2:55.230 standard G heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, unstable_flames(2), overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5)
2:56.367 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, incite_the_pack, unstable_flames(2), overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5)
2:57.508 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), resounding_protection, incite_the_pack, overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5)
2:58.653 standard D marrowrend Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, overwhelming_power, archive_of_the_titans(20), critical_prowess(5)
2:59.801 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
3:00.951 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
3:02.101 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:03.252 standard L rune_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:04.403 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:05.554 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:06.704 standard K heart_strike Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:07.854 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:09.008 Waiting     0.100 sec 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:09.108 default 6 mind_freeze Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:09.108 Waiting     0.900 sec 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:10.008 standard D marrowrend Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:11.159 Waiting     0.400 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:11.559 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:12.712 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:13.863 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:15.015 Waiting     3.100 sec 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:18.115 standard G heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:19.266 standard I death_and_decay Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:20.418 standard J blood_boil Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:21.569 standard G heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:22.721 standard D marrowrend Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
3:23.872 standard A death_strike Fluffy_Pillow 125.0/125: 100% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune bone_shield(7), hemostasis(2), unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
3:25.023 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(4), archive_of_the_titans(20), critical_prowess(5)
3:26.174 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:27.325 default 6 mind_freeze Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:27.325 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:28.475 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:29.627 Waiting     0.300 sec 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:29.927 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, unstable_flames(5), archive_of_the_titans(20), critical_prowess(5)
3:31.271 Waiting     2.100 sec 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:33.371 standard G heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:34.524 standard I death_and_decay Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:35.675 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:37.005 standard G heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis(2), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:38.156 standard D marrowrend Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), hemostasis(2), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:39.309 standard A death_strike Fluffy_Pillow 125.0/125: 100% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune bone_shield(7), hemostasis(2), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:40.461 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:41.614 standard J blood_boil Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:42.765 Waiting     0.800 sec 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:43.565 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:44.715 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
3:45.868 standard L rune_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
3:47.021 default 6 mind_freeze Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_haste, overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
3:47.021 standard J blood_boil Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), unholy_strength, resounding_protection, elemental_whirl_haste, overwhelming_power(23), archive_of_the_titans(20), critical_prowess(5)
3:48.223 standard K heart_strike Fluffy_Pillow 75.0/125: 60% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, overwhelming_power(22), archive_of_the_titans(20), critical_prowess(5)
3:49.268 standard G heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
3:50.318 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
3:51.368 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_haste, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
3:52.423 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, unstable_flames, overwhelming_power(18), archive_of_the_titans(20), critical_prowess(5)
3:53.482 standard K heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, unstable_flames(2), overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
3:54.544 Waiting     0.900 sec 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, unstable_flames(2), overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
3:55.444 standard G heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, elemental_whirl_haste, unstable_flames(2), overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
3:56.510 standard D marrowrend Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(2), overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
3:57.616 standard A death_strike Fluffy_Pillow 125.0/125: 100% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
3:58.726 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
3:59.839 default 8 dancing_rune_weapon Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), crimson_scourge, hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
4:01.120 standard G heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames, overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5)
4:02.245 standard E death_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, dancing_rune_weapon, hemostasis, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(2), overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
4:03.373 standard G heart_strike Fluffy_Pillow 65.0/125: 52% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(2), overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
4:04.503 standard G heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(2), overwhelming_power(5), archive_of_the_titans(20), critical_prowess(5)
4:05.638 standard E death_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(3), overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5)
4:06.776 standard G heart_strike Fluffy_Pillow 65.0/125: 52% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(3), overwhelming_power(3), archive_of_the_titans(20), critical_prowess(5)
4:07.918 standard C blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, dancing_rune_weapon, unholy_strength, resounding_protection, elemental_whirl_crit, unstable_flames(3), overwhelming_power(2), archive_of_the_titans(20), critical_prowess(5)
4:09.062 default 6 mind_freeze Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:09.062 standard I death_and_decay Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(6), crimson_scourge, hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:10.214 standard J blood_boil Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, unstable_flames(3), archive_of_the_titans(20), critical_prowess(5)
4:11.365 standard K heart_strike Fluffy_Pillow 85.0/125: 68% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, archive_of_the_titans(20), critical_prowess(5)
4:12.517 Waiting     0.400 sec 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:12.917 standard K heart_strike Fluffy_Pillow 100.0/125: 80% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:14.069 standard A death_strike Fluffy_Pillow 115.0/125: 92% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis(2), unholy_strength, resounding_protection, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:15.221 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:16.374 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:17.527 Waiting     2.800 sec 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), hemostasis, unholy_strength, resounding_protection, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:20.327 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:21.651 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:22.803 Waiting     1.100 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:23.903 default 6 mind_freeze Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:24.062 Waiting     1.600 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:25.662 standard G heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:26.813 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:27.967 standard J blood_boil Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:29.118 standard G heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:30.270 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:31.421 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), crimson_scourge, hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, archive_of_the_titans(20), critical_prowess(5)
4:32.571 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), crimson_scourge, unholy_strength, resounding_protection, elemental_whirl_versatility, elemental_whirl_mastery, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:33.723 standard I death_and_decay Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(7), crimson_scourge, unholy_strength, resounding_protection, elemental_whirl_mastery, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:34.875 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(7), unholy_strength, resounding_protection, elemental_whirl_mastery, incite_the_pack, unstable_flames, archive_of_the_titans(20), critical_prowess(5)
4:36.027 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_mastery, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:37.179 standard L rune_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, elemental_whirl_mastery, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:38.329 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, elemental_whirl_mastery, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:39.482 standard K heart_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(6), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, elemental_whirl_mastery, incite_the_pack, unstable_flames(2), archive_of_the_titans(20), critical_prowess(5)
4:40.634 standard A death_strike Fluffy_Pillow 120.0/125: 96% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis(2), unholy_strength, resounding_protection, elemental_whirl_versatility, elemental_whirl_mastery, overwhelming_power(24), archive_of_the_titans(20), critical_prowess(5)
4:41.706 standard G heart_strike Fluffy_Pillow 80.0/125: 64% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), unholy_strength, resounding_protection, elemental_whirl_versatility, overwhelming_power(22), archive_of_the_titans(20), critical_prowess(5)
4:42.785 standard K heart_strike Fluffy_Pillow 95.0/125: 76% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(21), archive_of_the_titans(20), critical_prowess(5)
4:43.867 standard E death_strike Fluffy_Pillow 110.0/125: 88% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(20), archive_of_the_titans(20), critical_prowess(5)
4:44.951 standard D marrowrend Fluffy_Pillow 70.0/125: 56% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(4), resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(19), archive_of_the_titans(20), critical_prowess(5)
4:46.039 standard J blood_boil Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), resounding_protection, elemental_whirl_versatility, unstable_flames, overwhelming_power(17), archive_of_the_titans(20), critical_prowess(5)
4:47.133 standard K heart_strike Fluffy_Pillow 90.0/125: 72% runic_power | 321140.0/321140: 100% health | 1.0/6: 17% rune blood_shield, bone_shield(7), hemostasis, resounding_protection, unstable_flames, overwhelming_power(16), archive_of_the_titans(20), critical_prowess(5)
4:48.230 Waiting     0.200 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
4:48.430 standard J blood_boil Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 0.0/6: 0% rune blood_shield, bone_shield(6), hemostasis, resounding_protection, overwhelming_power(15), archive_of_the_titans(20), critical_prowess(5)
4:49.718 default 6 mind_freeze Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), resounding_protection, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
4:49.718 Waiting     0.300 sec 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), resounding_protection, elemental_whirl_versatility, overwhelming_power(14), archive_of_the_titans(20), critical_prowess(5)
4:50.018 standard E death_strike Fluffy_Pillow 105.0/125: 84% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), hemostasis(2), resounding_protection, elemental_whirl_versatility, overwhelming_power(13), archive_of_the_titans(20), critical_prowess(5)
4:51.122 standard E death_strike Fluffy_Pillow 65.0/125: 52% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(6), resounding_protection, elemental_whirl_versatility, overwhelming_power(12), archive_of_the_titans(20), critical_prowess(5)
4:52.233 standard K heart_strike Fluffy_Pillow 25.0/125: 20% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_versatility, incite_the_pack, overwhelming_power(11), archive_of_the_titans(20), critical_prowess(5)
4:53.347 standard E death_strike Fluffy_Pillow 40.0/125: 32% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_versatility, incite_the_pack, overwhelming_power(10), archive_of_the_titans(20), critical_prowess(5)
4:54.463 standard J blood_boil Fluffy_Pillow 0.0/125: 0% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), resounding_protection, elemental_whirl_versatility, incite_the_pack, overwhelming_power(9), archive_of_the_titans(20), critical_prowess(5)
4:55.583 standard G heart_strike Fluffy_Pillow 0.0/125: 0% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, overwhelming_power(8), archive_of_the_titans(20), critical_prowess(5)
4:56.706 standard K heart_strike Fluffy_Pillow 15.0/125: 12% runic_power | 321140.0/321140: 100% health | 3.0/6: 50% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, overwhelming_power(7), archive_of_the_titans(20), critical_prowess(5)
4:57.834 Waiting     0.100 sec 30.0/125: 24% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
4:57.934 standard K heart_strike Fluffy_Pillow 30.0/125: 24% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(5), hemostasis, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames, overwhelming_power(6), archive_of_the_titans(20), critical_prowess(5)
4:59.064 standard D marrowrend Fluffy_Pillow 45.0/125: 36% runic_power | 321140.0/321140: 100% health | 2.0/6: 33% rune blood_shield, bone_shield(4), hemostasis, unholy_strength, resounding_protection, elemental_whirl_versatility, incite_the_pack, unstable_flames(2), overwhelming_power(4), archive_of_the_titans(20), critical_prowess(5)

Stats

Level Bonus (120) Race Bonus (undead) Raid-Buffed Unbuffed Gear Amount
Strength 1467 2 5842 5544 4075 (3433)
Agility 1467 -1 1526 1466 0
Stamina 1001 1 15170 13791 7207
Intellect 1467 -2 1677 1465 0
Spirit 0 0 0 0 0
Health 303400 275820 0
Runic Power 125 125 0
Rune 6 6 0
Crit 17.08% 17.08% 870
Haste 18.87% 17.84% 1213
Damage / Heal Versatility 4.69% 4.69% 399
Mitigation Versatility 2.35% 2.35% 399
Attack Power 7562 6524 0
Mastery 35.36% 35.36% 697
Armor 4663 4663 4055
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 6.00% 6.00% 0
Tank-Parry 22.43% 22.00% 870
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 386.00
Local Head Gridrunner Galea
ilevel: 390, stats: { 571 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Azerite Empowered, Incite the Pack, Elemental Whirl, Resounding Protection }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Chitinspine Pauldrons
ilevel: 390, stats: { 527 Armor, +491 StrInt, +892 Sta }
azerite powers: { Azerite Empowered, Archive of the Titans, Overwhelming Power, Runic Barrier }
Local Chest Chestguard of Virulent Mutagens
ilevel: 390, stats: { 702 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Azerite Empowered, Archive of the Titans, Unstable Flames, Resounding Protection }
Local Waist Decontaminator's Greatbelt
ilevel: 385, stats: { 382 Armor, +247 StrInt, +417 Sta, +123 Mastery, +60 Crit }
Local Legs Greaves of Unending Vigil
ilevel: 385, stats: { 594 Armor, +329 StrInt, +556 Sta, +165 Haste, +81 Mastery }
Local Feet Warboots of Absolute Eradication
ilevel: 385, stats: { 467 Armor, +247 StrInt, +417 Sta, +111 Haste, +72 Vers }
Local Wrists Imperious Vambraces
ilevel: 385, stats: { 297 Armor, +185 StrInt, +312 Sta, +83 Vers, +54 Haste }
Local Hands Waste Disposal Crushers
ilevel: 385, stats: { 424 Armor, +247 StrInt, +417 Sta, +115 Crit, +68 Vers }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Syringe of Bloodborne Infirmity
ilevel: 385, stats: { +313 Str }
Local Trinket2 Vanquished Tendril of G'huun
ilevel: 385, stats: { +176 Vers }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Khor, Hammer of the Corrupted
ilevel: 385, weapon: { 778 - 1003, 3.6 }, stats: { +329 Str, +556 Sta, +142 Crit, +103 Haste }, enchant: rune_of_the_fallen_crusader

Talents

Level
15 Heartbreaker (Blood Death Knight) Blooddrinker (Blood Death Knight) Rune Strike (Blood Death Knight)
30 Rapid Decomposition (Blood Death Knight) Hemostasis (Blood Death Knight) Consumption (Blood Death Knight)
45 Foul Bulwark (Blood Death Knight) Ossuary (Blood Death Knight) Tombstone (Blood Death Knight)
60 Will of the Necropolis (Blood Death Knight) Anti-Magic Barrier (Blood Death Knight) Rune Tap (Blood Death Knight)
75 Grip of the Dead (Blood Death Knight) Tightening Grasp (Blood Death Knight) Wraith Walk (Blood Death Knight)
90 Voracious (Blood Death Knight) Bloodworms (Blood Death Knight) Mark of Blood (Blood Death Knight)
100 Purgatory (Blood Death Knight) Red Thirst (Blood Death Knight) Bonestorm (Blood Death Knight)

Profile

deathknight="T22_Death_Knight_Blood"
spec=blood
level=120
race=undead
role=tank
position=front
talents=3222022

# Default consumables
potion=battle_potion_of_strength
flask=flask_of_the_undertow
food=swamp_fish_n_chips
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/mind_freeze
actions+=/blood_fury,if=cooldown.dancing_rune_weapon.ready&(!cooldown.blooddrinker.ready|!talent.blooddrinker.enabled)
actions+=/berserking
actions+=/use_items
actions+=/potion,if=buff.dancing_rune_weapon.up
actions+=/dancing_rune_weapon,if=!talent.blooddrinker.enabled|!cooldown.blooddrinker.ready
actions+=/tombstone,if=buff.bone_shield.stack>=7
actions+=/call_action_list,name=standard

actions.standard=death_strike,if=runic_power.deficit<=10
actions.standard+=/blooddrinker,if=!buff.dancing_rune_weapon.up
actions.standard+=/marrowrend,if=(buff.bone_shield.remains<=rune.time_to_3|buff.bone_shield.remains<=(gcd+cooldown.blooddrinker.ready*talent.blooddrinker.enabled*2)|buff.bone_shield.stack<3)&runic_power.deficit>=20
actions.standard+=/blood_boil,if=charges_fractional>=1.8&(buff.hemostasis.stack<=(5-spell_targets.blood_boil)|spell_targets.blood_boil>2)
actions.standard+=/marrowrend,if=buff.bone_shield.stack<5&talent.ossuary.enabled&runic_power.deficit>=15
actions.standard+=/bonestorm,if=runic_power>=100&!buff.dancing_rune_weapon.up
actions.standard+=/death_strike,if=runic_power.deficit<=(15+buff.dancing_rune_weapon.up*5+spell_targets.heart_strike*talent.heartbreaker.enabled*2)|target.time_to_die<10
actions.standard+=/death_and_decay,if=spell_targets.death_and_decay>=3
actions.standard+=/rune_strike,if=(charges_fractional>=1.8|buff.dancing_rune_weapon.up)&rune.time_to_3>=gcd
actions.standard+=/heart_strike,if=buff.dancing_rune_weapon.up|rune.time_to_4<gcd
actions.standard+=/blood_boil,if=buff.dancing_rune_weapon.up
actions.standard+=/death_and_decay,if=buff.crimson_scourge.up|talent.rapid_decomposition.enabled|spell_targets.death_and_decay>=2
actions.standard+=/consumption
actions.standard+=/blood_boil
actions.standard+=/heart_strike,if=rune.time_to_3<gcd|buff.bone_shield.stack>6
actions.standard+=/rune_strike
actions.standard+=/arcane_torrent,if=runic_power.deficit>20

head=gridrunner_galea,id=160634,bonus_id=4824/1507/4775,azerite_powers=13/481/21/15
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=chitinspine_pauldrons,id=160641,bonus_id=4824/1507/4775,azerite_powers=13/483/30/201
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=chestguard_of_virulent_mutagens,id=160636,bonus_id=4824/1507/4775,azerite_powers=13/483/459/15
wrists=imperious_vambraces,id=160723,bonus_id=4800/1507
hands=waste_disposal_crushers,id=160635,bonus_id=4800/1507
waist=decontaminators_greatbelt,id=160638,bonus_id=4800/1507
legs=greaves_of_unending_vigil,id=160639,bonus_id=4800/1507
feet=warboots_of_absolute_eradication,id=160640,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=syringe_of_bloodborne_infirmity,id=160655,bonus_id=4800/1507
trinket2=vanquished_tendril_of_ghuun,id=160654,bonus_id=4800/1507
main_hand=khor_hammer_of_the_corrupted,id=160679,bonus_id=4800/1507,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_ilvl=386.27
# gear_strength=4075
# gear_stamina=7207
# gear_crit_rating=870
# gear_haste_rating=1213
# gear_mastery_rating=697
# gear_versatility_rating=399
# gear_armor=4055

T22_Hunter_Beast_Mastery : 16133 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16132.7 16132.7 10.5 / 0.065% 1786.1 / 11.1% 408.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.1 15.9 Focus 9.89% 45.1 100.0% 100%
Talents
  • 15: Killer Instinct (Beast Mastery Hunter)
  • 30: Chimaera Shot (Beast Mastery Hunter)
  • 60: A Murder of Crows (Beast Mastery Hunter)
  • 90: Stomp (Beast Mastery Hunter)
  • 100: Aspect of the Beast (Beast Mastery Hunter)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Hunter_Beast_Mastery 16133
A Murder of Crows 1278 7.9% 5.5 60.59sec 69981 55894 Periodic 85.3 3319 7139 4478 30.3% 26.6%

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 0.00 85.26 85.26 1.2522 0.9360 381813.06 545847.62 30.05 4407.04 55894.17
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.4 69.66% 3319.46 2049 5075 3327.16 2848 3830 197163 281868 30.05
crit 25.9 30.34% 7139.13 4098 10149 7157.32 5672 9057 184650 263980 30.05
 
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target, dealing ${{$131900s1=0}*16} Physical damage over {$d=15 seconds}. If the target dies while under attack, A Murder of Crows' cooldown is reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=0} physical damage.
 
Auto Shot 1902 11.8% 119.8 2.51sec 4757 1909 Direct 119.5 3721 7581 4768 27.1%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.77 119.52 0.00 0.00 2.4921 0.0000 569821.97 814628.93 30.05 1909.02 1909.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.10 72.88% 3720.58 3221 5168 3722.44 3551 3910 324076 463306 30.05
crit 32.42 27.12% 7580.78 6442 10336 7585.86 6889 8393 245746 351323 30.05
 
 

Action details: auto_shot

Static Values
  • id:75
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:60.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Azerite Globules 132 0.8% 13.2 22.36sec 2987 0 Direct 13.2 2386 4776 2987 25.1%  

Stats details: azerite_globules

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.23 13.23 0.00 0.00 0.0000 0.0000 39517.37 39517.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.90 74.85% 2386.50 2341 2567 2386.74 2341 2491 23630 23630 0.00
crit 3.33 25.15% 4776.06 4683 5133 4648.45 0 5133 15887 15887 0.00
 
 

Action details: azerite_globules

Static Values
  • id:279958
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279958
  • name:Azerite Globules
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2200.00
  • base_dd_max:2200.00
 
Barbed Shot 300 (881) 1.9% (5.5%) 37.1 8.08sec 7109 5803 Periodic 131.1 686 0 686 0.0% 87.4%

Stats details: barbed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.11 0.00 131.13 131.13 1.2250 2.0000 89893.63 128513.74 30.05 857.41 5803.36
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.1 100.00% 685.55 655 839 685.84 673 695 89894 128514 30.05
 
 

Action details: barbed_shot

Static Values
  • id:217200
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pet.cat.buff.frenzy.up&pet.cat.buff.frenzy.remains<=gcd.max
Spelldata
  • id:217200
  • name:Barbed Shot
  • school:physical
  • tooltip:Suffering $sw1 damage every $t1 sec.
  • description:Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Stomp (cat) 582 3.6% 37.1 8.08sec 4687 0 Direct 37.1 3562 7634 4687 27.6%  

Stats details: stomp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.11 37.11 0.00 0.00 0.0000 0.0000 173944.62 248674.72 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.86 72.37% 3561.98 2700 6685 3567.06 2974 4368 95670 136772 30.05
crit 10.25 27.63% 7633.75 5399 13371 7659.37 5399 13371 78275 111903 30.05
 
 

Action details: stomp

Static Values
  • id:201754
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201754
  • name:Stomp
  • school:physical
  • tooltip:
  • description:{$@spelldesc199530=When you cast Barbed Shot, your pet stomps the ground, dealing $<damage> Physical damage to all nearby enemies.}
 
Chimaera Shot 0 (828) 0.0% (5.1%) 23.2 13.09sec 10674 8708

Stats details: chimaera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.24 0.00 0.00 0.00 1.2258 0.0000 0.00 0.00 0.00 8708.07 8708.07
 
 

Action details: chimaera_shot

Static Values
  • id:53209
  • school:froststrike
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53209
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. |cFFFFFFFFGenerates {$204304s1=10} Focus for each target hit.|r
 
    Chimaera Shot (_frost) 414 2.6% 0.0 0.00sec 0 0 Direct 11.6 8354 17088 10710 27.0%  

Stats details: chimaera_shot_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 11.58 0.00 0.00 0.0000 0.0000 124033.62 124033.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.46 73.02% 8353.63 7112 11384 8355.79 7112 10553 70647 70647 0.00
crit 3.12 26.98% 17087.87 14225 22768 16661.33 0 22768 53387 53387 0.00
 
 

Action details: chimaera_shot_frost

Static Values
  • id:171454
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171454
  • name:Chimaera Shot
  • school:frost
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. |cFFFFFFFFGenerates {$204304s1=10} Focus for each target hit.|r}
 
    Chimaera Shot (_nature) 414 2.6% 0.0 0.00sec 0 0 Direct 11.6 8354 17082 10706 27.0%  

Stats details: chimaera_shot_nature

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 11.58 0.00 0.00 0.0000 0.0000 124007.06 124007.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.46 73.05% 8353.67 7112 11384 8354.36 7112 10015 70680 70680 0.00
crit 3.12 26.95% 17082.10 14225 22768 16684.82 0 22768 53327 53327 0.00
 
 

Action details: chimaera_shot_nature

Static Values
  • id:171457
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:171457
  • name:Chimaera Shot
  • school:nature
  • tooltip:
  • description:{$@spelldesc53209=A two-headed shot that hits your primary target and another nearby target, dealing $171457sw2 Nature damage to one and $171454sw2 Frost damage to the other. |cFFFFFFFFGenerates {$204304s1=10} Focus for each target hit.|r}
 
Cobra Shot 1514 9.4% 86.3 3.43sec 5256 4326 Direct 86.1 4091 8361 5272 27.6%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.31 86.05 0.00 0.00 1.2149 0.0000 453650.05 648547.23 30.05 4326.29 4326.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.26 72.35% 4091.29 3470 5554 4093.54 3895 4324 254736 364175 30.05
crit 23.79 27.65% 8361.03 6939 11107 8368.81 7457 9533 198915 284372 30.05
 
 

Action details: cobra_shot

Static Values
  • id:193455
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(active_enemies<2|cooldown.kill_command.remains>focus.time_to_max)&(buff.bestial_wrath.up&active_enemies>1|cooldown.kill_command.remains>1+gcd&cooldown.bestial_wrath.remains>focus.time_to_max|focus-cost+focus.regen*(cooldown.kill_command.remains-1)>action.kill_command.cost)
Spelldata
  • id:193455
  • name:Cobra Shot
  • school:physical
  • tooltip:
  • description:A quick shot causing ${{$s2=0}*$<mult>} Physical damage. Reduces the cooldown of Kill Command by {$s3=1} sec.
 
Frenetic Blow (frentic_blow) 253 1.6% 3.0 81.20sec 25538 0 Direct 3.0 20443 40888 25538 24.9%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 2.98 0.00 0.00 0.0000 0.0000 76078.47 108763.30 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.24 75.08% 20442.82 20147 22086 19420.42 0 22086 45724 65368 28.55
crit 0.74 24.92% 40888.15 40294 44172 22365.67 0 44172 30354 43395 16.43
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Heed My Call 282 (403) 1.8% (2.5%) 6.7 40.23sec 17957 0 Direct 6.7 10046 20093 12567 25.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.73 6.73 0.00 0.00 0.0000 0.0000 84571.12 84571.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.04 74.92% 10046.43 9833 10779 10035.46 0 10779 50656 50656 0.00
crit 1.69 25.08% 20092.75 19667 21559 16500.87 0 21559 33916 33916 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9240.00
  • base_dd_max:9240.00
 
    Heed My Call (_aoe) 121 0.8% 6.7 40.23sec 5391 0 Direct 6.7 4306 8611 5391 25.2%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.73 6.73 0.00 0.00 0.0000 0.0000 36279.86 36279.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.03 74.80% 4305.60 4214 4620 4289.42 0 4620 21674 21674 0.00
crit 1.70 25.20% 8611.25 8429 9240 7112.23 0 9240 14605 14605 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3960.00
  • base_dd_max:3960.00
 
Kill Command 0 (3029) 0.0% (18.8%) 55.3 5.42sec 16412 13441

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.26 0.00 0.00 0.00 1.2210 0.0000 0.00 0.00 0.00 13440.67 13440.67
 
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:7.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to the enemy.
 
    Kill Command (cat) 3029 18.8% 55.3 5.42sec 16412 0 Direct 55.3 12539 26705 16412 27.3%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.26 55.26 0.00 0.00 0.0000 0.0000 906962.72 1296612.12 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.16 72.66% 12539.28 8197 31118 12547.58 10839 14281 503534 719863 30.05
crit 15.11 27.34% 26704.65 16395 62236 26742.55 17553 35878 403429 576749 30.05
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to the enemy.}
 
pet - cat 9523 / 9523
Claw 2992 18.6% 83.8 3.60sec 10688 10640 Direct 83.8 8187 17435 10688 27.0%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.85 83.85 0.00 0.00 1.0045 0.0000 896195.64 1281219.30 30.05 10640.24 10640.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.17 72.95% 8186.81 6353 16247 8196.00 7246 8987 500791 715941 30.05
crit 22.68 27.05% 17434.89 12706 32495 17473.39 13737 22761 395404 565278 30.05
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 2920 18.1% 289.1 1.03sec 3024 2918 Direct 289.1 2318 4926 3024 27.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 289.09 289.09 0.00 0.00 1.0363 0.0000 874204.57 1249780.42 30.05 2918.01 2918.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 210.80 72.92% 2317.63 1800 4457 2320.12 2182 2493 488554 698447 30.05
crit 78.29 27.08% 4925.81 3600 8914 4933.33 4355 5972 385650 551333 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
T22_Hunter_Beast_Mastery
Aspect of the Wild 3.0 120.78sec

Stats details: aspect_of_the_wild

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 0.7566 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_wild

Static Values
  • id:193530
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.3000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:193530
  • name:Aspect of the Wild
  • school:physical
  • tooltip:Gaining {$s2=5} Focus per sec. Critical Strike chance increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=5} Focus per sec and {$s1=10}% increased critical strike chance for {$d=20 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Beast_Mastery
  • harmful:false
  • if_expr:
 
Bestial Wrath 8.4 37.93sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.40 0.00 0.00 0.00 1.2120 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bestial_wrath.up
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by $w1%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=15 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=12} sec each time you use Barbed Shot.][]
 
Blood Fury 3.0 120.86sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.bestial_wrath.remains>30
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=400} for {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Beast_Mastery
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Beast_Mastery
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Wild 3.0 0.0 121.0sec 120.8sec 19.47% 0.00% 57.9(57.9) 2.8

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stack Uptimes

  • aspect_of_the_wild_1:19.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Gaining {$s2=5} Focus per sec. Critical Strike chance increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=5} Focus per sec and {$s1=10}% increased critical strike chance for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Barbed Shot (_1) 20.0 0.0 15.2sec 15.2sec 52.80% 0.00% 78.9(78.9) 19.5

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_barbed_shot_1
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • barbed_shot_1_1:52.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:246152
  • name:Barbed Shot
  • tooltip:Generating ${$w1*{$d=8 seconds}/$t1} Focus over {$d=8 seconds}.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Barbed Shot (_2) 16.7 0.0 17.8sec 17.8sec 44.15% 0.00% 65.9(65.9) 16.3

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_barbed_shot_2
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • barbed_shot_2_1:44.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:246152
  • name:Barbed Shot
  • tooltip:Generating ${$w1*{$d=8 seconds}/$t1} Focus over {$d=8 seconds}.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Barbed Shot (_3) 0.3 0.0 139.1sec 139.1sec 0.73% 0.00% 1.0(1.0) 0.2

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_barbed_shot_3
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • barbed_shot_3_1:0.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:246152
  • name:Barbed Shot
  • tooltip:Generating ${$w1*{$d=8 seconds}/$t1} Focus over {$d=8 seconds}.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Barbed Shot (_4) 0.0 0.0 0.0sec 0.0sec 0.02% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_barbed_shot_4
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Stack Uptimes

  • barbed_shot_4_1:0.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:246152
  • name:Barbed Shot
  • tooltip:Generating ${$w1*{$d=8 seconds}/$t1} Focus over {$d=8 seconds}.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Potion of Agility 2.0 0.0 136.1sec 0.0sec 15.85% 0.00% 0.0(0.0) 1.9

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:15.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bestial Wrath 8.4 0.0 37.9sec 37.9sec 40.96% 0.00% 0.0(0.0) 8.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bestial_wrath_1:40.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by $w1%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=15 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=12} sec each time you use Barbed Shot.][]
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
Blood Fury 3.0 0.0 120.9sec 120.9sec 14.63% 0.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:attack_power
  • amount:400.00

Stack Uptimes

  • blood_fury_1:14.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $w1.
  • description:Increases your attack power by {$s1=400} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 4.7 10.6 67.7sec 19.2sec 75.46% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:28.61%
  • frothing_rage_2:25.13%
  • frothing_rage_3:21.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Golden Luster 3.0 0.0 120.3sec 120.3sec 19.55% 0.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_golden_luster
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Lustrous Golden Plumage

Stat Buff details

  • stat:versatility_rating
  • amount:828.62

Stack Uptimes

  • golden_luster_1:19.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271107
  • name:Golden Luster
  • tooltip:Versatility increased by $w1.
  • description:Increase your Versatility by {$s1=781} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Primal Instincts 3.0 0.0 121.0sec 120.8sec 19.47% 0.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_primal_instincts
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:2937.00

Stack Uptimes

  • primal_instincts_1:19.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279810
  • name:Primal Instincts
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc279806=Aspect of the Wild increases your Mastery by {$s1=0}, and grants you a charge of Barbed Shot.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spell details

  • id:279806
  • name:Primal Instincts
  • tooltip:
  • description:Aspect of the Wild increases your Mastery by {$s1=0}, and grants you a charge of Barbed Shot.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Quick Navigation 6.2 23.1 52.3sec 10.4sec 69.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.98%
  • quick_navigation_2:17.59%
  • quick_navigation_3:17.07%
  • quick_navigation_4:16.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.3sec 52.3sec 18.05% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
cat: Bestial Wrath 8.4 0.0 37.9sec 37.9sec 40.96% 0.00% 0.0(0.0) 8.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bestial_wrath_1:40.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:186254
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc19574=Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=15 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=12} sec each time you use Barbed Shot.][]}
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
cat: Frenzy 7.9 29.3 40.0sec 8.1sec 85.98% 0.00% 17.0(17.0) 7.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery_cat
  • cooldown name:buff_frenzy
  • max_stacks:3
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • frenzy_1:17.56%
  • frenzy_2:17.37%
  • frenzy_3:51.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:272790
  • name:Frenzy
  • tooltip:Attack speed increased by {$s1=30}%.
  • description:{$@spelldesc217200=Fire a shot that tears through your enemy, causing them to bleed for ${{$s1=0}*{$d=8 seconds}/$t1} damage over {$d=8 seconds}. Sends your pet into a frenzy, increasing attack speed by {$272790s1=30}% for {$272790d=8 seconds}, stacking up to {$272790u=3} times. |cFFFFFFFFGenerates ${{$246152s1=5}*{$246152d=8 seconds}/$246152t1} Focus over {$246152d=8 seconds}.|r}
  • max_stacks:3
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
starved: a_murder_of_crows 1.1 7.2sec
wild_call 6.5 39.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Aspect of the Wild1.2560.0013.9851.9740.0007.362
Barbed Shot1.0710.0016.4095.7920.00021.145
A Murder of Crows0.7690.0014.1172.7560.0008.275
Bestial Wrath1.1100.0015.0047.2560.94914.200
Chimaera Shot0.7260.0016.32711.6723.65928.023
Kill Command1.1190.0017.89537.19516.28064.875

Resources

Resource Usage Type Count Total Average RPE APR
T22_Hunter_Beast_Mastery
a_murder_of_crows Focus 5.5 163.7 30.0 30.0 2332.8
cobra_shot Focus 86.3 3020.8 35.0 35.0 150.2
kill_command Focus 55.3 1657.9 30.0 30.0 547.1
pet - cat
claw Focus 83.8 4192.5 50.0 50.0 213.8
Resource Gains Type Count Total Average Overflow
aspect_of_the_wild Focus 57.92 288.16 (6.04%) 4.97 1.46 0.50%
barbed_shot Focus 145.86 727.34 (15.24%) 4.99 1.96 0.27%
chimaera_shot_frost Focus 11.62 111.01 (2.33%) 9.55 5.18 4.46%
chimaera_shot_nature Focus 11.62 110.96 (2.32%) 9.55 5.23 4.51%
focus_regen Focus 764.17 3535.67 (74.07%) 4.63 37.18 1.04%
pet - cat
focus_regen Focus 547.57 3933.35 (94.47%) 7.18 536.59 12.00%
aspect_of_the_wild Focus 57.92 230.10 (5.53%) 3.97 59.53 20.55%
Resource RPS-Gain RPS-Loss
Focus 15.91 16.14
Combat End Resource Mean Min Max
Focus 50.89 0.03 120.00

Benefits & Uptimes

Benefits %
killer_instinct 33.0%
cat-wild_hunt 100.0%
Uptimes %
Focus Cap 0.6%
cat-Focus Cap 5.9%

Statistics & Data Analysis

Fight Length
Sample Data T22_Hunter_Beast_Mastery Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Hunter_Beast_Mastery Damage Per Second
Count 7499
Mean 16132.74
Minimum 14722.59
Maximum 18025.11
Spread ( max - min ) 3302.51
Range [ ( max - min ) / 2 * 100% ] 10.24%
Standard Deviation 464.0744
5th Percentile 15400.15
95th Percentile 16923.25
( 95th Percentile - 5th Percentile ) 1523.10
Mean Distribution
Standard Deviation 5.3590
95.00% Confidence Intervall ( 16122.24 - 16143.25 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3179
0.1 Scale Factor Error with Delta=300 1839
0.05 Scale Factor Error with Delta=300 7354
0.01 Scale Factor Error with Delta=300 183848
Priority Target DPS
Sample Data T22_Hunter_Beast_Mastery Priority Target Damage Per Second
Count 7499
Mean 16132.74
Minimum 14722.59
Maximum 18025.11
Spread ( max - min ) 3302.51
Range [ ( max - min ) / 2 * 100% ] 10.24%
Standard Deviation 464.0744
5th Percentile 15400.15
95th Percentile 16923.25
( 95th Percentile - 5th Percentile ) 1523.10
Mean Distribution
Standard Deviation 5.3590
95.00% Confidence Intervall ( 16122.24 - 16143.25 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3179
0.1 Scale Factor Error with Delta=300 1839
0.05 Scale Factor Error with Delta=300 7354
0.01 Scale Factor Error with Delta=300 183848
DPS(e)
Sample Data T22_Hunter_Beast_Mastery Damage Per Second (Effective)
Count 7499
Mean 16132.74
Minimum 14722.59
Maximum 18025.11
Spread ( max - min ) 3302.51
Range [ ( max - min ) / 2 * 100% ] 10.24%
Damage
Sample Data T22_Hunter_Beast_Mastery Damage
Count 7499
Mean 1979666.20
Minimum 1420380.98
Maximum 2576468.80
Spread ( max - min ) 1156087.82
Range [ ( max - min ) / 2 * 100% ] 29.20%
DTPS
Sample Data T22_Hunter_Beast_Mastery Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Hunter_Beast_Mastery Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Hunter_Beast_Mastery Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Hunter_Beast_Mastery Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Hunter_Beast_Mastery Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Hunter_Beast_Mastery Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Hunter_Beast_MasteryTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Hunter_Beast_Mastery Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 summon_pet
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion
6 0.00 aspect_of_the_wild
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
0.00 counter_shot,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
8 2.99 use_items
0.00 berserking,if=cooldown.bestial_wrath.remains>30
9 2.97 blood_fury,if=cooldown.bestial_wrath.remains>30
0.00 ancestral_call,if=cooldown.bestial_wrath.remains>30
0.00 fireblood,if=cooldown.bestial_wrath.remains>30
0.00 lights_judgment
A 0.97 potion,if=buff.bestial_wrath.up&buff.aspect_of_the_wild.up
B 24.49 barbed_shot,if=pet.cat.buff.frenzy.up&pet.cat.buff.frenzy.remains<=gcd.max
C 5.46 a_murder_of_crows
0.00 spitting_cobra
0.00 stampede,if=buff.bestial_wrath.up|cooldown.bestial_wrath.remains<gcd|target.time_to_die<15
D 1.98 aspect_of_the_wild
E 8.40 bestial_wrath,if=!buff.bestial_wrath.up
0.00 multishot,if=spell_targets>2&(pet.cat.buff.beast_cleave.remains<gcd.max|pet.cat.buff.beast_cleave.down)
F 23.24 chimaera_shot
G 55.28 kill_command
0.00 dire_beast
H 12.62 barbed_shot,if=pet.cat.buff.frenzy.down&charges_fractional>1.4|full_recharge_time<gcd.max|target.time_to_die<9
0.00 multishot,if=spell_targets>1&(pet.cat.buff.beast_cleave.remains<gcd.max|pet.cat.buff.beast_cleave.down)
I 86.31 cobra_shot,if=(active_enemies<2|cooldown.kill_command.remains>focus.time_to_max)&(buff.bestial_wrath.up&active_enemies>1|cooldown.kill_command.remains>1+gcd&cooldown.bestial_wrath.remains>focus.time_to_max|focus-cost+focus.regen*(cooldown.kill_command.remains-1)>action.kill_command.cost)

Sample Sequence

01235678CE9FGHIIGIIGIBFIGIIGIBGFHIGIIGIBEFGHIIGIGFHIIGIIBGIFBCGIIBEGIFIGIGHIFGIBIGIBGFIIBGIIBEFGIIIGI8DAC9HGFIIGBIHIGIIFBGIIGBEIIFGIIGHIGIBFGIIBGIGBFCIGBEIIGBFIIGBIIGIBFGIIGIGIFHGIEBGIIFGB8DI9CGHIIGFIBIGIIBEGIFIGIIGHIGFBIIGIIGIFGHIHG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Hunter_Beast_Mastery 120.0/120: 100% focus
Pre precombat 1 augmentation T22_Hunter_Beast_Mastery 120.0/120: 100% focus
Pre precombat 2 food T22_Hunter_Beast_Mastery 120.0/120: 100% focus
Pre precombat 3 summon_pet Fluffy_Pillow 120.0/120: 100% focus
Pre precombat 5 potion Fluffy_Pillow 120.0/120: 100% focus battle_potion_of_agility
Pre precombat 6 aspect_of_the_wild Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_wild, primal_instincts, battle_potion_of_agility
0:00.000 default 7 start_auto_shot Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_wild, primal_instincts, battle_potion_of_agility
0:00.000 default 8 use_items Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_wild, primal_instincts, battle_potion_of_agility
0:00.000 default C a_murder_of_crows Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_wild, primal_instincts, battle_potion_of_agility, golden_luster
0:01.167 default E bestial_wrath Fluffy_Pillow 108.7/120: 91% focus bloodlust, aspect_of_the_wild, primal_instincts, quick_navigation, battle_potion_of_agility, golden_luster
0:02.058 default 9 blood_fury Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, primal_instincts, quick_navigation, battle_potion_of_agility, golden_luster
0:02.058 default F chimaera_shot Fluffy_Pillow 120.0/120: 100% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, primal_instincts, quick_navigation, battle_potion_of_agility, golden_luster
0:02.951 default G kill_command Fluffy_Pillow 120.0/120: 100% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, primal_instincts, quick_navigation, battle_potion_of_agility, golden_luster
0:03.843 default H barbed_shot Fluffy_Pillow 108.1/120: 90% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, primal_instincts, quick_navigation, battle_potion_of_agility, golden_luster
0:04.735 default I cobra_shot Fluffy_Pillow 120.0/120: 100% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, quick_navigation(2), battle_potion_of_agility, golden_luster
0:05.622 default I cobra_shot Fluffy_Pillow 103.1/120: 86% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, quick_navigation(2), battle_potion_of_agility, golden_luster
0:06.508 default G kill_command Fluffy_Pillow 91.1/120: 76% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
0:07.393 default I cobra_shot Fluffy_Pillow 79.2/120: 66% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
0:08.279 default I cobra_shot Fluffy_Pillow 67.2/120: 56% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
0:09.166 Waiting     0.200 sec 50.3/120: 42% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
0:09.366 default G kill_command Fluffy_Pillow 53.2/120: 44% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
0:10.486 default I cobra_shot Fluffy_Pillow 49.8/120: 41% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:11.366 default B barbed_shot Fluffy_Pillow 32.8/120: 27% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:12.247 default F chimaera_shot Fluffy_Pillow 55.9/120: 47% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:13.127 default I cobra_shot Fluffy_Pillow 83.9/120: 70% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:14.010 default G kill_command Fluffy_Pillow 72.0/120: 60% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:14.891 default I cobra_shot Fluffy_Pillow 55.1/120: 46% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:15.772 default I cobra_shot Fluffy_Pillow 43.1/120: 36% focus bloodlust, blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:16.653 Waiting     0.300 sec 26.2/120: 22% focus bloodlust, blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:16.953 default G kill_command Fluffy_Pillow 30.6/120: 26% focus bloodlust, blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:17.950 Waiting     0.400 sec 25.4/120: 21% focus bloodlust, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:18.350 default I cobra_shot Fluffy_Pillow 36.3/120: 30% focus bloodlust, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:19.229 default B barbed_shot Fluffy_Pillow 19.4/120: 16% focus bloodlust, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
0:20.110 Waiting     0.800 sec 42.4/120: 35% focus bloodlust, barbed_shot_1, frothing_rage, quick_navigation(3), battle_potion_of_agility
0:20.910 default G kill_command Fluffy_Pillow 54.3/120: 45% focus bloodlust, barbed_shot_1, frothing_rage, quick_navigation(4), battle_potion_of_agility
0:22.131 default F chimaera_shot Fluffy_Pillow 47.5/120: 40% focus bloodlust, barbed_shot_1, frothing_rage, quick_navigation(4), battle_potion_of_agility
0:23.362 default H barbed_shot Fluffy_Pillow 80.9/120: 67% focus bloodlust, barbed_shot_1, frothing_rage, quick_navigation(4)
0:24.372 default I cobra_shot Fluffy_Pillow 96.0/120: 80% focus bloodlust, barbed_shot_1, barbed_shot_2, frothing_rage, quick_navigation(4)
0:25.382 default G kill_command Fluffy_Pillow 86.1/120: 72% focus bloodlust, barbed_shot_1, barbed_shot_2, frothing_rage, quick_navigation(4)
0:26.392 default I cobra_shot Fluffy_Pillow 71.1/120: 59% focus bloodlust, barbed_shot_1, barbed_shot_2, frothing_rage, quick_navigation(4)
0:27.402 default I cobra_shot Fluffy_Pillow 61.2/120: 51% focus bloodlust, barbed_shot_2, frothing_rage, quick_navigation(4)
0:28.411 default G kill_command Fluffy_Pillow 41.3/120: 34% focus bloodlust, barbed_shot_2, frothing_rage, quick_navigation(4)
0:29.421 Waiting     0.300 sec 31.3/120: 26% focus bloodlust, barbed_shot_2, frothing_rage, quick_navigation(4)
0:29.721 default I cobra_shot Fluffy_Pillow 35.8/120: 30% focus bloodlust, barbed_shot_2, frothing_rage, quick_navigation(4)
0:30.730 default B barbed_shot Fluffy_Pillow 15.9/120: 13% focus bloodlust, barbed_shot_2, frothing_rage, quick_navigation(4)
0:31.740 default E bestial_wrath Fluffy_Pillow 35.9/120: 30% focus bloodlust, barbed_shot_1, frothing_rage, quick_navigation(4)
0:32.748 default F chimaera_shot Fluffy_Pillow 56.0/120: 47% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(4)
0:33.755 default G kill_command Fluffy_Pillow 81.0/120: 67% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(4)
0:34.762 default H barbed_shot Fluffy_Pillow 71.0/120: 59% focus bloodlust, bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(4)
0:35.770 default I cobra_shot Fluffy_Pillow 86.1/120: 72% focus bloodlust, bestial_wrath, barbed_shot_1, barbed_shot_2, frothing_rage, quick_navigation(4)
0:36.778 default I cobra_shot Fluffy_Pillow 76.9/120: 64% focus bloodlust, bestial_wrath, barbed_shot_1, barbed_shot_2, frothing_rage(2), quick_navigation_final
0:37.738 default G kill_command Fluffy_Pillow 56.9/120: 47% focus bloodlust, bestial_wrath, barbed_shot_1, barbed_shot_2, frothing_rage(2), quick_navigation_final
0:38.697 default I cobra_shot Fluffy_Pillow 42.0/120: 35% focus bloodlust, bestial_wrath, barbed_shot_1, barbed_shot_2, frothing_rage(3), quick_navigation_final
0:39.657 Waiting     1.800 sec 32.0/120: 27% focus bloodlust, bestial_wrath, barbed_shot_2, frothing_rage(3), quick_navigation_final
0:41.457 default G kill_command Fluffy_Pillow 63.6/120: 53% focus bestial_wrath, barbed_shot_2, quick_navigation_final
0:42.922 default F chimaera_shot Fluffy_Pillow 56.3/120: 47% focus bestial_wrath, quick_navigation_final
0:44.171 default H barbed_shot Fluffy_Pillow 81.4/120: 68% focus bestial_wrath, quick_navigation_final
0:45.418 default I cobra_shot Fluffy_Pillow 96.4/120: 80% focus bestial_wrath, barbed_shot_1, quick_navigation_final
0:46.665 default I cobra_shot Fluffy_Pillow 80.7/120: 67% focus bestial_wrath, barbed_shot_1
0:48.009 default G kill_command Fluffy_Pillow 60.8/120: 51% focus barbed_shot_1, quick_navigation
0:49.346 default I cobra_shot Fluffy_Pillow 50.9/120: 42% focus barbed_shot_1, quick_navigation(2)
0:50.673 default I cobra_shot Fluffy_Pillow 35.9/120: 30% focus barbed_shot_1, quick_navigation(2)
0:52.001 default B barbed_shot Fluffy_Pillow 16.0/120: 13% focus barbed_shot_1, quick_navigation(2)
0:53.329 default G kill_command Fluffy_Pillow 36.0/120: 30% focus barbed_shot_2, quick_navigation(3)
0:54.648 Waiting     0.800 sec 26.1/120: 22% focus barbed_shot_2, quick_navigation(3)
0:55.448 default I cobra_shot Fluffy_Pillow 35.2/120: 29% focus barbed_shot_2, quick_navigation(3)
0:56.768 default F chimaera_shot Fluffy_Pillow 20.3/120: 17% focus barbed_shot_2, quick_navigation(3)
0:58.088 Waiting     0.600 sec 50.3/120: 42% focus barbed_shot_2, quick_navigation(3)
0:58.688 default B barbed_shot Fluffy_Pillow 57.1/120: 48% focus barbed_shot_2, quick_navigation(3)
1:00.006 default C a_murder_of_crows Fluffy_Pillow 77.2/120: 64% focus barbed_shot_1, quick_navigation(3)
1:01.326 default G kill_command Fluffy_Pillow 67.2/120: 56% focus barbed_shot_1, quick_navigation(3)
1:02.646 default I cobra_shot Fluffy_Pillow 52.3/120: 44% focus barbed_shot_1, quick_navigation(3)
1:03.964 default I cobra_shot Fluffy_Pillow 37.3/120: 31% focus barbed_shot_1, quick_navigation(3)
1:05.282 Waiting     0.100 sec 22.3/120: 19% focus barbed_shot_1, quick_navigation(3)
1:05.382 default B barbed_shot Fluffy_Pillow 23.5/120: 20% focus barbed_shot_1, quick_navigation(3)
1:06.703 default E bestial_wrath Fluffy_Pillow 43.6/120: 36% focus barbed_shot_2, quick_navigation(3)
1:08.022 default G kill_command Fluffy_Pillow 63.6/120: 53% focus bestial_wrath, barbed_shot_2, quick_navigation(3)
1:09.342 default I cobra_shot Fluffy_Pillow 48.6/120: 41% focus bestial_wrath, barbed_shot_2, quick_navigation(3)
1:10.661 default F chimaera_shot Fluffy_Pillow 33.7/120: 28% focus bestial_wrath, barbed_shot_2, quick_navigation(3)
1:11.982 default I cobra_shot Fluffy_Pillow 63.8/120: 53% focus bestial_wrath, barbed_shot_2, quick_navigation(3)
1:13.301 default G kill_command Fluffy_Pillow 43.8/120: 36% focus bestial_wrath, barbed_shot_2, quick_navigation(3)
1:14.620 Waiting     0.200 sec 33.8/120: 28% focus bestial_wrath, quick_navigation(3)
1:14.820 default I cobra_shot Fluffy_Pillow 36.1/120: 30% focus bestial_wrath, quick_navigation(3)
1:16.139 Waiting     2.300 sec 16.9/120: 14% focus bestial_wrath, quick_navigation_final
1:18.439 default G kill_command Fluffy_Pillow 44.7/120: 37% focus bestial_wrath, quick_navigation_final
1:19.902 default H barbed_shot Fluffy_Pillow 32.4/120: 27% focus bestial_wrath, quick_navigation_final
1:21.148 default I cobra_shot Fluffy_Pillow 47.4/120: 39% focus bestial_wrath, barbed_shot_1, quick_navigation_final
1:22.394 Waiting     0.700 sec 32.4/120: 27% focus barbed_shot_1, quick_navigation_final
1:23.094 default F chimaera_shot Fluffy_Pillow 40.9/120: 34% focus barbed_shot_1, quick_navigation_final
1:24.572 default G kill_command Fluffy_Pillow 73.7/120: 61% focus barbed_shot_1, quick_navigation_final
1:25.819 default I cobra_shot Fluffy_Pillow 58.0/120: 48% focus barbed_shot_1
1:27.164 default B barbed_shot Fluffy_Pillow 43.0/120: 36% focus barbed_shot_1
1:28.509 default I cobra_shot Fluffy_Pillow 63.1/120: 53% focus barbed_shot_2
1:29.854 default G kill_command Fluffy_Pillow 48.2/120: 40% focus barbed_shot_2, quick_navigation
1:31.191 default I cobra_shot Fluffy_Pillow 38.3/120: 32% focus barbed_shot_2, quick_navigation
1:32.526 Waiting     1.400 sec 18.3/120: 15% focus barbed_shot_2, frothing_rage, quick_navigation
1:33.926 default B barbed_shot Fluffy_Pillow 39.1/120: 33% focus barbed_shot_2, frothing_rage, quick_navigation
1:35.262 Waiting     0.100 sec 59.1/120: 49% focus barbed_shot_1, frothing_rage, quick_navigation
1:35.362 default G kill_command Fluffy_Pillow 60.2/120: 50% focus barbed_shot_1, frothing_rage, quick_navigation
1:36.853 default F chimaera_shot Fluffy_Pillow 52.0/120: 43% focus barbed_shot_1, frothing_rage, quick_navigation
1:38.190 default I cobra_shot Fluffy_Pillow 82.1/120: 68% focus barbed_shot_1, frothing_rage, quick_navigation
1:39.526 default I cobra_shot Fluffy_Pillow 62.1/120: 52% focus barbed_shot_1, frothing_rage, quick_navigation
1:40.862 default B barbed_shot Fluffy_Pillow 47.1/120: 39% focus barbed_shot_1, frothing_rage, quick_navigation
1:42.197 default G kill_command Fluffy_Pillow 67.2/120: 56% focus barbed_shot_2, frothing_rage, quick_navigation
1:43.534 default I cobra_shot Fluffy_Pillow 57.2/120: 48% focus barbed_shot_2, frothing_rage, quick_navigation
1:44.871 Waiting     2.000 sec 42.3/120: 35% focus barbed_shot_2, frothing_rage, quick_navigation
1:46.871 default I cobra_shot Fluffy_Pillow 69.8/120: 58% focus barbed_shot_2, frothing_rage, quick_navigation(2)
1:48.197 default B barbed_shot Fluffy_Pillow 49.8/120: 42% focus barbed_shot_2, frothing_rage, quick_navigation(2)
1:49.523 default E bestial_wrath Fluffy_Pillow 69.8/120: 58% focus barbed_shot_1, frothing_rage, quick_navigation(2)
1:50.852 default F chimaera_shot Fluffy_Pillow 89.9/120: 75% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(2)
1:52.179 default G kill_command Fluffy_Pillow 114.9/120: 96% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(2)
1:53.507 default I cobra_shot Fluffy_Pillow 105.0/120: 87% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(2)
1:54.836 default I cobra_shot Fluffy_Pillow 90.0/120: 75% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(2)
1:56.163 default I cobra_shot Fluffy_Pillow 70.1/120: 58% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(2)
1:57.490 default G kill_command Fluffy_Pillow 55.1/120: 46% focus bestial_wrath, frothing_rage, quick_navigation(2)
1:58.818 default I cobra_shot Fluffy_Pillow 40.2/120: 33% focus bestial_wrath, frothing_rage, quick_navigation(2)
2:00.146 default 8 use_items Fluffy_Pillow 20.2/120: 17% focus bestial_wrath, frothing_rage, quick_navigation(2)
2:00.146 default D aspect_of_the_wild Fluffy_Pillow 20.2/120: 17% focus bestial_wrath, frothing_rage, quick_navigation(2), golden_luster
2:01.300 default A potion Fluffy_Pillow 38.3/120: 32% focus aspect_of_the_wild, bestial_wrath, primal_instincts, frothing_rage, quick_navigation(2), golden_luster
2:01.300 default C a_murder_of_crows Fluffy_Pillow 38.3/120: 32% focus aspect_of_the_wild, bestial_wrath, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
2:02.452 default 9 blood_fury Fluffy_Pillow 26.3/120: 22% focus aspect_of_the_wild, bestial_wrath, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
2:02.452 default H barbed_shot Fluffy_Pillow 26.3/120: 22% focus blood_fury, aspect_of_the_wild, bestial_wrath, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
2:03.604 default G kill_command Fluffy_Pillow 44.4/120: 37% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
2:04.758 default F chimaera_shot Fluffy_Pillow 37.5/120: 31% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
2:05.910 default I cobra_shot Fluffy_Pillow 65.5/120: 55% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(2), battle_potion_of_agility, golden_luster
2:07.063 default I cobra_shot Fluffy_Pillow 53.6/120: 45% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
2:08.206 default G kill_command Fluffy_Pillow 41.6/120: 35% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(3), battle_potion_of_agility, golden_luster
2:09.349 default B barbed_shot Fluffy_Pillow 34.7/120: 29% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation(4), battle_potion_of_agility, golden_luster
2:10.485 default I cobra_shot Fluffy_Pillow 57.7/120: 48% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(4), battle_potion_of_agility, golden_luster
2:11.621 Waiting     0.100 sec 45.8/120: 38% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(4), battle_potion_of_agility, golden_luster
2:11.721 default H barbed_shot Fluffy_Pillow 46.9/120: 39% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation(4), battle_potion_of_agility, golden_luster
2:12.857 Waiting     0.300 sec 65.6/120: 55% focus blood_fury, aspect_of_the_wild, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation_final, battle_potion_of_agility, golden_luster
2:13.157 default I cobra_shot Fluffy_Pillow 74.2/120: 62% focus blood_fury, aspect_of_the_wild, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation_final, battle_potion_of_agility, golden_luster
2:14.240 default G kill_command Fluffy_Pillow 67.3/120: 56% focus blood_fury, aspect_of_the_wild, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation_final, battle_potion_of_agility, golden_luster
2:15.321 default I cobra_shot Fluffy_Pillow 55.4/120: 46% focus blood_fury, aspect_of_the_wild, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation_final, battle_potion_of_agility, golden_luster
2:16.402 default I cobra_shot Fluffy_Pillow 48.4/120: 40% focus blood_fury, aspect_of_the_wild, barbed_shot_1, barbed_shot_2, primal_instincts, quick_navigation_final, battle_potion_of_agility, golden_luster
2:17.484 default F chimaera_shot Fluffy_Pillow 36.5/120: 30% focus aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation_final, battle_potion_of_agility, golden_luster
2:18.647 default B barbed_shot Fluffy_Pillow 70.5/120: 59% focus aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation_final, battle_potion_of_agility, golden_luster
2:19.728 default G kill_command Fluffy_Pillow 93.5/120: 78% focus aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage, quick_navigation_final, battle_potion_of_agility, golden_luster
2:20.808 default I cobra_shot Fluffy_Pillow 86.6/120: 72% focus barbed_shot_2, frothing_rage, quick_navigation_final, battle_potion_of_agility
2:22.054 default I cobra_shot Fluffy_Pillow 66.3/120: 55% focus barbed_shot_2, frothing_rage(2), battle_potion_of_agility
2:23.400 Waiting     0.600 sec 51.4/120: 43% focus barbed_shot_2, frothing_rage(2), battle_potion_of_agility
2:24.000 default G kill_command Fluffy_Pillow 58.1/120: 48% focus barbed_shot_2, frothing_rage(2), battle_potion_of_agility
2:25.545 default B barbed_shot Fluffy_Pillow 50.3/120: 42% focus barbed_shot_2, frothing_rage(2), battle_potion_of_agility
2:26.891 default E bestial_wrath Fluffy_Pillow 70.4/120: 59% focus barbed_shot_1, frothing_rage(2)
2:28.237 default I cobra_shot Fluffy_Pillow 90.5/120: 75% focus bestial_wrath, barbed_shot_1, frothing_rage(2)
2:29.582 default I cobra_shot Fluffy_Pillow 75.6/120: 63% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation(2)
2:30.908 default F chimaera_shot Fluffy_Pillow 55.6/120: 46% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation(2)
2:32.237 default G kill_command Fluffy_Pillow 85.7/120: 71% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation(2)
2:33.565 default I cobra_shot Fluffy_Pillow 75.7/120: 63% focus bestial_wrath, frothing_rage(2), quick_navigation(2)
2:34.892 default I cobra_shot Fluffy_Pillow 55.8/120: 46% focus bestial_wrath, frothing_rage(2), quick_navigation(2)
2:36.219 Waiting     0.400 sec 35.8/120: 30% focus bestial_wrath, frothing_rage(2), quick_navigation(2)
2:36.619 default G kill_command Fluffy_Pillow 40.4/120: 34% focus bestial_wrath, frothing_rage(2), quick_navigation(2)
2:38.185 default H barbed_shot Fluffy_Pillow 28.1/120: 23% focus bestial_wrath, frothing_rage(2), quick_navigation(2)
2:39.512 default I cobra_shot Fluffy_Pillow 43.1/120: 36% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation(2)
2:40.841 Waiting     1.400 sec 28.2/120: 23% focus bestial_wrath, barbed_shot_1, frothing_rage(3), quick_navigation(2)
2:42.241 default G kill_command Fluffy_Pillow 49.1/120: 41% focus barbed_shot_1, frothing_rage(3), quick_navigation(2)
2:43.803 default I cobra_shot Fluffy_Pillow 36.8/120: 31% focus barbed_shot_1, frothing_rage(3), quick_navigation(2)
2:45.128 default B barbed_shot Fluffy_Pillow 21.8/120: 18% focus barbed_shot_1, frothing_rage(3), quick_navigation(2)
2:46.454 default F chimaera_shot Fluffy_Pillow 41.9/120: 35% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
2:47.772 Waiting     0.100 sec 71.9/120: 60% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
2:47.872 default G kill_command Fluffy_Pillow 73.1/120: 61% focus barbed_shot_2, frothing_rage(3), quick_navigation(3)
2:49.393 default I cobra_shot Fluffy_Pillow 65.4/120: 55% focus barbed_shot_2, quick_navigation(4)
2:50.704 default I cobra_shot Fluffy_Pillow 46.3/120: 39% focus barbed_shot_2, quick_navigation_final
2:51.951 default B barbed_shot Fluffy_Pillow 31.3/120: 26% focus barbed_shot_2, quick_navigation_final
2:53.198 default G kill_command Fluffy_Pillow 51.3/120: 43% focus barbed_shot_1, quick_navigation_final
2:54.445 default I cobra_shot Fluffy_Pillow 41.4/120: 34% focus barbed_shot_1, quick_navigation_final
2:55.691 Waiting     2.500 sec 21.4/120: 18% focus barbed_shot_1, quick_navigation_final
2:58.191 default G kill_command Fluffy_Pillow 61.6/120: 51% focus barbed_shot_1, quick_navigation_final
2:59.661 default B barbed_shot Fluffy_Pillow 49.1/120: 41% focus barbed_shot_1
3:01.007 default F chimaera_shot Fluffy_Pillow 69.1/120: 58% focus barbed_shot_2
3:02.353 default C a_murder_of_crows Fluffy_Pillow 99.2/120: 83% focus barbed_shot_2
3:03.698 default I cobra_shot Fluffy_Pillow 89.2/120: 74% focus barbed_shot_2
3:05.045 default G kill_command Fluffy_Pillow 69.3/120: 58% focus barbed_shot_2, quick_navigation
3:06.382 default B barbed_shot Fluffy_Pillow 59.4/120: 49% focus barbed_shot_2, quick_navigation
3:07.719 default E bestial_wrath Fluffy_Pillow 79.4/120: 66% focus barbed_shot_1, quick_navigation
3:09.057 default I cobra_shot Fluffy_Pillow 99.5/120: 83% focus bestial_wrath, barbed_shot_1, quick_navigation
3:10.393 default I cobra_shot Fluffy_Pillow 84.5/120: 70% focus bestial_wrath, barbed_shot_1, quick_navigation
3:11.731 default G kill_command Fluffy_Pillow 64.6/120: 54% focus bestial_wrath, barbed_shot_1, quick_navigation
3:13.067 default B barbed_shot Fluffy_Pillow 54.6/120: 46% focus bestial_wrath, barbed_shot_1, quick_navigation
3:14.403 default F chimaera_shot Fluffy_Pillow 74.7/120: 62% focus bestial_wrath, barbed_shot_2, quick_navigation
3:15.739 default I cobra_shot Fluffy_Pillow 104.7/120: 87% focus bestial_wrath, barbed_shot_2, quick_navigation
3:17.075 default I cobra_shot Fluffy_Pillow 89.7/120: 75% focus bestial_wrath, barbed_shot_2, quick_navigation
3:18.412 default G kill_command Fluffy_Pillow 69.8/120: 58% focus bestial_wrath, barbed_shot_2, quick_navigation
3:19.750 default B barbed_shot Fluffy_Pillow 59.9/120: 50% focus bestial_wrath, barbed_shot_2, quick_navigation
3:21.086 default I cobra_shot Fluffy_Pillow 79.9/120: 67% focus bestial_wrath, barbed_shot_1, quick_navigation
3:22.424 default I cobra_shot Fluffy_Pillow 65.0/120: 54% focus bestial_wrath, barbed_shot_1, quick_navigation
3:23.760 default G kill_command Fluffy_Pillow 50.0/120: 42% focus barbed_shot_1, quick_navigation
3:25.096 default I cobra_shot Fluffy_Pillow 35.0/120: 29% focus barbed_shot_1, quick_navigation
3:26.432 Waiting     1.100 sec 20.1/120: 17% focus barbed_shot_1, quick_navigation
3:27.532 default B barbed_shot Fluffy_Pillow 32.5/120: 27% focus barbed_shot_1, quick_navigation
3:29.037 default F chimaera_shot Fluffy_Pillow 54.4/120: 45% focus barbed_shot_2, quick_navigation
3:30.374 default G kill_command Fluffy_Pillow 84.5/120: 70% focus barbed_shot_2, quick_navigation
3:31.711 default I cobra_shot Fluffy_Pillow 74.5/120: 62% focus barbed_shot_2, quick_navigation
3:33.047 default I cobra_shot Fluffy_Pillow 54.5/120: 45% focus barbed_shot_2, quick_navigation
3:34.383 Waiting     0.500 sec 39.6/120: 33% focus barbed_shot_2, quick_navigation
3:34.883 default G kill_command Fluffy_Pillow 45.2/120: 38% focus barbed_shot_2, quick_navigation
3:36.372 default I cobra_shot Fluffy_Pillow 37.0/120: 31% focus quick_navigation
3:37.709 Waiting     2.800 sec 17.0/120: 14% focus quick_navigation
3:40.509 default G kill_command Fluffy_Pillow 48.5/120: 40% focus quick_navigation
3:42.034 default I cobra_shot Fluffy_Pillow 35.7/120: 30% focus quick_navigation
3:43.372 default F chimaera_shot Fluffy_Pillow 15.8/120: 13% focus quick_navigation
3:44.709 default H barbed_shot Fluffy_Pillow 40.8/120: 34% focus quick_navigation
3:46.047 Waiting     0.100 sec 55.9/120: 47% focus barbed_shot_1, quick_navigation
3:46.147 default G kill_command Fluffy_Pillow 57.0/120: 48% focus barbed_shot_1, quick_navigation
3:47.696 default I cobra_shot Fluffy_Pillow 49.5/120: 41% focus barbed_shot_1, quick_navigation
3:49.033 Waiting     0.500 sec 34.5/120: 29% focus barbed_shot_1, frothing_rage, quick_navigation(2)
3:49.533 default E bestial_wrath Fluffy_Pillow 40.2/120: 33% focus barbed_shot_1, frothing_rage, quick_navigation(2)
3:51.047 Waiting     0.400 sec 62.3/120: 52% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(2)
3:51.447 default B barbed_shot Fluffy_Pillow 66.9/120: 56% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation(2)
3:52.774 default G kill_command Fluffy_Pillow 87.0/120: 72% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(3)
3:54.093 default I cobra_shot Fluffy_Pillow 77.0/120: 64% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(3)
3:55.414 default I cobra_shot Fluffy_Pillow 57.2/120: 48% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation(4)
3:56.725 default F chimaera_shot Fluffy_Pillow 43.0/120: 36% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation_final
3:57.973 default G kill_command Fluffy_Pillow 73.1/120: 61% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation_final
3:59.222 default B barbed_shot Fluffy_Pillow 58.1/120: 48% focus bestial_wrath, barbed_shot_2, frothing_rage, quick_navigation_final
4:00.469 default 8 use_items Fluffy_Pillow 78.2/120: 65% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final
4:00.469 default D aspect_of_the_wild Fluffy_Pillow 78.2/120: 65% focus bestial_wrath, barbed_shot_1, frothing_rage, quick_navigation_final, golden_luster
4:01.550 default I cobra_shot Fluffy_Pillow 101.2/120: 84% focus aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation_final, golden_luster
4:02.632 default 9 blood_fury Fluffy_Pillow 84.3/120: 70% focus aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation_final, golden_luster
4:02.632 default C a_murder_of_crows Fluffy_Pillow 84.3/120: 70% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation_final, golden_luster
4:03.712 default G kill_command Fluffy_Pillow 77.3/120: 64% focus blood_fury, aspect_of_the_wild, bestial_wrath, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation_final, golden_luster
4:04.795 default H barbed_shot Fluffy_Pillow 65.4/120: 54% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage, quick_navigation_final, golden_luster
4:05.877 default I cobra_shot Fluffy_Pillow 88.0/120: 73% focus blood_fury, aspect_of_the_wild, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage, golden_luster
4:07.044 default I cobra_shot Fluffy_Pillow 76.1/120: 63% focus blood_fury, aspect_of_the_wild, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage(2), golden_luster
4:08.210 default G kill_command Fluffy_Pillow 64.2/120: 53% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(2), quick_navigation, golden_luster
4:09.436 default F chimaera_shot Fluffy_Pillow 58.0/120: 48% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(2), quick_navigation, golden_luster
4:10.597 default I cobra_shot Fluffy_Pillow 91.0/120: 76% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(2), quick_navigation, golden_luster
4:11.757 default B barbed_shot Fluffy_Pillow 79.2/120: 66% focus blood_fury, aspect_of_the_wild, barbed_shot_2, primal_instincts, frothing_rage(2), quick_navigation(2), golden_luster
4:12.909 default I cobra_shot Fluffy_Pillow 102.2/120: 85% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation(2), golden_luster
4:14.060 default G kill_command Fluffy_Pillow 90.3/120: 75% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation(2), golden_luster
4:15.212 default I cobra_shot Fluffy_Pillow 78.3/120: 65% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation(2), golden_luster
4:16.364 default I cobra_shot Fluffy_Pillow 66.4/120: 55% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation(2), golden_luster
4:17.515 Waiting     1.000 sec 54.4/120: 45% focus blood_fury, aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation(2), golden_luster
4:18.515 default B barbed_shot Fluffy_Pillow 75.7/120: 63% focus aspect_of_the_wild, barbed_shot_1, primal_instincts, frothing_rage(2), quick_navigation(2), golden_luster
4:19.665 default E bestial_wrath Fluffy_Pillow 93.8/120: 78% focus aspect_of_the_wild, barbed_shot_1, barbed_shot_2, primal_instincts, frothing_rage(2), quick_navigation(2), golden_luster
4:20.871 default G kill_command Fluffy_Pillow 120.0/120: 100% focus bestial_wrath, barbed_shot_2, frothing_rage(2), quick_navigation(2)
4:22.199 default I cobra_shot Fluffy_Pillow 105.0/120: 88% focus bestial_wrath, barbed_shot_2, frothing_rage(2), quick_navigation(2)
4:23.526 default F chimaera_shot Fluffy_Pillow 90.2/120: 75% focus bestial_wrath, barbed_shot_2, frothing_rage(2), quick_navigation(3)
4:24.845 default I cobra_shot Fluffy_Pillow 120.0/120: 100% focus bestial_wrath, barbed_shot_2, frothing_rage(2), quick_navigation(3)
4:26.165 default G kill_command Fluffy_Pillow 100.1/120: 83% focus bestial_wrath, barbed_shot_2, frothing_rage(2), quick_navigation(3)
4:27.485 default I cobra_shot Fluffy_Pillow 90.1/120: 75% focus bestial_wrath, frothing_rage(2), quick_navigation(3)
4:28.805 default I cobra_shot Fluffy_Pillow 70.2/120: 58% focus bestial_wrath, frothing_rage(2), quick_navigation(3)
4:30.123 Waiting     0.400 sec 50.2/120: 42% focus bestial_wrath, frothing_rage(2), quick_navigation(3)
4:30.523 default G kill_command Fluffy_Pillow 54.8/120: 46% focus bestial_wrath, frothing_rage(2), quick_navigation(3)
4:32.061 default H barbed_shot Fluffy_Pillow 42.3/120: 35% focus bestial_wrath, frothing_rage(2), quick_navigation(3)
4:33.382 default I cobra_shot Fluffy_Pillow 57.4/120: 48% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation(3)
4:34.701 Waiting     1.400 sec 42.4/120: 35% focus bestial_wrath, barbed_shot_1, frothing_rage(2), quick_navigation(3)
4:36.101 default G kill_command Fluffy_Pillow 63.4/120: 53% focus barbed_shot_1, frothing_rage(2), quick_navigation(4)
4:37.624 default F chimaera_shot Fluffy_Pillow 50.9/120: 42% focus barbed_shot_1, frothing_rage(2), quick_navigation(4)
4:38.934 default B barbed_shot Fluffy_Pillow 80.9/120: 67% focus barbed_shot_1, frothing_rage(2), quick_navigation(4)
4:40.245 default I cobra_shot Fluffy_Pillow 100.9/120: 84% focus barbed_shot_2, frothing_rage(2), quick_navigation(4)
4:41.556 default I cobra_shot Fluffy_Pillow 86.0/120: 72% focus barbed_shot_2, frothing_rage(2), quick_navigation(4)
4:42.866 default G kill_command Fluffy_Pillow 66.0/120: 55% focus barbed_shot_2, frothing_rage(2), quick_navigation(4)
4:44.178 default I cobra_shot Fluffy_Pillow 56.1/120: 47% focus barbed_shot_2, frothing_rage(2), quick_navigation(4)
4:45.489 default I cobra_shot Fluffy_Pillow 41.1/120: 34% focus barbed_shot_2, frothing_rage(2), quick_navigation(4)
4:46.799 Waiting     0.400 sec 21.2/120: 18% focus barbed_shot_2, frothing_rage(2), quick_navigation(4)
4:47.199 default G kill_command Fluffy_Pillow 30.8/120: 26% focus frothing_rage(2), quick_navigation(4)
4:48.710 Waiting     1.500 sec 18.1/120: 15% focus frothing_rage(2), quick_navigation(4)
4:50.210 default I cobra_shot Fluffy_Pillow 35.3/120: 29% focus frothing_rage(2), quick_navigation(4)
4:51.523 default F chimaera_shot Fluffy_Pillow 15.4/120: 13% focus quick_navigation(4)
4:52.834 default G kill_command Fluffy_Pillow 40.4/120: 34% focus quick_navigation(4)
4:54.244 default H barbed_shot Fluffy_Pillow 26.7/120: 22% focus frothing_rage, quick_navigation_final
4:55.491 default I cobra_shot Fluffy_Pillow 41.7/120: 35% focus barbed_shot_1, frothing_rage, quick_navigation_final
4:56.739 Waiting     0.700 sec 26.8/120: 22% focus barbed_shot_1, frothing_rage, quick_navigation_final
4:57.439 default H barbed_shot Fluffy_Pillow 35.2/120: 29% focus barbed_shot_1, frothing_rage, quick_navigation_final
4:58.922 default G kill_command Fluffy_Pillow 58.1/120: 48% focus barbed_shot_1, barbed_shot_2, frothing_rage, quick_navigation_final

Stats

Level Bonus (120) Race Bonus (orc) Raid-Buffed Unbuffed Gear Amount
Strength 1467 3 1530 1470 0
Agility 1467 -3 6518 6100 4346 (3433)
Stamina 1001 1 9029 8209 7207
Intellect 1467 -1 1678 1466 0
Spirit 0 0 0 0 0
Health 180580 164180 0
Focus 120 120 0
Crit 25.04% 25.04% 1083
Haste 11.84% 11.84% 805
Damage / Heal Versatility 1.35% 1.35% 115
Attack Power 7170 6100 0
Mastery 41.65% 41.65% 1002
Armor 2738 2738 2738
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Crest of the Undying Visionary
ilevel: 390, stats: { 381 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Primal Instincts, Heed My Call, Vampiric Speed, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Cannoneer's Mantle
ilevel: 390, stats: { 352 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Primal Instincts, Azerite Globules, Gemhide, Azerite Empowered }
Local Chest Corrupted Hexxer's Vestments
ilevel: 390, stats: { 469 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Primal Instincts, Heed My Call, Longstrider, Azerite Empowered }
Local Waist Titanspark Energy Girdle
ilevel: 385, stats: { 255 Armor, +247 AgiInt, +417 Sta, +96 Haste, +88 Crit }
Local Legs Legguards of Coalescing Plasma
ilevel: 385, stats: { 397 Armor, +329 AgiInt, +556 Sta, +159 Crit, +86 Mastery }
Local Feet Fused Monstrosity Stompers
ilevel: 385, stats: { 312 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Wrists Rubywrought Sparkguards
ilevel: 385, stats: { 198 Armor, +185 AgiInt, +312 Sta, +78 Haste, +60 Mastery }
Local Hands Oblivion Crushers
ilevel: 385, stats: { 283 Armor, +247 AgiInt, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Haste }
Local Trinket1 Lustrous Golden Plumage
ilevel: 370, stats: { +271 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Plasma-Spattered Greatcloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +81 Mastery, +57 Crit }
Local Main Hand Bow of Virulent Infection
ilevel: 385, weapon: { 630 - 854, 3 }, stats: { +329 Agi, +556 Sta, +158 Crit, +87 Mastery }, enchant: quick_navigation

Talents

Level
15 Killer Instinct (Beast Mastery Hunter) Animal Companion (Beast Mastery Hunter) Dire Beast (Beast Mastery Hunter)
30 Scent of Blood (Beast Mastery Hunter) One with the Pack (Beast Mastery Hunter) Chimaera Shot (Beast Mastery Hunter)
45 Trailblazer Natural Mending Camouflage
60 Venomous Bite (Beast Mastery Hunter) Thrill of the Hunt (Beast Mastery Hunter) A Murder of Crows (Beast Mastery Hunter)
75 Born To Be Wild Posthaste Binding Shot
90 Stomp (Beast Mastery Hunter) Barrage (Beast Mastery Hunter) Stampede (Beast Mastery Hunter)
100 Aspect of the Beast (Beast Mastery Hunter) Killer Cobra (Beast Mastery Hunter) Spitting Cobra (Beast Mastery Hunter)

Profile

hunter="T22_Hunter_Beast_Mastery"
spec=beast_mastery
level=120
race=orc
role=attack
position=ranged_back
talents=1303011

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/aspect_of_the_wild

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
actions+=/use_items
actions+=/berserking,if=cooldown.bestial_wrath.remains>30
actions+=/blood_fury,if=cooldown.bestial_wrath.remains>30
actions+=/ancestral_call,if=cooldown.bestial_wrath.remains>30
actions+=/fireblood,if=cooldown.bestial_wrath.remains>30
actions+=/lights_judgment
actions+=/potion,if=buff.bestial_wrath.up&buff.aspect_of_the_wild.up
actions+=/barbed_shot,if=pet.cat.buff.frenzy.up&pet.cat.buff.frenzy.remains<=gcd.max
actions+=/a_murder_of_crows
actions+=/spitting_cobra
actions+=/stampede,if=buff.bestial_wrath.up|cooldown.bestial_wrath.remains<gcd|target.time_to_die<15
actions+=/aspect_of_the_wild
actions+=/bestial_wrath,if=!buff.bestial_wrath.up
actions+=/multishot,if=spell_targets>2&(pet.cat.buff.beast_cleave.remains<gcd.max|pet.cat.buff.beast_cleave.down)
actions+=/chimaera_shot
actions+=/kill_command
actions+=/dire_beast
actions+=/barbed_shot,if=pet.cat.buff.frenzy.down&charges_fractional>1.4|full_recharge_time<gcd.max|target.time_to_die<9
actions+=/multishot,if=spell_targets>1&(pet.cat.buff.beast_cleave.remains<gcd.max|pet.cat.buff.beast_cleave.down)
actions+=/cobra_shot,if=(active_enemies<2|cooldown.kill_command.remains>focus.time_to_max)&(buff.bestial_wrath.up&active_enemies>1|cooldown.kill_command.remains>1+gcd&cooldown.bestial_wrath.remains>focus.time_to_max|focus-cost+focus.regen*(cooldown.kill_command.remains-1)>action.kill_command.cost)

head=crest_of_the_undying_visionary,id=160630,bonus_id=4824/1507/4775,azerite_powers=3/366/22/44/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=cannoneers_mantle,id=159393,bonus_id=1557/4819/4775/4786,azerite_powers=3/366/462/85/13
back=plasmaspattered_greatcloak,id=160644,bonus_id=4800/1507
chest=corrupted_hexxers_vestments,id=159370,bonus_id=1557/4819/4775/4786,azerite_powers=3/366/22/14/13
wrists=rubywrought_sparkguards,id=160629,bonus_id=4800/1507
hands=oblivion_crushers,id=160721,bonus_id=4800/1507
waist=titanspark_energy_girdle,id=160633,bonus_id=4800/1507
legs=legguards_of_coalescing_plasma,id=160631,bonus_id=4800/1507
feet=fused_monstrosity_stompers,id=160628,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=lustrous_golden_plumage,id=159617,bonus_id=1542/4779
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=bow_of_virulent_infection,id=160678,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=385.27
# gear_agility=4346
# gear_stamina=7207
# gear_crit_rating=1083
# gear_haste_rating=805
# gear_mastery_rating=1002
# gear_versatility_rating=115
# gear_armor=2738

T22_Hunter_Marksmanship : 15535 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
15534.5 15534.5 12.5 / 0.081% 2142.1 / 13.8% 2318.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
6.7 6.5 Focus 0.00% 41.0 100.0% 100%
Talents
  • 15: Serpent Sting (Marksmanship Hunter)
  • 30: Careful Aim (Marksmanship Hunter)
  • 60: Hunter's Mark (Marksmanship Hunter)
  • 90: Lethal Shots (Marksmanship Hunter)
  • 100: Lock and Load (Marksmanship Hunter)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Hunter_Marksmanship 15535
Aimed Shot 5390 34.7% 35.1 8.44sec 45975 24865 Direct 36.1 30135 60345 44758 48.4%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.10 36.05 0.00 0.00 1.8490 0.0000 1613734.40 2307027.12 30.05 24864.94 24864.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 51.60% 30135.25 18949 73295 30162.26 23386 40342 560589 801429 30.05
crit 17.45 48.40% 60344.97 37898 146589 60376.24 46516 87602 1053145 1505598 30.05
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:true
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<3
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${{$s1=0}*$<mult>} Physical damage. Damage increased by {$s2=50}% against a target you have not yet damaged. $?!s19434&c1[ Replaces Cobra Shot.][]
 
Arcane Shot 2802 18.0% 54.8 5.42sec 15307 13073 Direct 54.7 13105 26215 15335 17.0%  

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.83 54.73 0.00 0.00 1.1709 0.0000 839220.78 839220.78 0.00 13072.59 13072.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.42 83.00% 13105.23 6282 15293 13107.17 11886 13580 595257 595257 0.00
crit 9.31 17.00% 26214.95 12564 30586 26216.95 18320 29260 243963 243963 0.00
 
 

Action details: arcane_shot

Static Values
  • id:185358
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:70.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.precise_shots.up&(cooldown.aimed_shot.full_recharge_time<gcd*buff.precise_shots.stack+action.aimed_shot.cast_time|buff.lethal_shots.up)
Spelldata
  • id:185358
  • name:Arcane Shot
  • school:arcane
  • tooltip:
  • description:A quick shot that causes ${$sw2*$<mult>} Arcane damage.
 
Auto Shot 1646 10.6% 106.2 2.83sec 4645 2005 Direct 105.9 3975 7950 4655 17.1%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.16 105.95 0.00 0.00 2.3168 0.0000 493176.98 705055.72 30.05 2005.12 2005.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.82 82.89% 3974.72 3887 4354 3975.74 3932 4029 349069 499036 30.05
crit 18.13 17.11% 7949.95 7774 8708 7951.99 7774 8368 144108 206020 30.05
 
 

Action details: auto_shot

Static Values
  • id:75
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:60.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:75
  • name:Auto Shot
  • school:physical
  • tooltip:Firing at the target.
  • description:Automatically shoots the target until cancelled.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Frenetic Blow (frentic_blow) 282 1.8% 3.3 77.57sec 25898 0 Direct 3.3 22092 44185 25900 17.2%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.27 3.27 0.00 0.00 0.0000 0.0000 84625.54 120982.38 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.70 82.77% 22092.50 22092 22092 21680.05 0 22092 59755 85427 29.49
crit 0.56 17.23% 44184.99 44185 44185 19697.35 0 44185 24871 35556 13.40
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Heed My Call 446 (637) 2.9% (4.1%) 7.1 38.67sec 27089 0 Direct 7.1 16174 32348 18962 17.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 7.05 0.00 0.00 0.0000 0.0000 133734.66 133734.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.84 82.77% 16174.12 16174 16174 16161.18 0 16174 94416 94416 0.00
crit 1.22 17.23% 32348.24 32348 32348 23086.78 0 32348 39319 39319 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:13860.00
  • base_dd_max:13860.00
 
    Heed My Call (_aoe) 191 1.2% 7.1 38.67sec 8127 0 Direct 7.1 6932 13864 8127 17.2%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 7.05 0.00 0.00 0.0000 0.0000 57322.25 57322.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.84 82.75% 6931.77 6932 6932 6927.14 0 6932 40456 40456 0.00
crit 1.22 17.25% 13863.53 13864 13864 9862.91 0 13864 16866 16866 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5940.00
  • base_dd_max:5940.00
 
Kul Tiran Cannonball Runner 161 1.0% 52.4 5.15sec 924 0 Direct 52.4 789 1578 924 17.1%  

Stats details: kul_tiran_cannonball_runner

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.41 52.41 0.00 0.00 0.0000 0.0000 48414.73 48414.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.45 82.90% 788.87 789 789 788.87 789 789 34276 34276 0.00
crit 8.96 17.10% 1577.74 1578 1578 1576.89 0 1578 14139 14139 0.00
 
 

Action details: kul_tiran_cannonball_runner

Static Values
  • id:271197
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271197
  • name:Kul Tiran Cannonball Runner
  • school:fire
  • tooltip:
  • description:{$@spelldesc271190=Your attacks have a chance to deploy a cannon battery at your side for {$271194d=10 seconds}, dealing ${{$s1=676}*5} total Fire damage divided evenly among enemies in a cone in front of it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:676.37
  • base_dd_max:676.37
 
Light's Judgment 0 (312) 0.0% (2.0%) 2.5 150.51sec 37883 29794

Stats details: lights_judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.49 0.00 0.00 0.00 1.2718 0.0000 0.00 0.00 0.00 29793.82 29793.82
 
 

Action details: lights_judgment

Static Values
  • id:255647
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:150.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:255647
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing $<damage> Holy damage to enemies within $A1 yards after 3 sec.
 
    Light's Judgment (_damage) 312 2.0% 2.5 150.53sec 38252 0 Direct 2.5 32615 65191 38251 17.3%  

Stats details: lights_judgment_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.47 2.47 0.00 0.00 0.0000 0.0000 94357.03 94357.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.04 82.70% 32614.62 30830 34469 32033.20 0 34469 66530 66530 0.00
crit 0.43 17.30% 65191.39 61660 68939 24124.02 0 68939 27827 27827 0.00
 
 

Action details: lights_judgment_damage

Static Values
  • id:256893
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:150.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:256893
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing $<damage> Holy damage to enemies within $A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Rapid Fire 1601 10.3% 14.9 20.66sec 32114 11893 Periodic 148.4 2507 5004 3236 29.2% 12.2%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.95 0.00 148.86 148.37 2.7002 0.2458 480056.54 686298.47 30.05 11893.19 11893.19
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.1 70.83% 2507.17 2380 2897 2507.96 2430 2649 263489 376689 30.05
crit 43.3 29.17% 5004.00 4760 5794 5006.86 4833 5384 216567 309609 30.05
 
 

Action details: rapid_fire

Static Values
  • id:257044
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.lethal_shots.enabled|buff.lethal_shots.up)&azerite.focused_fire.enabled|azerite.in_the_rhythm.enabled
Spelldata
  • id:257044
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:Shoot a stream of {$s1=10} shots at your target over {$d=3 seconds}, dealing a total of ${$m1*$257045sw1} Physical damage. Each shot generates {$263585s1=1} Focus. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.33
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: rapid_fire_damage

Static Values
  • id:257045
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:257045
  • name:Rapid Fire
  • school:physical
  • tooltip:
  • description:Shoot a stream of arrows at your target every, dealing {$s1=0} damage every $t sec.
 
Serpent Sting 1177 7.6% 25.3 11.96sec 13972 11745 Direct 25.2 2063 4126 2416 17.1%  
Periodic 123.2 2024 4046 2369 17.1% 94.7%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.25 25.19 123.24 123.24 1.1897 2.3063 352851.84 352851.84 0.00 1122.77 11744.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.89 82.92% 2063.42 1963 2390 2063.93 2004 2124 43096 43096 0.00
crit 4.30 17.08% 4126.35 3926 4779 4082.23 0 4779 17749 17749 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.2 82.91% 2023.68 1 2390 2024.26 1944 2084 206768 206768 0.00
crit 21.1 17.09% 4046.09 1 4779 4047.38 3430 4361 85239 85239 0.00
 
 

Action details: serpent_sting

Static Values
  • id:271788
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:refreshable
Spelldata
  • id:271788
  • name:Serpent Sting
  • school:nature
  • tooltip:Suffering {$s2=0} Nature damage every $t2 sec.
  • description:Fire a shot that poisons your target, causing them to take {$s1=0} Nature damage instantly and an additional $o2 Nature damage over {$d=12 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.150000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Steady Shot 1525 9.8% 67.9 4.26sec 6729 4832 Direct 67.8 5754 11508 6740 17.1%  

Stats details: steady_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.93 67.81 0.00 0.00 1.3924 0.0000 457067.97 653433.55 30.05 4832.45 4832.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.19 82.87% 5754.49 5493 6686 5755.85 5649 5877 323371 462297 30.05
crit 11.62 17.13% 11507.79 10985 13372 11511.36 10985 12658 133697 191136 30.05
 
 

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:75.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus+cast_regen<focus.max|(talent.lethal_shots.enabled&buff.lethal_shots.down)
Spelldata
  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:
  • description:A steady shot that causes {$s1=0} Physical damage. Usable while moving. |cFFFFFFFFGenerates {$s2=10} Focus.
 
Simple Action Stats Execute Interval
T22_Hunter_Marksmanship
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Marksmanship
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Marksmanship
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Marksmanship
  • harmful:false
  • if_expr:
 
Hunter's Mark 1.0 0.00sec

Stats details: hunters_mark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: hunters_mark

Static Values
  • id:257284
  • school:nature
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:257284
  • name:Hunter's Mark
  • school:nature
  • tooltip:Damage taken from the Hunter increased by {$s1=5}%. Can always be seen and tracked by the Hunter.
  • description:Apply Hunter's Mark to the target, increasing all damage you deal to the marked target by {$s1=5}%. If the target dies while affected by Hunter's Mark, you instantly gain {$259558s1=20} Focus. The target can always be seen and tracked by the Hunter. Only one Hunter's Mark can be applied at a time.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.0 185.24sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.1132 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.aimed_shot.charges<1|talent.barrage.enabled&cooldown.aimed_shot.charges_fractional<1.3
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=30}% for {$d=15 seconds}.
  • description:Immediately gain {$s2=1} charge of Aimed Shot, and gain {$s1=30}% Haste for {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Potion of Agility 2.0 0.0 269.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 4.8 11.3 65.6sec 18.3sec 75.48% 0.00% 0.0(0.0) 0.8

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:28.08%
  • frothing_rage_2:25.03%
  • frothing_rage_3:22.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
In The Rhythm 14.9 0.0 20.7sec 20.7sec 39.02% 0.00% 0.0(0.0) 14.4

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_in_the_rhythm
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • in_the_rhythm_1:39.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:272733
  • name:In The Rhythm
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc264198=When Rapid Fire finishes fully channeling, your Haste is increased by {$s1=0} for {$272733d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%

Trigger Spell details

  • id:264198
  • name:In The Rhythm
  • tooltip:
  • description:When Rapid Fire finishes fully channeling, your Haste is increased by {$s1=0} for {$272733d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lethal Shots 15.9 1.0 17.8sec 16.6sec 13.40% 19.08% 1.0(1.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_lethal_shots
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:25.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lethal_shots_1:13.40%

Trigger Attempt Success

  • trigger_pct:24.97%

Spelldata details

  • id:260395
  • name:Lethal Shots
  • tooltip:Your next Aimed Shot will have {$s1=100}% increased critical strike chance, or your next Rapid Fire will deal a critical strike with each shot.
  • description:{$@spelldesc260393=Steady Shot has a {$h=25}% chance to cause your next Aimed Shot or Rapid Fire to be guaranteed critical strikes.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:260393
  • name:Lethal Shots
  • tooltip:
  • description:Steady Shot has a {$h=25}% chance to cause your next Aimed Shot or Rapid Fire to be guaranteed critical strikes.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:25.00%
Lock and Load 5.1 0.2 48.3sec 46.0sec 6.12% 14.13% 0.2(0.2) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_lock_and_load
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lock_and_load_1:6.12%

Trigger Attempt Success

  • trigger_pct:4.98%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:{$@spelldesc194595=Your ranged auto attacks have a {$194595h=5}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:194595
  • name:Lock and Load
  • tooltip:
  • description:Your ranged auto attacks have a {$194595h=5}% chance to trigger Lock and Load, causing your next Aimed Shot to cost no Focus and be instant.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:5.00%
Masterful Navigation 6.2 23.1 52.1sec 10.4sec 69.11% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_masterful_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:50.00

Stack Uptimes

  • masterful_navigation_1:18.09%
  • masterful_navigation_2:17.46%
  • masterful_navigation_3:17.10%
  • masterful_navigation_4:16.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268899
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Masterful Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.10% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_masterful_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:600.00

Stack Uptimes

  • masterful_navigation_final_1:18.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268898
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Precise Shots 36.1 0.0 8.4sec 8.4sec 23.30% 98.29% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_precise_shots
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • precise_shots_1:16.80%
  • precise_shots_2:6.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:260242
  • name:Precise Shots
  • tooltip:Damage of Arcane Shot or Multi-Shot increased by {$s1=100}%.
  • description:{$@spelldesc260240=Aimed Shot causes your next 1-{$260242u=2} Arcane Shots or Multi-Shots to deal {$260242s1=100}% more damage.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.0 0.0 185.3sec 185.3sec 10.14% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • trueshot_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=30}% for {$d=15 seconds}.
  • description:Immediately gain {$s2=1} charge of Aimed Shot, and gain {$s1=30}% Haste for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
lethal_shots_aimed 13.6 20.5sec
lethal_shots_rapid_fire 2.2 72.8sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Aimed Shot1.8400.00112.2059.4630.00037.769
Trueshot5.6630.00293.8715.3370.00093.871
Rapid Fire0.7590.0015.4789.1882.90317.852

Resources

Resource Usage Type Count Total Average RPE APR
T22_Hunter_Marksmanship
aimed_shot Focus 36.1 932.7 25.8 26.6 1730.1
arcane_shot Focus 54.8 822.4 15.0 15.0 1020.5
serpent_sting Focus 25.3 252.5 10.0 10.0 1397.2
Resource Gains Type Count Total Average Overflow
rapid_fire_damage Focus 148.86 147.98 (7.57%) 0.99 0.88 0.59%
steady_shot Focus 67.93 678.25 (34.72%) 9.98 1.02 0.15%
focus_regen Focus 617.95 1127.44 (57.71%) 1.82 6.33 0.56%
Resource RPS-Gain RPS-Loss
Focus 6.51 6.69
Combat End Resource Mean Min Max
Focus 46.12 0.33 100.00

Benefits & Uptimes

Benefits %
careful_aim 22.0%
Uptimes %
Focus Cap 0.4%

Statistics & Data Analysis

Fight Length
Sample Data T22_Hunter_Marksmanship Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Hunter_Marksmanship Damage Per Second
Count 7499
Mean 15534.53
Minimum 13825.31
Maximum 17669.58
Spread ( max - min ) 3844.27
Range [ ( max - min ) / 2 * 100% ] 12.37%
Standard Deviation 552.7909
5th Percentile 14655.62
95th Percentile 16482.81
( 95th Percentile - 5th Percentile ) 1827.19
Mean Distribution
Standard Deviation 6.3835
95.00% Confidence Intervall ( 15522.02 - 15547.04 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4865
0.1 Scale Factor Error with Delta=300 2609
0.05 Scale Factor Error with Delta=300 10435
0.01 Scale Factor Error with Delta=300 260859
Priority Target DPS
Sample Data T22_Hunter_Marksmanship Priority Target Damage Per Second
Count 7499
Mean 15534.53
Minimum 13825.31
Maximum 17669.58
Spread ( max - min ) 3844.27
Range [ ( max - min ) / 2 * 100% ] 12.37%
Standard Deviation 552.7909
5th Percentile 14655.62
95th Percentile 16482.81
( 95th Percentile - 5th Percentile ) 1827.19
Mean Distribution
Standard Deviation 6.3835
95.00% Confidence Intervall ( 15522.02 - 15547.04 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4865
0.1 Scale Factor Error with Delta=300 2609
0.05 Scale Factor Error with Delta=300 10435
0.01 Scale Factor Error with Delta=300 260859
DPS(e)
Sample Data T22_Hunter_Marksmanship Damage Per Second (Effective)
Count 7499
Mean 15534.53
Minimum 13825.31
Maximum 17669.58
Spread ( max - min ) 3844.27
Range [ ( max - min ) / 2 * 100% ] 12.37%
Damage
Sample Data T22_Hunter_Marksmanship Damage
Count 7499
Mean 4654562.72
Minimum 3477813.14
Maximum 5991312.27
Spread ( max - min ) 2513499.13
Range [ ( max - min ) / 2 * 100% ] 27.00%
DTPS
Sample Data T22_Hunter_Marksmanship Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Hunter_Marksmanship Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Hunter_Marksmanship Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Hunter_Marksmanship Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Hunter_Marksmanship Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Hunter_Marksmanship Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Hunter_MarksmanshipTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Hunter_Marksmanship Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 hunters_mark
6 0.00 double_tap,precast_time=5
7 0.00 aimed_shot,if=active_enemies<3
8 0.00 explosive_shot,if=active_enemies>2
Default action list Executed every time the actor is available.
# count action,conditions
9 1.00 auto_shot
0.00 counter_shot,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
0.00 use_items
A 0.00 call_action_list,name=cds
B 0.00 call_action_list,name=st,if=active_enemies<3
C 0.00 call_action_list,name=trickshots,if=active_enemies>2
actions.cds
# count action,conditions
0.00 hunters_mark,if=debuff.hunters_mark.down
0.00 double_tap,if=cooldown.rapid_fire.remains<gcd
0.00 berserking,if=cooldown.trueshot.remains>30
0.00 blood_fury,if=cooldown.trueshot.remains>30
0.00 ancestral_call,if=cooldown.trueshot.remains>30
0.00 fireblood,if=cooldown.trueshot.remains>30
D 2.49 lights_judgment
E 1.00 potion,if=(buff.trueshot.react&buff.bloodlust.react)|((consumable.prolonged_power&target.time_to_die<62)|target.time_to_die<31)
F 2.00 trueshot,if=cooldown.aimed_shot.charges<1|talent.barrage.enabled&cooldown.aimed_shot.charges_fractional<1.3
actions.st
# count action,conditions
0.00 explosive_shot
0.00 barrage,if=active_enemies>1
G 5.63 arcane_shot,if=buff.precise_shots.up&(cooldown.aimed_shot.full_recharge_time<gcd*buff.precise_shots.stack+action.aimed_shot.cast_time|buff.lethal_shots.up)
H 14.95 rapid_fire,if=(!talent.lethal_shots.enabled|buff.lethal_shots.up)&azerite.focused_fire.enabled|azerite.in_the_rhythm.enabled
I 27.34 aimed_shot,if=buff.precise_shots.down&(buff.double_tap.down&full_recharge_time<cast_time+gcd|buff.lethal_shots.up)
0.00 rapid_fire,if=!talent.lethal_shots.enabled|buff.lethal_shots.up
0.00 piercing_shot
0.00 a_murder_of_crows
J 25.25 serpent_sting,if=refreshable
K 7.95 aimed_shot,if=buff.precise_shots.down&(!talent.steady_focus.enabled&focus>70|!talent.lethal_shots.enabled|buff.lethal_shots.up)
L 49.19 arcane_shot,if=buff.precise_shots.up|focus>60&(!talent.lethal_shots.enabled|buff.lethal_shots.up)
M 68.26 steady_shot,if=focus+cast_regen<focus.max|(talent.lethal_shots.enabled&buff.lethal_shots.down)
0.00 arcane_shot

Sample Sequence

0124579DHJLIFGILMMMJILMILMLMHMIJLLMMMMKLMJMMIHLLMIJLLMMILJGHILLMMIJLLMIMHJLLMMILJMGMIHLJMLMIMLMJLMHILLMJMIMLMMMHIDJLMMILLJMIHLLMIJLLMMMILHJLIFGMIJMGMIMLGHMIJLMMILLJMMMHILJLMMMILIJLHMILMMJILMMIELHJMKLMMIJLLMMHIJLMM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Hunter_Marksmanship 100.0/100: 100% focus
Pre precombat 1 augmentation T22_Hunter_Marksmanship 100.0/100: 100% focus
Pre precombat 2 food T22_Hunter_Marksmanship 100.0/100: 100% focus
Pre precombat 4 potion Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
Pre precombat 5 hunters_mark Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
0:00.000 precombat 7 aimed_shot Fluffy_Pillow 70.0/100: 70% focus precise_shots, frothing_rage, masterful_navigation, battle_potion_of_agility
0:00.000 default 9 start_auto_shot Fluffy_Pillow 70.0/100: 70% focus precise_shots, frothing_rage, masterful_navigation, resounding_protection, battle_potion_of_agility
0:00.000 cds D lights_judgment Fluffy_Pillow 70.0/100: 70% focus precise_shots, frothing_rage, masterful_navigation, resounding_protection, battle_potion_of_agility
0:01.320 st H rapid_fire Fluffy_Pillow 74.8/100: 75% focus bloodlust, precise_shots, frothing_rage, masterful_navigation, resounding_protection, battle_potion_of_agility
0:03.658 st J serpent_sting Fluffy_Pillow 95.4/100: 95% focus bloodlust, precise_shots, in_the_rhythm, frothing_rage(2), masterful_navigation, resounding_protection, battle_potion_of_agility
0:04.602 st L arcane_shot Fluffy_Pillow 89.9/100: 90% focus bloodlust, precise_shots, in_the_rhythm, frothing_rage(2), masterful_navigation, resounding_protection, battle_potion_of_agility
0:05.546 st I aimed_shot Fluffy_Pillow 79.4/100: 79% focus bloodlust, in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
0:07.115 cds F trueshot Fluffy_Pillow 56.9/100: 57% focus bloodlust, precise_shots, in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
0:08.060 st G arcane_shot Fluffy_Pillow 62.8/100: 63% focus bloodlust, precise_shots, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
0:08.815 st I aimed_shot Fluffy_Pillow 52.5/100: 52% focus bloodlust, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
0:10.023 st L arcane_shot Fluffy_Pillow 30.0/100: 30% focus bloodlust, precise_shots, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
0:10.776 st M steady_shot Fluffy_Pillow 19.7/100: 20% focus bloodlust, trueshot, in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
0:11.623 st M steady_shot Fluffy_Pillow 34.8/100: 35% focus bloodlust, trueshot, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
0:12.533 st M steady_shot Fluffy_Pillow 50.1/100: 50% focus bloodlust, trueshot, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
0:13.445 st J serpent_sting Fluffy_Pillow 65.4/100: 65% focus bloodlust, trueshot, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:14.227 st I aimed_shot Fluffy_Pillow 59.9/100: 60% focus bloodlust, trueshot, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:15.528 st L arcane_shot Fluffy_Pillow 37.4/100: 37% focus bloodlust, precise_shots, trueshot, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:16.309 st M steady_shot Fluffy_Pillow 26.9/100: 27% focus bloodlust, trueshot, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:17.221 st I aimed_shot Fluffy_Pillow 42.2/100: 42% focus bloodlust, trueshot, lethal_shots, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:18.521 st L arcane_shot Fluffy_Pillow 19.7/100: 20% focus bloodlust, precise_shots(2), trueshot, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:19.304 st M steady_shot Fluffy_Pillow 9.2/100: 9% focus bloodlust, precise_shots, trueshot, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:20.215 st L arcane_shot Fluffy_Pillow 24.5/100: 24% focus bloodlust, precise_shots, trueshot, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:20.998 st M steady_shot Fluffy_Pillow 14.0/100: 14% focus bloodlust, trueshot, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:21.912 st H rapid_fire Fluffy_Pillow 29.3/100: 29% focus bloodlust, trueshot, lethal_shots, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
0:23.734 st M steady_shot Fluffy_Pillow 47.8/100: 48% focus bloodlust, in_the_rhythm, frothing_rage(3), masterful_navigation(3), resounding_protection
0:24.833 st I aimed_shot Fluffy_Pillow 63.0/100: 63% focus bloodlust, lethal_shots, in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
0:26.403 st J serpent_sting Fluffy_Pillow 40.6/100: 41% focus bloodlust, precise_shots(2), in_the_rhythm, frothing_rage(3), masterful_navigation(4), resounding_protection
0:27.346 st L arcane_shot Fluffy_Pillow 35.1/100: 35% focus bloodlust, precise_shots(2), in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:28.289 st L arcane_shot Fluffy_Pillow 24.6/100: 25% focus bloodlust, precise_shots, in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection
0:29.233 st M steady_shot Fluffy_Pillow 14.1/100: 14% focus bloodlust, in_the_rhythm, masterful_navigation_final, resounding_protection
0:30.333 st M steady_shot Fluffy_Pillow 29.4/100: 29% focus bloodlust, in_the_rhythm, masterful_navigation_final, resounding_protection
0:31.434 st M steady_shot Fluffy_Pillow 44.7/100: 45% focus bloodlust, in_the_rhythm, masterful_navigation_final, resounding_protection
0:32.537 st M steady_shot Fluffy_Pillow 59.6/100: 60% focus bloodlust, masterful_navigation_final, resounding_protection
0:33.722 st K aimed_shot Fluffy_Pillow 74.8/100: 75% focus bloodlust, frothing_rage, masterful_navigation_final, resounding_protection
0:35.414 st L arcane_shot Fluffy_Pillow 52.3/100: 52% focus bloodlust, precise_shots, frothing_rage, masterful_navigation_final, resounding_protection
0:36.431 st M steady_shot Fluffy_Pillow 41.9/100: 42% focus bloodlust, frothing_rage, masterful_navigation_final, resounding_protection
0:37.615 st J serpent_sting Fluffy_Pillow 57.1/100: 57% focus bloodlust, frothing_rage, resounding_protection
0:38.634 st M steady_shot Fluffy_Pillow 51.7/100: 52% focus bloodlust, frothing_rage, resounding_protection
0:39.819 st M steady_shot Fluffy_Pillow 66.9/100: 67% focus bloodlust, frothing_rage, resounding_protection
0:41.004 st I aimed_shot Fluffy_Pillow 82.2/100: 82% focus lethal_shots, frothing_rage, masterful_navigation, resounding_protection
0:43.201 st H rapid_fire Fluffy_Pillow 59.7/100: 60% focus precise_shots(2), frothing_rage, masterful_navigation, resounding_protection
0:45.995 st L arcane_shot Fluffy_Pillow 79.3/100: 79% focus precise_shots(2), in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
0:47.220 st L arcane_shot Fluffy_Pillow 68.8/100: 69% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
0:48.445 st M steady_shot Fluffy_Pillow 58.3/100: 58% focus in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
0:49.873 st I aimed_shot Fluffy_Pillow 73.6/100: 74% focus lethal_shots, in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
0:51.913 st J serpent_sting Fluffy_Pillow 51.1/100: 51% focus precise_shots(2), lock_and_load, in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
0:53.139 st L arcane_shot Fluffy_Pillow 45.6/100: 46% focus precise_shots(2), lock_and_load, in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
0:54.364 st L arcane_shot Fluffy_Pillow 35.0/100: 35% focus precise_shots, lock_and_load, frothing_rage, masterful_navigation(2), resounding_protection
0:55.684 st M steady_shot Fluffy_Pillow 24.5/100: 25% focus lock_and_load, frothing_rage, masterful_navigation(2), resounding_protection
0:57.222 st M steady_shot Fluffy_Pillow 39.8/100: 40% focus lock_and_load, frothing_rage, masterful_navigation(2), resounding_protection
0:58.762 st I aimed_shot Fluffy_Pillow 55.0/100: 55% focus lock_and_load, lethal_shots, frothing_rage, masterful_navigation(2), resounding_protection
1:00.080 st L arcane_shot Fluffy_Pillow 59.5/100: 60% focus precise_shots(2), frothing_rage, masterful_navigation(2), resounding_protection
1:01.401 st J serpent_sting Fluffy_Pillow 49.1/100: 49% focus precise_shots, frothing_rage, masterful_navigation(2), resounding_protection
1:02.720 st G arcane_shot Fluffy_Pillow 43.6/100: 44% focus precise_shots, lock_and_load, frothing_rage, masterful_navigation(2), resounding_protection
1:04.039 st H rapid_fire Fluffy_Pillow 33.1/100: 33% focus lock_and_load, frothing_rage, masterful_navigation(2), resounding_protection
1:06.883 st I aimed_shot Fluffy_Pillow 52.9/100: 53% focus lock_and_load, in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:08.108 st L arcane_shot Fluffy_Pillow 57.4/100: 57% focus precise_shots(2), in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:09.334 st L arcane_shot Fluffy_Pillow 46.9/100: 47% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:10.559 st M steady_shot Fluffy_Pillow 36.4/100: 36% focus in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:11.987 st M steady_shot Fluffy_Pillow 51.7/100: 52% focus in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:13.414 st I aimed_shot Fluffy_Pillow 66.9/100: 67% focus lethal_shots, in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
1:15.456 st J serpent_sting Fluffy_Pillow 44.2/100: 44% focus precise_shots(2), frothing_rage, masterful_navigation(3), resounding_protection
1:16.775 st L arcane_shot Fluffy_Pillow 38.8/100: 39% focus precise_shots(2), frothing_rage, masterful_navigation(3), resounding_protection
1:18.096 st L arcane_shot Fluffy_Pillow 28.3/100: 28% focus precise_shots, frothing_rage, masterful_navigation(3), resounding_protection
1:19.414 st M steady_shot Fluffy_Pillow 17.8/100: 18% focus frothing_rage, masterful_navigation(3), resounding_protection
1:20.954 st I aimed_shot Fluffy_Pillow 33.0/100: 33% focus lethal_shots, frothing_rage, masterful_navigation(3), resounding_protection
1:23.150 st M steady_shot Fluffy_Pillow 10.6/100: 11% focus precise_shots(2), frothing_rage, masterful_navigation(3), resounding_protection
1:24.690 st H rapid_fire Fluffy_Pillow 25.8/100: 26% focus precise_shots(2), frothing_rage, masterful_navigation(3), resounding_protection
1:27.507 st J serpent_sting Fluffy_Pillow 45.5/100: 46% focus precise_shots(2), in_the_rhythm, frothing_rage, masterful_navigation(4), resounding_protection
1:28.734 st L arcane_shot Fluffy_Pillow 40.0/100: 40% focus precise_shots(2), in_the_rhythm, frothing_rage, masterful_navigation(4), resounding_protection
1:29.959 st L arcane_shot Fluffy_Pillow 29.5/100: 30% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation(4), resounding_protection
1:31.183 st M steady_shot Fluffy_Pillow 19.1/100: 19% focus in_the_rhythm, frothing_rage, masterful_navigation(4), resounding_protection
1:32.611 st M steady_shot Fluffy_Pillow 34.3/100: 34% focus in_the_rhythm, frothing_rage(2), masterful_navigation(4), resounding_protection
1:34.040 st I aimed_shot Fluffy_Pillow 49.6/100: 50% focus lethal_shots, in_the_rhythm, frothing_rage(2), masterful_navigation(4), resounding_protection
1:36.078 st L arcane_shot Fluffy_Pillow 26.9/100: 27% focus precise_shots(2), frothing_rage(2), masterful_navigation(4), resounding_protection
1:37.400 st J serpent_sting Fluffy_Pillow 16.4/100: 16% focus precise_shots, frothing_rage(2), masterful_navigation(4), resounding_protection
1:38.720 st M steady_shot Fluffy_Pillow 10.9/100: 11% focus precise_shots, frothing_rage(2), masterful_navigation(4), resounding_protection
1:40.261 st G arcane_shot Fluffy_Pillow 26.2/100: 26% focus precise_shots, lethal_shots, frothing_rage(2), masterful_navigation(4), resounding_protection
1:41.581 st M steady_shot Fluffy_Pillow 15.7/100: 16% focus lethal_shots, frothing_rage(2), masterful_navigation_final, resounding_protection
1:43.121 st I aimed_shot Fluffy_Pillow 31.0/100: 31% focus lethal_shots, masterful_navigation_final, resounding_protection
1:45.319 st H rapid_fire Fluffy_Pillow 8.5/100: 8% focus precise_shots(2), masterful_navigation_final, resounding_protection
1:48.286 st L arcane_shot Fluffy_Pillow 28.7/100: 29% focus precise_shots(2), in_the_rhythm, masterful_navigation_final, resounding_protection
1:49.512 st J serpent_sting Fluffy_Pillow 18.2/100: 18% focus precise_shots, in_the_rhythm, masterful_navigation_final, resounding_protection
1:50.738 st M steady_shot Fluffy_Pillow 12.8/100: 13% focus precise_shots, in_the_rhythm, masterful_navigation_final, resounding_protection
1:52.165 st L arcane_shot Fluffy_Pillow 28.0/100: 28% focus precise_shots, in_the_rhythm, resounding_protection
1:53.389 st M steady_shot Fluffy_Pillow 17.5/100: 18% focus in_the_rhythm, resounding_protection
1:54.819 st I aimed_shot Fluffy_Pillow 32.8/100: 33% focus lethal_shots, in_the_rhythm, resounding_protection
1:56.859 st M steady_shot Fluffy_Pillow 10.1/100: 10% focus precise_shots(2), frothing_rage, resounding_protection
1:58.398 st L arcane_shot Fluffy_Pillow 25.3/100: 25% focus precise_shots(2), frothing_rage, resounding_protection
1:59.716 st M steady_shot Fluffy_Pillow 14.8/100: 15% focus precise_shots, frothing_rage, resounding_protection
2:01.255 st J serpent_sting Fluffy_Pillow 30.1/100: 30% focus precise_shots, frothing_rage, resounding_protection
2:02.574 st L arcane_shot Fluffy_Pillow 24.6/100: 25% focus precise_shots, frothing_rage, resounding_protection
2:03.892 st M steady_shot Fluffy_Pillow 14.1/100: 14% focus frothing_rage, resounding_protection
2:05.431 st H rapid_fire Fluffy_Pillow 29.4/100: 29% focus frothing_rage, resounding_protection
2:08.246 st I aimed_shot Fluffy_Pillow 49.1/100: 49% focus in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
2:10.286 st L arcane_shot Fluffy_Pillow 26.6/100: 27% focus precise_shots(2), in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
2:11.511 st L arcane_shot Fluffy_Pillow 16.1/100: 16% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
2:12.736 st M steady_shot Fluffy_Pillow 5.6/100: 6% focus in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
2:14.164 st J serpent_sting Fluffy_Pillow 20.9/100: 21% focus lethal_shots, in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
2:15.390 st M steady_shot Fluffy_Pillow 15.4/100: 15% focus lethal_shots, in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
2:16.819 st I aimed_shot Fluffy_Pillow 30.4/100: 30% focus lethal_shots, frothing_rage, masterful_navigation(2), resounding_protection
2:19.017 st M steady_shot Fluffy_Pillow 7.9/100: 8% focus precise_shots, frothing_rage, masterful_navigation(2), resounding_protection
2:20.558 st L arcane_shot Fluffy_Pillow 23.2/100: 23% focus precise_shots, frothing_rage, masterful_navigation(2), resounding_protection
2:21.879 st M steady_shot Fluffy_Pillow 12.7/100: 13% focus frothing_rage, masterful_navigation(2), resounding_protection
2:23.418 st M steady_shot Fluffy_Pillow 28.0/100: 28% focus frothing_rage, masterful_navigation(2), resounding_protection
2:24.957 st M steady_shot Fluffy_Pillow 43.3/100: 43% focus frothing_rage, masterful_navigation(3), resounding_protection
2:26.496 st H rapid_fire Fluffy_Pillow 58.5/100: 59% focus frothing_rage, masterful_navigation(3), resounding_protection
2:29.299 st I aimed_shot Fluffy_Pillow 78.2/100: 78% focus in_the_rhythm, frothing_rage, masterful_navigation(4), resounding_protection
2:31.339 cds D lights_judgment Fluffy_Pillow 55.7/100: 56% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation_final, resounding_protection
2:32.566 st J serpent_sting Fluffy_Pillow 60.2/100: 60% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation_final, resounding_protection
2:33.790 st L arcane_shot Fluffy_Pillow 54.7/100: 55% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation_final, resounding_protection
2:35.016 st M steady_shot Fluffy_Pillow 44.2/100: 44% focus in_the_rhythm, frothing_rage, masterful_navigation_final, resounding_protection
2:36.444 st M steady_shot Fluffy_Pillow 59.5/100: 59% focus in_the_rhythm, frothing_rage, masterful_navigation_final, resounding_protection
2:37.874 st I aimed_shot Fluffy_Pillow 74.5/100: 75% focus lethal_shots, frothing_rage, masterful_navigation_final, resounding_protection
2:40.071 st L arcane_shot Fluffy_Pillow 52.1/100: 52% focus precise_shots(2), frothing_rage, masterful_navigation_final, resounding_protection
2:41.391 st L arcane_shot Fluffy_Pillow 41.6/100: 42% focus precise_shots, resounding_protection
2:42.710 st J serpent_sting Fluffy_Pillow 31.1/100: 31% focus resounding_protection
2:44.030 st M steady_shot Fluffy_Pillow 25.6/100: 26% focus masterful_navigation, resounding_protection
2:45.569 st I aimed_shot Fluffy_Pillow 40.9/100: 41% focus lock_and_load, masterful_navigation, resounding_protection
2:46.889 st H rapid_fire Fluffy_Pillow 45.4/100: 45% focus precise_shots(2), masterful_navigation, resounding_protection
2:49.787 st L arcane_shot Fluffy_Pillow 65.4/100: 65% focus precise_shots(2), in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
2:51.013 st L arcane_shot Fluffy_Pillow 54.9/100: 55% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
2:52.238 st M steady_shot Fluffy_Pillow 44.4/100: 44% focus in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
2:53.667 st I aimed_shot Fluffy_Pillow 59.7/100: 60% focus in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
2:55.707 st J serpent_sting Fluffy_Pillow 37.2/100: 37% focus precise_shots(2), in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
2:56.933 st L arcane_shot Fluffy_Pillow 31.7/100: 32% focus precise_shots(2), in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
2:58.158 st L arcane_shot Fluffy_Pillow 21.0/100: 21% focus precise_shots, frothing_rage, masterful_navigation(2), resounding_protection
2:59.477 st M steady_shot Fluffy_Pillow 10.5/100: 11% focus frothing_rage, masterful_navigation(2), resounding_protection
3:01.017 st M steady_shot Fluffy_Pillow 25.8/100: 26% focus frothing_rage, masterful_navigation(2), resounding_protection
3:02.557 st M steady_shot Fluffy_Pillow 41.1/100: 41% focus frothing_rage, masterful_navigation(2), resounding_protection
3:04.097 st I aimed_shot Fluffy_Pillow 56.3/100: 56% focus lock_and_load, frothing_rage, masterful_navigation(2), resounding_protection
3:05.417 st L arcane_shot Fluffy_Pillow 60.8/100: 61% focus precise_shots(2), frothing_rage, masterful_navigation(2), resounding_protection
3:06.736 st H rapid_fire Fluffy_Pillow 50.4/100: 50% focus precise_shots, frothing_rage, masterful_navigation(2), resounding_protection
3:09.730 st J serpent_sting Fluffy_Pillow 70.7/100: 71% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
3:10.956 st L arcane_shot Fluffy_Pillow 65.2/100: 65% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
3:12.181 st I aimed_shot Fluffy_Pillow 54.7/100: 55% focus in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
3:14.221 cds F trueshot Fluffy_Pillow 32.2/100: 32% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
3:15.448 st G arcane_shot Fluffy_Pillow 38.1/100: 38% focus precise_shots, trueshot, in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
3:16.390 st M steady_shot Fluffy_Pillow 27.6/100: 28% focus trueshot, in_the_rhythm, frothing_rage, masterful_navigation(3), resounding_protection
3:17.490 st I aimed_shot Fluffy_Pillow 42.9/100: 43% focus trueshot, frothing_rage, masterful_navigation(3), resounding_protection
3:19.183 st J serpent_sting Fluffy_Pillow 20.4/100: 20% focus precise_shots, trueshot, frothing_rage, masterful_navigation(3), resounding_protection
3:20.199 st M steady_shot Fluffy_Pillow 14.9/100: 15% focus precise_shots, trueshot, frothing_rage, masterful_navigation(3), resounding_protection
3:21.383 st G arcane_shot Fluffy_Pillow 30.2/100: 30% focus precise_shots, trueshot, lethal_shots, frothing_rage, masterful_navigation(4), resounding_protection
3:22.400 st M steady_shot Fluffy_Pillow 19.7/100: 20% focus trueshot, lethal_shots, frothing_rage, masterful_navigation(4), resounding_protection
3:23.582 st I aimed_shot Fluffy_Pillow 34.9/100: 35% focus trueshot, lethal_shots, frothing_rage, masterful_navigation(4), resounding_protection
3:25.273 st M steady_shot Fluffy_Pillow 12.5/100: 12% focus precise_shots(2), trueshot, frothing_rage, masterful_navigation(4), resounding_protection
3:26.457 st L arcane_shot Fluffy_Pillow 27.7/100: 28% focus precise_shots(2), trueshot, frothing_rage, masterful_navigation_final, resounding_protection
3:27.473 st G arcane_shot Fluffy_Pillow 17.2/100: 17% focus precise_shots, trueshot, lock_and_load, frothing_rage, masterful_navigation_final, resounding_protection
3:28.489 st H rapid_fire Fluffy_Pillow 6.8/100: 7% focus trueshot, lock_and_load, frothing_rage, masterful_navigation_final, resounding_protection
3:30.800 st M steady_shot Fluffy_Pillow 25.5/100: 25% focus lock_and_load, in_the_rhythm, frothing_rage, masterful_navigation_final, resounding_protection
3:32.228 st I aimed_shot Fluffy_Pillow 40.8/100: 41% focus lock_and_load, lethal_shots, in_the_rhythm, frothing_rage, masterful_navigation_final, resounding_protection
3:33.454 st J serpent_sting Fluffy_Pillow 45.3/100: 45% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation_final, resounding_protection
3:34.679 st L arcane_shot Fluffy_Pillow 39.8/100: 40% focus precise_shots, in_the_rhythm, masterful_navigation_final, resounding_protection
3:35.904 st M steady_shot Fluffy_Pillow 29.3/100: 29% focus in_the_rhythm, frothing_rage, masterful_navigation_final, resounding_protection
3:37.333 st M steady_shot Fluffy_Pillow 44.6/100: 45% focus in_the_rhythm, frothing_rage, resounding_protection
3:38.761 st I aimed_shot Fluffy_Pillow 59.8/100: 60% focus lethal_shots, frothing_rage, resounding_protection
3:40.959 st L arcane_shot Fluffy_Pillow 37.3/100: 37% focus precise_shots(2), frothing_rage, resounding_protection
3:42.279 st L arcane_shot Fluffy_Pillow 26.8/100: 27% focus precise_shots, frothing_rage, resounding_protection
3:43.598 st J serpent_sting Fluffy_Pillow 16.3/100: 16% focus frothing_rage, resounding_protection
3:44.919 st M steady_shot Fluffy_Pillow 10.8/100: 11% focus frothing_rage, resounding_protection
3:46.458 st M steady_shot Fluffy_Pillow 26.1/100: 26% focus frothing_rage, masterful_navigation, resounding_protection
3:47.998 st M steady_shot Fluffy_Pillow 41.3/100: 41% focus frothing_rage, masterful_navigation, resounding_protection
3:49.538 st H rapid_fire Fluffy_Pillow 56.6/100: 57% focus lethal_shots, frothing_rage, masterful_navigation, resounding_protection
3:52.394 st I aimed_shot Fluffy_Pillow 76.4/100: 76% focus in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
3:54.434 st L arcane_shot Fluffy_Pillow 54.0/100: 54% focus precise_shots(2), in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
3:55.660 st J serpent_sting Fluffy_Pillow 43.5/100: 43% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
3:56.886 st L arcane_shot Fluffy_Pillow 38.0/100: 38% focus precise_shots, in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
3:58.111 st M steady_shot Fluffy_Pillow 27.5/100: 28% focus in_the_rhythm, frothing_rage, masterful_navigation, resounding_protection
3:59.539 st M steady_shot Fluffy_Pillow 42.8/100: 43% focus in_the_rhythm, frothing_rage, masterful_navigation(2), resounding_protection
4:00.968 st M steady_shot Fluffy_Pillow 57.8/100: 58% focus frothing_rage, masterful_navigation(2), resounding_protection
4:02.509 st I aimed_shot Fluffy_Pillow 73.1/100: 73% focus lethal_shots, frothing_rage, masterful_navigation(2), resounding_protection
4:04.708 st L arcane_shot Fluffy_Pillow 50.6/100: 51% focus precise_shots, frothing_rage, masterful_navigation(2), resounding_protection
4:06.027 st I aimed_shot Fluffy_Pillow 40.1/100: 40% focus lock_and_load, frothing_rage, masterful_navigation(2), resounding_protection
4:07.346 st J serpent_sting Fluffy_Pillow 44.6/100: 45% focus precise_shots, frothing_rage, masterful_navigation(2), resounding_protection
4:08.665 st L arcane_shot Fluffy_Pillow 39.1/100: 39% focus precise_shots, frothing_rage, masterful_navigation(2), resounding_protection
4:09.985 st H rapid_fire Fluffy_Pillow 28.6/100: 29% focus frothing_rage, masterful_navigation(3), resounding_protection
4:12.845 st M steady_shot Fluffy_Pillow 48.5/100: 48% focus in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
4:14.273 st I aimed_shot Fluffy_Pillow 63.8/100: 64% focus in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
4:16.312 st L arcane_shot Fluffy_Pillow 41.3/100: 41% focus precise_shots, lock_and_load, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
4:17.537 st M steady_shot Fluffy_Pillow 30.8/100: 31% focus lock_and_load, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
4:18.965 st M steady_shot Fluffy_Pillow 46.0/100: 46% focus lock_and_load, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
4:20.393 st J serpent_sting Fluffy_Pillow 61.3/100: 61% focus lock_and_load, in_the_rhythm, frothing_rage(2), masterful_navigation(3), resounding_protection
4:21.617 st I aimed_shot Fluffy_Pillow 55.5/100: 56% focus lock_and_load, frothing_rage(2), masterful_navigation(3), resounding_protection
4:22.936 st L arcane_shot Fluffy_Pillow 60.0/100: 60% focus precise_shots, frothing_rage(2), masterful_navigation(4), resounding_protection
4:24.256 st M steady_shot Fluffy_Pillow 49.6/100: 50% focus frothing_rage(2), masterful_navigation(4), resounding_protection
4:25.794 st M steady_shot Fluffy_Pillow 64.8/100: 65% focus frothing_rage(2), masterful_navigation(4), resounding_protection
4:27.334 st I aimed_shot Fluffy_Pillow 80.1/100: 80% focus lethal_shots, frothing_rage(2), masterful_navigation_final, resounding_protection
4:29.533 cds E potion Fluffy_Pillow 57.6/100: 58% focus precise_shots, frothing_rage(2), masterful_navigation_final, resounding_protection
4:29.533 st L arcane_shot Fluffy_Pillow 57.6/100: 58% focus precise_shots, frothing_rage(2), masterful_navigation_final, resounding_protection, battle_potion_of_agility
4:30.851 st H rapid_fire Fluffy_Pillow 47.1/100: 47% focus frothing_rage(2), masterful_navigation_final, resounding_protection, battle_potion_of_agility
4:33.756 st J serpent_sting Fluffy_Pillow 67.1/100: 67% focus in_the_rhythm, frothing_rage(2), masterful_navigation_final, resounding_protection, battle_potion_of_agility
4:34.983 st M steady_shot Fluffy_Pillow 61.6/100: 62% focus in_the_rhythm, frothing_rage(2), masterful_navigation_final, resounding_protection, battle_potion_of_agility
4:36.412 st K aimed_shot Fluffy_Pillow 76.9/100: 77% focus in_the_rhythm, frothing_rage(3), masterful_navigation_final, resounding_protection, battle_potion_of_agility
4:38.452 st L arcane_shot Fluffy_Pillow 54.4/100: 54% focus precise_shots, in_the_rhythm, frothing_rage(3), resounding_protection, battle_potion_of_agility
4:39.676 st M steady_shot Fluffy_Pillow 43.9/100: 44% focus in_the_rhythm, frothing_rage(3), resounding_protection, battle_potion_of_agility
4:41.104 st M steady_shot Fluffy_Pillow 59.2/100: 59% focus in_the_rhythm, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
4:42.533 st I aimed_shot Fluffy_Pillow 74.2/100: 74% focus lock_and_load, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
4:43.853 st J serpent_sting Fluffy_Pillow 78.7/100: 79% focus precise_shots(2), frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
4:45.173 st L arcane_shot Fluffy_Pillow 73.2/100: 73% focus precise_shots(2), frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
4:46.494 st L arcane_shot Fluffy_Pillow 62.7/100: 63% focus precise_shots, frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
4:47.814 st M steady_shot Fluffy_Pillow 52.2/100: 52% focus frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
4:49.355 st M steady_shot Fluffy_Pillow 67.5/100: 68% focus frothing_rage(3), masterful_navigation, resounding_protection, battle_potion_of_agility
4:50.895 st H rapid_fire Fluffy_Pillow 82.8/100: 83% focus lethal_shots, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
4:53.769 st I aimed_shot Fluffy_Pillow 100.0/100: 100% focus in_the_rhythm, frothing_rage(3), masterful_navigation(2), resounding_protection, battle_potion_of_agility
4:55.808 st J serpent_sting Fluffy_Pillow 70.0/100: 70% focus precise_shots, in_the_rhythm, masterful_navigation(2), resounding_protection
4:57.033 st L arcane_shot Fluffy_Pillow 64.5/100: 65% focus precise_shots, in_the_rhythm, masterful_navigation(2), resounding_protection
4:58.259 st M steady_shot Fluffy_Pillow 54.0/100: 54% focus in_the_rhythm, masterful_navigation(2), resounding_protection
4:59.688 st M steady_shot Fluffy_Pillow 69.3/100: 69% focus in_the_rhythm, masterful_navigation(2), resounding_protection

Stats

Level Bonus (120) Race Bonus (lightforged_draenei) Raid-Buffed Unbuffed Gear Amount
Strength 1467 -2 1525 1465 0
Agility 1467 1 6522 6104 4346 (3433)
Stamina 1001 -1 9027 8207 7207
Intellect 1467 2 1681 1469 0
Spirit 0 0 0 0 0
Health 180540 164140 0
Focus 100 100 0
Crit 17.08% 17.08% 510
Haste 13.99% 13.99% 951
Damage / Heal Versatility 5.85% 5.85% 497
Attack Power 7174 6104 0
Mastery 14.09% 14.09% 1047
Armor 2738 2738 2738
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Soulscarred Headgear
ilevel: 390, stats: { 381 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { In The Rhythm, Heed My Call, Longstrider, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Crashguard Spaulders
ilevel: 390, stats: { 352 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Steady Aim, Heed My Call, Resounding Protection, Azerite Empowered }
Local Chest Chainvest of Assured Quality
ilevel: 390, stats: { 469 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Steady Aim, Heed My Call, Resounding Protection, Azerite Empowered }
Local Waist Cincture of Profane Deeds
ilevel: 385, stats: { 255 Armor, +247 AgiInt, +417 Sta, +104 Mastery, +80 Vers }
Local Legs Blighted Anima Greaves
ilevel: 385, stats: { 397 Armor, +329 AgiInt, +556 Sta, +149 Haste, +96 Vers }
Local Feet Fused Monstrosity Stompers
ilevel: 385, stats: { 312 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Wrists Rubywrought Sparkguards
ilevel: 385, stats: { 198 Armor, +185 AgiInt, +312 Sta, +78 Haste, +60 Mastery }
Local Hands Gloves of Involuntary Amputation
ilevel: 385, stats: { 283 Armor, +247 AgiInt, +417 Sta, +108 Vers, +76 Mastery }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Mastery }
Local Finger2 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Mastery }
Local Trinket1 Kul Tiran Cannonball Runner
ilevel: 370, stats: { +271 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Re-Origination Pulse Rifle
ilevel: 385, weapon: { 741 - 743, 3 }, stats: { +329 Agi, +556 Sta, +147 Haste, +98 Vers }, enchant: masterful_navigation

Talents

Level
15 Master Marksman (Marksmanship Hunter) Serpent Sting (Marksmanship Hunter) A Murder of Crows (Marksmanship Hunter)
30 Careful Aim (Marksmanship Hunter) Volley (Marksmanship Hunter) Explosive Shot (Marksmanship Hunter)
45 Trailblazer Natural Mending Camouflage
60 Steady Focus (Marksmanship Hunter) Streamline (Marksmanship Hunter) Hunter's Mark (Marksmanship Hunter)
75 Born To Be Wild Posthaste Binding Shot
90 Lethal Shots (Marksmanship Hunter) Barrage (Marksmanship Hunter) Double Tap (Marksmanship Hunter)
100 Calling the Shots (Marksmanship Hunter) Lock and Load (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter)

Profile

hunter="T22_Hunter_Marksmanship"
spec=marksmanship
level=120
race=lightforged_draenei
role=attack
position=ranged_back
talents=2103012

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/hunters_mark
actions.precombat+=/double_tap,precast_time=5
actions.precombat+=/aimed_shot,if=active_enemies<3
actions.precombat+=/explosive_shot,if=active_enemies>2

# Executed every time the actor is available.
actions=auto_shot
actions+=/counter_shot,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
actions+=/use_items
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=st,if=active_enemies<3
actions+=/call_action_list,name=trickshots,if=active_enemies>2

actions.cds=hunters_mark,if=debuff.hunters_mark.down
actions.cds+=/double_tap,if=cooldown.rapid_fire.remains<gcd
actions.cds+=/berserking,if=cooldown.trueshot.remains>30
actions.cds+=/blood_fury,if=cooldown.trueshot.remains>30
actions.cds+=/ancestral_call,if=cooldown.trueshot.remains>30
actions.cds+=/fireblood,if=cooldown.trueshot.remains>30
actions.cds+=/lights_judgment
actions.cds+=/potion,if=(buff.trueshot.react&buff.bloodlust.react)|((consumable.prolonged_power&target.time_to_die<62)|target.time_to_die<31)
actions.cds+=/trueshot,if=cooldown.aimed_shot.charges<1|talent.barrage.enabled&cooldown.aimed_shot.charges_fractional<1.3

actions.st=explosive_shot
actions.st+=/barrage,if=active_enemies>1
actions.st+=/arcane_shot,if=buff.precise_shots.up&(cooldown.aimed_shot.full_recharge_time<gcd*buff.precise_shots.stack+action.aimed_shot.cast_time|buff.lethal_shots.up)
actions.st+=/rapid_fire,if=(!talent.lethal_shots.enabled|buff.lethal_shots.up)&azerite.focused_fire.enabled|azerite.in_the_rhythm.enabled
actions.st+=/aimed_shot,if=buff.precise_shots.down&(buff.double_tap.down&full_recharge_time<cast_time+gcd|buff.lethal_shots.up)
actions.st+=/rapid_fire,if=!talent.lethal_shots.enabled|buff.lethal_shots.up
actions.st+=/piercing_shot
actions.st+=/a_murder_of_crows
actions.st+=/serpent_sting,if=refreshable
actions.st+=/aimed_shot,if=buff.precise_shots.down&(!talent.steady_focus.enabled&focus>70|!talent.lethal_shots.enabled|buff.lethal_shots.up)
actions.st+=/arcane_shot,if=buff.precise_shots.up|focus>60&(!talent.lethal_shots.enabled|buff.lethal_shots.up)
actions.st+=/steady_shot,if=focus+cast_regen<focus.max|(talent.lethal_shots.enabled&buff.lethal_shots.down)
actions.st+=/arcane_shot

actions.trickshots=barrage
actions.trickshots+=/explosive_shot
actions.trickshots+=/rapid_fire,if=buff.trick_shots.up&!talent.barrage.enabled
actions.trickshots+=/aimed_shot,if=buff.trick_shots.up&buff.precise_shots.down&buff.double_tap.down&(!talent.lethal_shots.enabled|buff.lethal_shots.up|focus>60)
actions.trickshots+=/rapid_fire,if=buff.trick_shots.up
actions.trickshots+=/multishot,if=buff.trick_shots.down|(buff.precise_shots.up|buff.lethal_shots.up)&(!talent.barrage.enabled&buff.steady_focus.down&focus>45|focus>70)
actions.trickshots+=/piercing_shot
actions.trickshots+=/a_murder_of_crows
actions.trickshots+=/serpent_sting,if=refreshable
actions.trickshots+=/steady_shot,if=focus+cast_regen<focus.max|(talent.lethal_shots.enabled&buff.lethal_shots.down)

head=soulscarred_headgear,id=159398,bonus_id=1557/4819/4775/4786,azerite_powers=3/36/22/14/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=crashguard_spaulders,id=159360,bonus_id=1557/4819/4775/4786,azerite_powers=3/368/22/15/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=chainvest_of_assured_quality,id=160627,bonus_id=4824/1507/4775,azerite_powers=3/368/22/15/13
wrists=rubywrought_sparkguards,id=160629,bonus_id=4800/1507
hands=gloves_of_involuntary_amputation,id=160626,bonus_id=4800/1507
waist=cincture_of_profane_deeds,id=160724,bonus_id=4800/1507
legs=blighted_anima_greaves,id=160716,bonus_id=4800/1507
feet=fused_monstrosity_stompers,id=160628,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_mastery
finger2=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_mastery
trinket1=kul_tiran_cannonball_runner,id=159628,bonus_id=1542/4779
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=reorigination_pulse_rifle,id=160694,bonus_id=4800/1507,enchant=masterful_navigation

# Gear Summary
# gear_ilvl=385.27
# gear_agility=4346
# gear_stamina=7207
# gear_crit_rating=510
# gear_haste_rating=951
# gear_mastery_rating=1047
# gear_versatility_rating=497
# gear_armor=2738

T22_Hunter_Survival : 17463 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17462.8 17462.8 8.0 / 0.046% 1386.5 / 7.9% 1175.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
11.1 10.9 Focus 2.65% 53.3 100.0% 100%
Talents
  • 15: Viper's Venom (Survival Hunter)
  • 30: Guerrilla Tactics (Survival Hunter)
  • 60: Bloodseeker (Survival Hunter)
  • 90: Flanking Strike (Survival Hunter)
  • 100: Birds of Prey (Survival Hunter)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Hunter_Survival 17463
auto_attack_mh 2204 12.6% 122.2 2.45sec 5406 2206 Direct 122.2 4453 8902 5406 21.4%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.17 122.17 0.00 0.00 2.4501 0.0000 660431.37 944165.95 30.05 2206.43 2206.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.00 78.58% 4453.45 4025 5402 4456.29 4314 4603 427543 611224 30.05
crit 26.16 21.42% 8901.68 8049 10804 8907.36 8231 9712 232888 332942 30.05
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Azerite Globules 145 0.8% 14.9 19.95sec 2920 0 Direct 14.9 2405 4811 2920 21.4%  

Stats details: azerite_globules

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.87 14.87 0.00 0.00 0.0000 0.0000 43420.82 43420.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.69 78.61% 2405.39 2405 2405 2405.39 2405 2405 28116 28116 0.00
crit 3.18 21.39% 4810.78 4811 4811 4652.32 0 4811 15305 15305 0.00
 
 

Action details: azerite_globules

Static Values
  • id:279958
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279958
  • name:Azerite Globules
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2200.00
  • base_dd_max:2200.00
 
Flanking Strike 0 (478) 0.0% (2.7%) 7.7 41.47sec 18642 16592

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.67 0.00 0.00 0.00 1.1237 0.0000 0.00 0.00 0.00 16591.95 16591.95
 
 

Action details: flanking_strike

Static Values
  • id:269751
  • school:physical
  • resource:none
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269751
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:You and your pet leap to the target and strike it as one, dealing a total of $<damage> Physical damage. |cFFFFFFFFGenerates {$269752s2=30} Focus for you and your pet.|r
 
    Flanking Strike (_damage) 262 1.5% 0.0 0.00sec 0 0 Direct 7.7 8404 16804 10227 21.7%  

Stats details: flanking_strike_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.67 0.00 0.00 0.0000 0.0000 78465.96 112176.51 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 78.31% 8404.39 7422 9944 8414.21 7422 9944 50496 72190 30.05
crit 1.66 21.69% 16804.04 14843 19888 14193.34 0 19888 27970 39986 25.36
 
 

Action details: flanking_strike_damage

Static Values
  • id:269752
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269752
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc269751=You and your pet leap to the target and strike it as one, dealing a total of $<damage> Physical damage. |cFFFFFFFFGenerates {$269752s2=30} Focus for you and your pet.|r}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Flanking Strike (cat) 216 1.2% 7.7 41.47sec 8416 0 Direct 7.7 6913 13849 8416 21.7%  

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.67 7.67 0.00 0.00 0.0000 0.0000 64573.27 92315.25 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 78.33% 6912.96 6064 8314 6921.75 6064 8314 41548 59397 30.05
crit 1.66 21.67% 13848.65 12127 16629 11707.55 0 16629 23026 32918 25.37
 
 

Action details: flanking_strike

Static Values
  • id:259516
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:259516
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc269751=You and your pet leap to the target and strike it as one, dealing a total of $<damage> Physical damage. |cFFFFFFFFGenerates {$269752s2=30} Focus for you and your pet.|r}
 
Frenetic Blow (frentic_blow) 308 1.8% 3.7 71.73sec 25033 0 Direct 3.7 20699 41398 25032 20.9%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.69 3.69 0.00 0.00 0.0000 0.0000 92316.21 131977.10 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.92 79.06% 20699.04 20699 20699 20423.01 0 20699 60353 86281 29.65
crit 0.77 20.94% 41398.07 41398 41398 23395.79 0 41398 31964 45696 16.98
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Kill Command 0 (1740) 0.0% (10.0%) 77.8 3.80sec 6704 5949

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.78 0.00 0.00 0.00 1.1268 0.0000 0.00 0.00 0.00 5949.37 5949.37
 
 

Action details: kill_command

Static Values
  • id:259489
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3&active_enemies<2
Spelldata
  • id:259489
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to the enemy.{$?s263186=true}[ Has a {$s2=25}% chance to immediately reset its cooldown.][] |cFFFFFFFFGenerates {$s3=15} Focus.|r
 
    Kill Command (cat) 1740 10.0% 77.8 3.80sec 6704 0 Direct 77.8 3470 6942 4213 21.4%  
Periodic 195.0 819 1637 993 21.3% 97.7%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.78 77.78 194.98 194.98 0.0000 1.5030 521427.02 662228.82 21.26 1779.21 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.13 78.59% 3470.32 3109 4264 3472.65 3335 3641 212148 303291 30.05
crit 16.65 21.41% 6941.58 6219 8527 6946.83 6219 7965 115588 165246 30.05
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.4 78.66% 818.80 2 1016 819.34 795 842 125588 125588 0.00
crit 41.6 21.34% 1637.05 4 2032 1638.09 1520 1781 68103 68103 0.00
 
 

Action details: kill_command

Static Values
  • id:259277
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:259277
  • name:Kill Command
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:{$@spelldesc259489=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to the enemy.{$?s263186=true}[ Has a {$s2=25}% chance to immediately reset its cooldown.][] |cFFFFFFFFGenerates {$s3=15} Focus.|r}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Raptor Strike 3761 21.5% 98.0 3.03sec 11498 10209 Direct 98.0 9467 18948 11498 21.4%  

Stats details: raptor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.05 98.05 0.00 0.00 1.1263 0.0000 1127372.59 1611714.50 30.05 10209.03 10209.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.04 78.57% 9466.87 8604 11420 9472.80 9172 9822 729337 1042675 30.05
crit 21.01 21.43% 18947.52 17209 22839 18959.38 17209 20848 398035 569039 30.05
 
 

Action details: raptor_strike

Static Values
  • id:186270
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:186270
  • name:Raptor Strike
  • school:physical
  • tooltip:
  • description:A vicious slash dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Serpent Sting 2623 (4100) 15.0% (23.5%) 41.4 7.28sec 29675 26459 Direct 41.4 6049 12086 7348 21.5%  
Periodic 133.3 2979 5960 3615 21.3% 97.5%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.41 41.40 133.28 133.28 1.1216 2.1952 786004.67 786004.67 0.00 3624.56 26458.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.49 78.48% 6049.20 2318 10873 6041.98 4211 7954 196546 196546 0.00
crit 8.91 21.52% 12086.15 4637 21745 12064.67 4637 21745 107664 107664 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.8 78.66% 2978.86 1 3633 2980.79 2866 3083 312298 312298 0.00
crit 28.4 21.34% 5959.51 7 7265 5963.53 5287 6555 169497 169497 0.00
 
 

Action details: serpent_sting

Static Values
  • id:259491
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:60.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(active_enemies<2&refreshable&(buff.mongoose_fury.down|(variable.can_gcd&!talent.vipers_venom.enabled)))|buff.vipers_venom.up
Spelldata
  • id:259491
  • name:Serpent Sting
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.$?a265428[ The Hunter's pet deals $w3% increased damage to you.][]
  • description:Fire a poison-tipped arrow at an enemy, dealing {$s1=0} Nature damage instantly and an additional $o2 damage over {$d=12 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.237510
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Latent Poison 1477 8.5% 87.6 3.40sec 5054 0 Direct 87.6 4159 8331 5054 21.5%  

Stats details: latent_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.61 87.61 0.00 0.00 0.0000 0.0000 442810.72 442810.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.81 78.54% 4159.20 2100 18900 4163.68 3509 4865 286192 286192 0.00
crit 18.80 21.46% 8331.02 4200 33600 8339.72 4200 14127 156619 156619 0.00
 
 

Action details: latent_poison

Static Values
  • id:273289
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:273289
  • name:Latent Poison
  • school:nature
  • tooltip:
  • description:{$@spelldesc273283=Serpent Sting damage applies Latent Poison, stacking up to {$273286u=10} times. Your {$?s259387=true}[Mongoose Bite][Raptor Strike] consumes all applications of Latent Poison to deal {$s1=501} Nature damage per stack.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6300.00
  • base_dd_max:6300.00
 
Wildfire Bomb 0 (2254) 0.0% (12.9%) 30.9 9.77sec 21830 19659

Stats details: wildfire_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.93 0.00 0.00 0.00 1.1105 0.0000 0.00 0.00 0.00 19658.63 19658.63
 
 

Action details: wildfire_bomb

Static Values
  • id:259495
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:18.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(focus+cast_regen<focus.max|active_enemies>1)&(dot.wildfire_bomb.refreshable&buff.mongoose_fury.down|full_recharge_time<gcd)
Spelldata
  • id:259495
  • name:Wildfire Bomb
  • school:physical
  • tooltip:
  • description:Hurl a bomb at the target, exploding for {$265157s1=0} Fire damage in a cone and coating enemies in wildfire, scorching them for $269747o1 Fire damage over {$269747d=6 seconds}.
 
    Wildfire Bomb (_impact) 1142 6.5% 0.0 0.00sec 0 0 Direct 30.9 9117 18232 11067 21.4%  

Stats details: wildfire_bomb_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 30.92 0.00 0.00 0.0000 0.0000 342145.41 342145.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.30 78.61% 9116.99 8162 10936 9123.19 8545 9622 221570 221570 0.00
crit 6.61 21.39% 18232.30 16323 21871 18235.96 0 21871 120575 120575 0.00
 
 

Action details: wildfire_bomb_impact

Static Values
  • id:265157
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:265157
  • name:Wildfire Bomb
  • school:fire
  • tooltip:
  • description:{$@spelldesc259495=Hurl a bomb at the target, exploding for {$265157s1=0} Fire damage in a cone and coating enemies in wildfire, scorching them for $269747o1 Fire damage over {$269747d=6 seconds}.}
 
    Wildfire Bomb (_dot) 1112 6.4% 0.0 0.00sec 0 0 Periodic 181.9 1508 3016 1831 21.4% 60.6%

Stats details: wildfire_bomb_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 181.90 181.90 0.0000 1.0000 333030.37 333030.37 0.00 1830.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.0 78.60% 1508.03 1360 1823 1508.98 1465 1554 215604 215604 0.00
crit 38.9 21.40% 3016.47 2721 3645 3018.25 2772 3277 117426 117426 0.00
 
 

Action details: wildfire_bomb_dot

Static Values
  • id:269747
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:269747
  • name:Wildfire Bomb
  • school:fire
  • tooltip:Suffering $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc259495=Hurl a bomb at the target, exploding for {$265157s1=0} Fire damage in a cone and coating enemies in wildfire, scorching them for $269747o1 Fire damage over {$269747d=6 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.150000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - cat 4429 / 4429
Claw 1097 6.3% 83.7 3.61sec 3926 3908 Direct 83.7 3231 6468 3926 21.5%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.71 83.71 0.00 0.00 1.0045 0.0000 328601.98 469776.00 30.05 3908.11 3908.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.75 78.55% 3231.44 2174 5963 3235.94 2936 3619 212470 303751 30.05
crit 17.95 21.45% 6468.05 4349 11926 6479.65 4416 9457 116132 166025 30.05
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 1377 7.9% 242.1 1.24sec 1704 1377 Direct 242.1 1404 2808 1704 21.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 242.05 242.05 0.00 0.00 1.2375 0.0000 412452.11 589649.83 30.05 1376.92 1376.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 190.28 78.61% 1403.60 1269 1700 1404.50 1368 1440 267074 381815 30.05
crit 51.78 21.39% 2807.78 2537 3400 2809.62 2642 2991 145378 207835 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
T22_Hunter_Survival
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Survival
  • harmful:false
  • if_expr:
 
Coordinated Assault 3.0 120.35sec

Stats details: coordinated_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 0.00 0.00 0.00 1.1144 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: coordinated_assault

Static Values
  • id:266779
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:266779
  • name:Coordinated Assault
  • school:physical
  • tooltip:Damage dealt increased by {$s1=20}%.{$?s263186=true}[ Kill Command's chance to reset increased by {$s4=25}%.][]
  • description:You and your pet attack as one, increasing all damage you both deal by {$s1=20}% for {$d=20 seconds}.{$?s263186=true}[ While Coordinated Assault is active, Kill Command's chance to reset is increased by {$s4=25}%.][]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Survival
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Hunter_Survival
  • harmful:false
  • if_expr:
 
Harpoon 1.0 0.00sec

Stats details: harpoon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: harpoon

Static Values
  • id:190925
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:70.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190925
  • name:Harpoon
  • school:physical
  • tooltip:
  • description:Hurls a harpoon at an enemy, rooting them in place for {$190927d=3 seconds} and pulling you to them.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Potion of Agility 2.0 0.0 121.5sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:200.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Coordinated Assault 3.0 0.0 120.3sec 120.4sec 38.19% 0.00% 0.0(0.0) 2.7

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_coordinated_assault
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • coordinated_assault_1:38.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:266779
  • name:Coordinated Assault
  • tooltip:Damage dealt increased by {$s1=20}%.{$?s263186=true}[ Kill Command's chance to reset increased by {$s4=25}%.][]
  • description:You and your pet attack as one, increasing all damage you both deal by {$s1=20}% for {$d=20 seconds}.{$?s263186=true}[ While Coordinated Assault is active, Kill Command's chance to reset is increased by {$s4=25}%.][]
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 5.0 12.3 64.2sec 17.2sec 76.00% 0.00% 0.0(0.0) 0.5

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:27.58%
  • frothing_rage_2:25.31%
  • frothing_rage_3:23.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Galecaller's Boon 5.5 0.0 60.4sec 60.4sec 18.01% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_galecallers_boon
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Galecaller's Boon

Stat Buff details

  • stat:haste_rating
  • amount:1239.29
  • stat:speed_rating
  • amount:1239.29

Stack Uptimes

  • galecallers_boon_1:18.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268311
  • name:Galecaller's Boon
  • tooltip:Haste increased by $w1. Speed increased by $w2.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.9 0.0 59.7sec 37.1sec 37.92% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.49%
  • overwhelming_power_2:1.49%
  • overwhelming_power_3:1.50%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.51%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.53%
  • overwhelming_power_10:1.53%
  • overwhelming_power_11:1.54%
  • overwhelming_power_12:1.54%
  • overwhelming_power_13:1.54%
  • overwhelming_power_14:1.55%
  • overwhelming_power_15:1.55%
  • overwhelming_power_16:1.56%
  • overwhelming_power_17:1.56%
  • overwhelming_power_18:1.57%
  • overwhelming_power_19:1.58%
  • overwhelming_power_20:1.58%
  • overwhelming_power_21:1.58%
  • overwhelming_power_22:1.58%
  • overwhelming_power_23:1.60%
  • overwhelming_power_24:1.63%
  • overwhelming_power_25:0.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Predator 1.0 0.0 0.0sec 0.0sec 99.66% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_predator
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • predator_1:99.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:260249
  • name:Predator
  • tooltip:Attack speed increased by {$s1=10}%.
  • description:{$@spelldesc260248=Kill Command causes the target to bleed for ${$RAP*({$s1=10}/100)*({$259277d=8 seconds}/$259277t2)} damage over {$259277d=8 seconds}. You and your pet gain {$260249s1=10}% attack speed for every bleeding enemy within {$s2=12} yds.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation 6.2 23.0 52.2sec 10.3sec 68.71% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.03%
  • quick_navigation_2:17.48%
  • quick_navigation_3:16.86%
  • quick_navigation_4:16.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.2sec 52.2sec 17.97% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Viper's Venom 22.5 0.0 13.3sec 13.3sec 14.13% 53.86% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_vipers_venom
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:2.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

RPPM Buff details

  • scaling:haste
  • frequency:3.00
  • modifier:1.00

Stack Uptimes

  • vipers_venom_1:14.13%

Trigger Attempt Success

  • trigger_pct:22.97%

Spelldata details

  • id:268552
  • name:Viper's Venom
  • tooltip:Your next Serpent Sting costs no Focus, and will deal {$s1=250}% increased initial damage.
  • description:{$@spelldesc268501={$?s259387=true}[Mongoose Bite][Raptor Strike] has a chance to make your next Serpent Sting cost no Focus and deal an additional {$268552s1=250}% initial damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%

Trigger Spell details

  • id:268501
  • name:Viper's Venom
  • tooltip:
  • description:{$?s259387=true}[Mongoose Bite][Raptor Strike] has a chance to make your next Serpent Sting cost no Focus and deal an additional {$268552s1=250}% initial damage.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
cat: Predator 1.0 0.0 0.0sec 0.0sec 99.66% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival_cat
  • cooldown name:buff_predator
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • predator_1:99.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:260249
  • name:Predator
  • tooltip:Attack speed increased by {$s1=10}%.
  • description:{$@spelldesc260248=Kill Command causes the target to bleed for ${$RAP*({$s1=10}/100)*({$259277d=8 seconds}/$259277t2)} damage over {$259277d=8 seconds}. You and your pet gain {$260249s1=10}% attack speed for every bleeding enemy within {$s2=12} yds.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
flankers_advantage 27.8 10.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Coordinated Assault0.4810.0011.2460.6960.0002.256
Kill Command1.0250.00113.50568.30123.395133.819
Wildfire Bomb1.2450.0039.8030.0950.0009.803
Flanking Strike1.6730.0018.1229.7830.85530.057

Resources

Resource Usage Type Count Total Average RPE APR
T22_Hunter_Survival
raptor_strike Focus 98.0 2941.4 30.0 30.0 383.3
serpent_sting Focus 41.4 380.7 9.2 9.2 3228.0
pet - cat
claw Focus 83.7 2789.1 33.3 33.3 117.8
Resource Gains Type Count Total Average Overflow
kill_command Focus 77.78 1166.75 (35.64%) 15.00 0.00 0.00%
flanking_strike_damage Focus 7.67 152.57 (4.66%) 19.88 77.62 33.72%
focus_regen Focus 658.71 1954.03 (59.70%) 2.97 49.33 2.46%
pet - cat
flanking_strike Focus 7.67 218.57 (8.05%) 28.49 11.62 5.05%
focus_regen Focus 493.39 2496.43 (91.95%) 5.06 9.84 0.39%
Resource RPS-Gain RPS-Loss
Focus 10.91 11.07
Combat End Resource Mean Min Max
Focus 50.84 0.00 100.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 33.4%
Uptimes %
Focus Cap 1.7%
cat-Focus Cap 0.3%

Statistics & Data Analysis

Fight Length
Sample Data T22_Hunter_Survival Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Hunter_Survival Damage Per Second
Count 7499
Mean 17462.79
Minimum 16174.62
Maximum 18734.90
Spread ( max - min ) 2560.28
Range [ ( max - min ) / 2 * 100% ] 7.33%
Standard Deviation 354.9409
5th Percentile 16895.94
95th Percentile 18061.11
( 95th Percentile - 5th Percentile ) 1165.17
Mean Distribution
Standard Deviation 4.0988
95.00% Confidence Intervall ( 17454.76 - 17470.82 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1588
0.1 Scale Factor Error with Delta=300 1076
0.05 Scale Factor Error with Delta=300 4302
0.01 Scale Factor Error with Delta=300 107547
Priority Target DPS
Sample Data T22_Hunter_Survival Priority Target Damage Per Second
Count 7499
Mean 17462.79
Minimum 16174.62
Maximum 18734.90
Spread ( max - min ) 2560.28
Range [ ( max - min ) / 2 * 100% ] 7.33%
Standard Deviation 354.9409
5th Percentile 16895.94
95th Percentile 18061.11
( 95th Percentile - 5th Percentile ) 1165.17
Mean Distribution
Standard Deviation 4.0988
95.00% Confidence Intervall ( 17454.76 - 17470.82 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1588
0.1 Scale Factor Error with Delta=300 1076
0.05 Scale Factor Error with Delta=300 4302
0.01 Scale Factor Error with Delta=300 107547
DPS(e)
Sample Data T22_Hunter_Survival Damage Per Second (Effective)
Count 7499
Mean 17462.79
Minimum 16174.62
Maximum 18734.90
Spread ( max - min ) 2560.28
Range [ ( max - min ) / 2 * 100% ] 7.33%
Damage
Sample Data T22_Hunter_Survival Damage
Count 7499
Mean 3905998.13
Minimum 2950788.66
Maximum 4858034.50
Spread ( max - min ) 1907245.85
Range [ ( max - min ) / 2 * 100% ] 24.41%
DTPS
Sample Data T22_Hunter_Survival Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Hunter_Survival Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Hunter_Survival Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Hunter_Survival Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Hunter_Survival Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Hunter_Survival Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Hunter_SurvivalTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Hunter_Survival Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 summon_pet
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion
6 0.00 steel_trap
7 0.00 harpoon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_attack
0.00 muzzle,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
9 5.47 use_items
0.00 berserking,if=cooldown.coordinated_assault.remains>30
0.00 blood_fury,if=cooldown.coordinated_assault.remains>30
0.00 ancestral_call,if=cooldown.coordinated_assault.remains>30
0.00 fireblood,if=cooldown.coordinated_assault.remains>30
0.00 lights_judgment
0.00 arcane_torrent,if=cooldown.kill_command.remains>gcd.max&focus<=30
A 1.00 potion,if=buff.coordinated_assault.up&(buff.berserking.up|buff.blood_fury.up|!race.troll&!race.orc)
0.00 variable,name=can_gcd,value=!talent.mongoose_bite.enabled|buff.mongoose_fury.down|(buff.mongoose_fury.remains-(((buff.mongoose_fury.remains*focus.regen+focus)%action.mongoose_bite.cost)*gcd.max)>gcd.max)
0.00 steel_trap
0.00 a_murder_of_crows
B 2.99 coordinated_assault
0.00 chakrams,if=active_enemies>1
C 77.79 kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3&active_enemies<2
D 30.93 wildfire_bomb,if=(focus+cast_regen<focus.max|active_enemies>1)&(dot.wildfire_bomb.refreshable&buff.mongoose_fury.down|full_recharge_time<gcd)
0.00 kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3
0.00 butchery,if=(!talent.wildfire_infusion.enabled|full_recharge_time<gcd)&active_enemies>3|(dot.shrapnel_bomb.ticking&dot.internal_bleeding.stack<3)
E 41.41 serpent_sting,if=(active_enemies<2&refreshable&(buff.mongoose_fury.down|(variable.can_gcd&!talent.vipers_venom.enabled)))|buff.vipers_venom.up
0.00 carve,if=active_enemies>2&(active_enemies<6&active_enemies+gcd<cooldown.wildfire_bomb.remains|5+gcd<cooldown.wildfire_bomb.remains)
0.00 harpoon,if=talent.terms_of_engagement.enabled
F 7.67 flanking_strike
0.00 chakrams
0.00 serpent_sting,target_if=min:remains,if=refreshable&buff.mongoose_fury.down|buff.vipers_venom.up
0.00 aspect_of_the_eagle,if=target.distance>=6
0.00 mongoose_bite_eagle,target_if=min:dot.internal_bleeding.stack,if=buff.mongoose_fury.up|focus>60
0.00 mongoose_bite,target_if=min:dot.internal_bleeding.stack,if=buff.mongoose_fury.up|focus>60
0.00 raptor_strike_eagle,target_if=min:dot.internal_bleeding.stack
G 98.05 raptor_strike,target_if=min:dot.internal_bleeding.stack

Sample Sequence

01235789BEDFGEGCDGCGCEDGCGGECDGGCGGDCEGCGECDGCGGECDFGCEGGCCDGGCE9GCGDGCCEGECCDGGCGEGCEDFGCGGECGCDEGCEGEGCDGEGCGGDCG9BAECGGGCCCDEFGGCGCDEGCCGCEGDCEGCGGGCCDEGCGGDCEFGCGE9GCDGGCCGGECDGECGGCGDECGGCGDFCEGECCGGDCGEGCGDGCCB9EGCEGDCGGGCCCDEFGCEGEGCDGCGGECCGDGCGGECCGDGCGECGDEC

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Hunter_Survival 100.0/100: 100% focus
Pre precombat 1 augmentation T22_Hunter_Survival 100.0/100: 100% focus
Pre precombat 2 food T22_Hunter_Survival 100.0/100: 100% focus
Pre precombat 3 summon_pet Fluffy_Pillow 100.0/100: 100% focus
Pre precombat 5 potion Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
Pre precombat 7 harpoon Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
0:00.000 default 8 auto_attack Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
0:00.000 default 9 use_items Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility
0:00.000 default B coordinated_assault Fluffy_Pillow 100.0/100: 100% focus battle_potion_of_agility, galecallers_boon
0:01.098 default E serpent_sting Fluffy_Pillow 100.0/100: 100% focus bloodlust, coordinated_assault, predator, battle_potion_of_agility, galecallers_boon
0:01.945 default D wildfire_bomb Fluffy_Pillow 87.6/100: 88% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:02.786 default F flanking_strike Fluffy_Pillow 95.1/100: 95% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:03.627 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:04.468 default E serpent_sting Fluffy_Pillow 77.5/100: 78% focus bloodlust, coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:05.308 default G raptor_strike Fluffy_Pillow 85.1/100: 85% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:06.149 default C kill_command Fluffy_Pillow 62.6/100: 63% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:06.991 default D wildfire_bomb Fluffy_Pillow 85.1/100: 85% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:07.831 default G raptor_strike Fluffy_Pillow 92.6/100: 93% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:08.672 default C kill_command Fluffy_Pillow 70.2/100: 70% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:09.513 default G raptor_strike Fluffy_Pillow 92.7/100: 93% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility, galecallers_boon
0:10.355 default C kill_command Fluffy_Pillow 69.8/100: 70% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:11.325 default E serpent_sting Fluffy_Pillow 92.4/100: 92% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:12.295 default D wildfire_bomb Fluffy_Pillow 79.9/100: 80% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:13.265 default G raptor_strike Fluffy_Pillow 87.4/100: 87% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:14.235 default C kill_command Fluffy_Pillow 65.0/100: 65% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:15.205 default G raptor_strike Fluffy_Pillow 87.5/100: 88% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:16.175 default G raptor_strike Fluffy_Pillow 65.1/100: 65% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:17.144 default E serpent_sting Fluffy_Pillow 42.6/100: 43% focus bloodlust, coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:18.113 default C kill_command Fluffy_Pillow 50.1/100: 50% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:19.084 default D wildfire_bomb Fluffy_Pillow 72.7/100: 73% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:20.054 default G raptor_strike Fluffy_Pillow 80.2/100: 80% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:21.025 default G raptor_strike Fluffy_Pillow 57.8/100: 58% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:21.993 default C kill_command Fluffy_Pillow 35.3/100: 35% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:22.961 default G raptor_strike Fluffy_Pillow 57.8/100: 58% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
0:23.932 default G raptor_strike Fluffy_Pillow 35.3/100: 35% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation
0:24.904 default D wildfire_bomb Fluffy_Pillow 12.9/100: 13% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:25.867 default C kill_command Fluffy_Pillow 20.5/100: 20% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:26.830 default E serpent_sting Fluffy_Pillow 43.0/100: 43% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:27.794 default G raptor_strike Fluffy_Pillow 30.5/100: 31% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:28.757 Waiting     0.700 sec 8.1/100: 8% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:29.457 default C kill_command Fluffy_Pillow 13.5/100: 14% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:30.666 default G raptor_strike Fluffy_Pillow 38.0/100: 38% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:31.631 Waiting     1.100 sec 15.5/100: 16% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:32.731 default E serpent_sting Fluffy_Pillow 24.1/100: 24% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:33.694 default C kill_command Fluffy_Pillow 11.7/100: 12% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:34.657 default D wildfire_bomb Fluffy_Pillow 34.2/100: 34% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:35.621 default G raptor_strike Fluffy_Pillow 41.7/100: 42% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(2)
0:36.584 Waiting     0.700 sec 19.3/100: 19% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(3)
0:37.284 default C kill_command Fluffy_Pillow 24.8/100: 25% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(3)
0:38.478 default G raptor_strike Fluffy_Pillow 49.2/100: 49% focus bloodlust, coordinated_assault, predator, frothing_rage, quick_navigation(3)
0:39.435 Waiting     0.500 sec 26.7/100: 27% focus bloodlust, coordinated_assault, predator, frothing_rage(2), quick_navigation(3)
0:39.935 default G raptor_strike Fluffy_Pillow 30.7/100: 31% focus bloodlust, coordinated_assault, predator, frothing_rage(2), quick_navigation(3)
0:40.892 default E serpent_sting Fluffy_Pillow 8.2/100: 8% focus bloodlust, coordinated_assault, vipers_venom, predator, frothing_rage(2), quick_navigation(3)
0:41.848 default C kill_command Fluffy_Pillow 14.2/100: 14% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(4)
0:43.085 default D wildfire_bomb Fluffy_Pillow 36.7/100: 37% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(4)
0:44.319 default F flanking_strike Fluffy_Pillow 44.2/100: 44% focus predator, frothing_rage(2), quick_navigation(4)
0:45.554 default G raptor_strike Fluffy_Pillow 81.7/100: 82% focus predator, frothing_rage(2), quick_navigation(4)
0:46.788 default C kill_command Fluffy_Pillow 59.2/100: 59% focus predator, frothing_rage(2), quick_navigation(4)
0:48.022 default E serpent_sting Fluffy_Pillow 81.8/100: 82% focus predator, frothing_rage(2), quick_navigation(4)
0:49.257 default G raptor_strike Fluffy_Pillow 69.3/100: 69% focus predator, frothing_rage(2), quick_navigation(4)
0:50.493 default G raptor_strike Fluffy_Pillow 46.8/100: 47% focus predator, frothing_rage(2), quick_navigation(4)
0:51.729 default C kill_command Fluffy_Pillow 24.3/100: 24% focus predator, frothing_rage(2), quick_navigation(4)
0:52.964 default C kill_command Fluffy_Pillow 46.8/100: 47% focus predator, frothing_rage(2), quick_navigation(4)
0:54.197 default D wildfire_bomb Fluffy_Pillow 69.4/100: 69% focus predator, frothing_rage(3), quick_navigation(4)
0:55.432 default G raptor_strike Fluffy_Pillow 76.9/100: 77% focus predator, frothing_rage(3), quick_navigation_final
0:56.613 default G raptor_strike Fluffy_Pillow 54.4/100: 54% focus predator, frothing_rage(3), quick_navigation_final
0:57.795 default C kill_command Fluffy_Pillow 32.0/100: 32% focus predator, quick_navigation_final
0:58.976 default E serpent_sting Fluffy_Pillow 54.5/100: 55% focus predator, quick_navigation_final
1:00.157 default 9 use_items Fluffy_Pillow 42.1/100: 42% focus predator, frothing_rage, quick_navigation_final
1:00.157 default G raptor_strike Fluffy_Pillow 42.1/100: 42% focus predator, frothing_rage, quick_navigation_final, galecallers_boon
1:01.190 Waiting     0.800 sec 19.6/100: 20% focus predator, frothing_rage, quick_navigation_final, galecallers_boon
1:01.990 default C kill_command Fluffy_Pillow 25.4/100: 25% focus predator, frothing_rage, quick_navigation_final, galecallers_boon
1:03.236 default G raptor_strike Fluffy_Pillow 49.5/100: 50% focus predator, frothing_rage, quick_navigation_final, galecallers_boon
1:04.268 default D wildfire_bomb Fluffy_Pillow 27.0/100: 27% focus predator, frothing_rage, quick_navigation_final, galecallers_boon
1:05.299 default G raptor_strike Fluffy_Pillow 34.6/100: 35% focus predator, frothing_rage, quick_navigation_final, galecallers_boon
1:06.331 default C kill_command Fluffy_Pillow 11.7/100: 12% focus predator, frothing_rage, galecallers_boon
1:07.475 default C kill_command Fluffy_Pillow 34.5/100: 34% focus predator, frothing_rage, galecallers_boon
1:08.574 default E serpent_sting Fluffy_Pillow 57.0/100: 57% focus predator, frothing_rage, galecallers_boon
1:09.672 default G raptor_strike Fluffy_Pillow 44.5/100: 45% focus predator, frothing_rage, galecallers_boon
1:10.772 default E serpent_sting Fluffy_Pillow 21.5/100: 22% focus vipers_venom, predator, frothing_rage
1:12.038 default C kill_command Fluffy_Pillow 29.0/100: 29% focus predator, frothing_rage
1:13.381 default C kill_command Fluffy_Pillow 52.0/100: 52% focus predator, frothing_rage
1:14.646 default D wildfire_bomb Fluffy_Pillow 74.6/100: 75% focus predator, frothing_rage, quick_navigation
1:16.087 default G raptor_strike Fluffy_Pillow 83.2/100: 83% focus predator, frothing_rage, quick_navigation
1:17.343 default G raptor_strike Fluffy_Pillow 60.7/100: 61% focus predator, frothing_rage, quick_navigation
1:18.600 default C kill_command Fluffy_Pillow 38.2/100: 38% focus predator, frothing_rage, quick_navigation
1:19.857 default G raptor_strike Fluffy_Pillow 60.7/100: 61% focus predator, frothing_rage, quick_navigation
1:21.115 default E serpent_sting Fluffy_Pillow 38.2/100: 38% focus vipers_venom, predator, frothing_rage, quick_navigation
1:22.375 default G raptor_strike Fluffy_Pillow 45.8/100: 46% focus predator, frothing_rage, quick_navigation
1:23.634 default C kill_command Fluffy_Pillow 23.3/100: 23% focus vipers_venom, predator, frothing_rage, quick_navigation
1:24.891 default E serpent_sting Fluffy_Pillow 45.8/100: 46% focus vipers_venom, predator, frothing_rage, quick_navigation(2)
1:26.142 default D wildfire_bomb Fluffy_Pillow 53.3/100: 53% focus predator, frothing_rage, quick_navigation(2)
1:27.392 default F flanking_strike Fluffy_Pillow 60.9/100: 61% focus predator, frothing_rage, quick_navigation(2)
1:28.642 default G raptor_strike Fluffy_Pillow 98.4/100: 98% focus predator, frothing_rage(2), quick_navigation(2)
1:29.892 default C kill_command Fluffy_Pillow 75.9/100: 76% focus predator, frothing_rage(2), quick_navigation(2)
1:31.145 default G raptor_strike Fluffy_Pillow 98.4/100: 98% focus predator, frothing_rage(2), quick_navigation(2)
1:32.394 default G raptor_strike Fluffy_Pillow 75.9/100: 76% focus predator, frothing_rage(2), quick_navigation(2)
1:33.644 default E serpent_sting Fluffy_Pillow 53.5/100: 53% focus vipers_venom, predator, frothing_rage(2), quick_navigation(2)
1:34.895 default C kill_command Fluffy_Pillow 61.0/100: 61% focus predator, frothing_rage(2), quick_navigation(3)
1:36.137 default G raptor_strike Fluffy_Pillow 83.5/100: 84% focus predator, frothing_rage(2), quick_navigation(3)
1:37.380 default C kill_command Fluffy_Pillow 61.1/100: 61% focus vipers_venom, predator, frothing_rage(2), quick_navigation(3)
1:38.624 default D wildfire_bomb Fluffy_Pillow 83.6/100: 84% focus vipers_venom, predator, frothing_rage(2), quick_navigation(3)
1:39.870 default E serpent_sting Fluffy_Pillow 91.1/100: 91% focus vipers_venom, predator, frothing_rage(2), quick_navigation(4)
1:41.105 default G raptor_strike Fluffy_Pillow 98.7/100: 99% focus predator, frothing_rage(2), quick_navigation(4)
1:42.341 default C kill_command Fluffy_Pillow 76.2/100: 76% focus vipers_venom, predator, frothing_rage(2), quick_navigation(4)
1:43.577 default E serpent_sting Fluffy_Pillow 98.7/100: 99% focus vipers_venom, predator, frothing_rage(2), quick_navigation(4)
1:44.812 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus predator, frothing_rage(2), quick_navigation(4)
1:46.051 default E serpent_sting Fluffy_Pillow 77.7/100: 78% focus vipers_venom, predator, frothing_rage(2), quick_navigation_final
1:47.233 default G raptor_strike Fluffy_Pillow 85.2/100: 85% focus predator, frothing_rage(2), quick_navigation_final
1:48.411 default C kill_command Fluffy_Pillow 63.8/100: 64% focus predator, frothing_rage(2), quick_navigation_final, overwhelming_power(24)
1:49.447 default D wildfire_bomb Fluffy_Pillow 86.3/100: 86% focus predator, frothing_rage(2), quick_navigation_final, overwhelming_power(23)
1:50.488 default G raptor_strike Fluffy_Pillow 93.8/100: 94% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(22)
1:51.535 default E serpent_sting Fluffy_Pillow 71.4/100: 71% focus vipers_venom, predator, frothing_rage(3), quick_navigation_final, overwhelming_power(21)
1:52.586 default G raptor_strike Fluffy_Pillow 78.9/100: 79% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(20)
1:53.643 default C kill_command Fluffy_Pillow 56.4/100: 56% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(19)
1:54.706 default G raptor_strike Fluffy_Pillow 78.9/100: 79% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(18)
1:55.773 default G raptor_strike Fluffy_Pillow 56.2/100: 56% focus predator, frothing_rage(3), quick_navigation, overwhelming_power(17)
1:56.913 default D wildfire_bomb Fluffy_Pillow 33.7/100: 34% focus predator, frothing_rage(3), quick_navigation, overwhelming_power(16)
1:58.086 default C kill_command Fluffy_Pillow 41.4/100: 41% focus predator, frothing_rage(3), quick_navigation, overwhelming_power(14)
1:59.245 default G raptor_strike Fluffy_Pillow 63.9/100: 64% focus predator, frothing_rage(3), quick_navigation, overwhelming_power(13)
2:00.410 default 9 use_items Fluffy_Pillow 41.4/100: 41% focus vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(12)
2:00.410 default B coordinated_assault Fluffy_Pillow 41.4/100: 41% focus vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(12), galecallers_boon
2:01.436 default A potion Fluffy_Pillow 48.9/100: 49% focus coordinated_assault, vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(11), galecallers_boon
2:01.436 default E serpent_sting Fluffy_Pillow 48.9/100: 49% focus coordinated_assault, vipers_venom, predator, frothing_rage(3), quick_navigation, overwhelming_power(11), battle_potion_of_agility, galecallers_boon
2:02.471 default C kill_command Fluffy_Pillow 56.4/100: 56% focus coordinated_assault, predator, quick_navigation, overwhelming_power(10), battle_potion_of_agility, galecallers_boon
2:03.510 default G raptor_strike Fluffy_Pillow 79.0/100: 79% focus coordinated_assault, predator, quick_navigation, overwhelming_power(9), battle_potion_of_agility, galecallers_boon
2:04.552 default G raptor_strike Fluffy_Pillow 56.5/100: 56% focus coordinated_assault, predator, quick_navigation, overwhelming_power(8), battle_potion_of_agility, galecallers_boon
2:05.600 default G raptor_strike Fluffy_Pillow 34.0/100: 34% focus coordinated_assault, predator, frothing_rage, quick_navigation, overwhelming_power(7), battle_potion_of_agility, galecallers_boon
2:06.652 default C kill_command Fluffy_Pillow 11.5/100: 11% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation, overwhelming_power(6), battle_potion_of_agility, galecallers_boon
2:07.709 default C kill_command Fluffy_Pillow 34.0/100: 34% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation, overwhelming_power(5), battle_potion_of_agility, galecallers_boon
2:08.774 default C kill_command Fluffy_Pillow 56.5/100: 56% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation, overwhelming_power(4), battle_potion_of_agility, galecallers_boon
2:09.843 default D wildfire_bomb Fluffy_Pillow 79.0/100: 79% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation, overwhelming_power(3), battle_potion_of_agility, galecallers_boon
2:10.919 default E serpent_sting Fluffy_Pillow 86.0/100: 86% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation, overwhelming_power(2), battle_potion_of_agility
2:12.162 default F flanking_strike Fluffy_Pillow 93.5/100: 93% focus coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
2:13.420 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
2:14.679 default G raptor_strike Fluffy_Pillow 77.5/100: 78% focus coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
2:15.938 default C kill_command Fluffy_Pillow 55.1/100: 55% focus coordinated_assault, predator, frothing_rage, quick_navigation, battle_potion_of_agility
2:17.195 default G raptor_strike Fluffy_Pillow 77.6/100: 78% focus coordinated_assault, predator, frothing_rage, quick_navigation(2), battle_potion_of_agility
2:18.446 default C kill_command Fluffy_Pillow 55.1/100: 55% focus coordinated_assault, predator, frothing_rage, quick_navigation(2), battle_potion_of_agility
2:19.697 default D wildfire_bomb Fluffy_Pillow 77.7/100: 78% focus coordinated_assault, predator, frothing_rage, quick_navigation(2), battle_potion_of_agility
2:20.947 default E serpent_sting Fluffy_Pillow 85.2/100: 85% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), battle_potion_of_agility
2:22.198 default G raptor_strike Fluffy_Pillow 72.7/100: 73% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), battle_potion_of_agility
2:23.447 default C kill_command Fluffy_Pillow 50.2/100: 50% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), battle_potion_of_agility
2:24.697 default C kill_command Fluffy_Pillow 72.7/100: 73% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), battle_potion_of_agility
2:25.947 default G raptor_strike Fluffy_Pillow 95.3/100: 95% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), battle_potion_of_agility
2:27.196 default C kill_command Fluffy_Pillow 72.8/100: 73% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2)
2:28.447 default E serpent_sting Fluffy_Pillow 95.3/100: 95% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2)
2:29.696 default G raptor_strike Fluffy_Pillow 82.8/100: 83% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2)
2:30.946 default D wildfire_bomb Fluffy_Pillow 60.3/100: 60% focus coordinated_assault, vipers_venom, predator, frothing_rage(3), quick_navigation(2)
2:32.196 default C kill_command Fluffy_Pillow 67.8/100: 68% focus coordinated_assault, vipers_venom, predator, frothing_rage(3), quick_navigation(2)
2:33.447 default E serpent_sting Fluffy_Pillow 90.4/100: 90% focus coordinated_assault, vipers_venom, predator, frothing_rage(3), quick_navigation(3)
2:34.689 default G raptor_strike Fluffy_Pillow 97.9/100: 98% focus predator, frothing_rage(3), quick_navigation(3)
2:35.935 default C kill_command Fluffy_Pillow 75.4/100: 75% focus predator, frothing_rage(3), quick_navigation(3)
2:37.179 default G raptor_strike Fluffy_Pillow 98.0/100: 98% focus predator, frothing_rage(3), quick_navigation(3)
2:38.424 default G raptor_strike Fluffy_Pillow 75.5/100: 75% focus predator, frothing_rage(3), quick_navigation(3)
2:39.667 default G raptor_strike Fluffy_Pillow 53.0/100: 53% focus predator, frothing_rage(3), quick_navigation(3)
2:40.911 default C kill_command Fluffy_Pillow 30.5/100: 31% focus predator, frothing_rage(3), quick_navigation(3)
2:42.154 default C kill_command Fluffy_Pillow 53.1/100: 53% focus predator, frothing_rage(3), quick_navigation(4)
2:43.389 default D wildfire_bomb Fluffy_Pillow 76.0/100: 76% focus predator, frothing_rage(3), quick_navigation_final
2:44.569 default E serpent_sting Fluffy_Pillow 83.5/100: 83% focus predator, frothing_rage(3), quick_navigation_final
2:45.749 default G raptor_strike Fluffy_Pillow 71.0/100: 71% focus predator, frothing_rage(3), quick_navigation_final
2:46.931 default C kill_command Fluffy_Pillow 48.6/100: 49% focus predator, frothing_rage(3), quick_navigation_final
2:48.110 default G raptor_strike Fluffy_Pillow 71.1/100: 71% focus predator, frothing_rage(3), quick_navigation_final
2:49.288 default G raptor_strike Fluffy_Pillow 48.6/100: 49% focus predator, frothing_rage(3), quick_navigation_final
2:50.467 Waiting     0.500 sec 26.1/100: 26% focus predator, frothing_rage(3), quick_navigation_final
2:50.967 default D wildfire_bomb Fluffy_Pillow 29.3/100: 29% focus predator, frothing_rage(3), quick_navigation_final
2:52.322 default C kill_command Fluffy_Pillow 37.9/100: 38% focus predator, frothing_rage(3)
2:53.587 default E serpent_sting Fluffy_Pillow 60.5/100: 60% focus predator, frothing_rage(3)
2:54.854 default F flanking_strike Fluffy_Pillow 48.0/100: 48% focus predator, frothing_rage(3)
2:56.119 default G raptor_strike Fluffy_Pillow 85.6/100: 86% focus predator, frothing_rage(3), quick_navigation
2:57.377 default C kill_command Fluffy_Pillow 63.1/100: 63% focus predator, frothing_rage(3), quick_navigation
2:58.638 default G raptor_strike Fluffy_Pillow 85.6/100: 86% focus predator, frothing_rage(3), quick_navigation
2:59.897 default E serpent_sting Fluffy_Pillow 63.1/100: 63% focus vipers_venom, predator, frothing_rage(3), quick_navigation
3:01.156 default 9 use_items Fluffy_Pillow 70.7/100: 71% focus predator, frothing_rage(3), quick_navigation
3:01.156 default G raptor_strike Fluffy_Pillow 70.7/100: 71% focus predator, frothing_rage(3), quick_navigation, galecallers_boon
3:02.249 default C kill_command Fluffy_Pillow 48.2/100: 48% focus predator, frothing_rage(3), quick_navigation, galecallers_boon
3:03.340 default D wildfire_bomb Fluffy_Pillow 70.7/100: 71% focus predator, frothing_rage(3), quick_navigation, galecallers_boon
3:04.431 default G raptor_strike Fluffy_Pillow 78.2/100: 78% focus predator, frothing_rage(3), quick_navigation, galecallers_boon
3:05.522 default G raptor_strike Fluffy_Pillow 55.8/100: 56% focus predator, quick_navigation(2), galecallers_boon
3:06.610 default C kill_command Fluffy_Pillow 33.3/100: 33% focus predator, quick_navigation(2), galecallers_boon
3:07.697 default C kill_command Fluffy_Pillow 55.8/100: 56% focus predator, quick_navigation(2), galecallers_boon
3:08.783 default G raptor_strike Fluffy_Pillow 78.4/100: 78% focus predator, quick_navigation(2), galecallers_boon
3:09.870 default G raptor_strike Fluffy_Pillow 55.9/100: 56% focus predator, quick_navigation(2), galecallers_boon
3:10.956 default E serpent_sting Fluffy_Pillow 33.4/100: 33% focus predator, quick_navigation(2), galecallers_boon
3:12.042 default C kill_command Fluffy_Pillow 20.1/100: 20% focus predator, quick_navigation(2)
3:13.413 default D wildfire_bomb Fluffy_Pillow 43.4/100: 43% focus predator, quick_navigation(2)
3:14.663 default G raptor_strike Fluffy_Pillow 50.9/100: 51% focus predator, quick_navigation(2)
3:15.914 default E serpent_sting Fluffy_Pillow 28.4/100: 28% focus vipers_venom, predator, quick_navigation(2)
3:17.162 default C kill_command Fluffy_Pillow 35.9/100: 36% focus predator, quick_navigation(2)
3:18.412 default G raptor_strike Fluffy_Pillow 58.4/100: 58% focus predator, quick_navigation(2)
3:19.662 default G raptor_strike Fluffy_Pillow 36.0/100: 36% focus predator, quick_navigation(2)
3:20.913 Waiting     1.000 sec 13.5/100: 13% focus predator, quick_navigation(2)
3:21.913 default C kill_command Fluffy_Pillow 19.5/100: 20% focus predator, quick_navigation(2)
3:23.401 default G raptor_strike Fluffy_Pillow 43.5/100: 43% focus predator, quick_navigation(2)
3:24.652 default D wildfire_bomb Fluffy_Pillow 21.1/100: 21% focus predator, quick_navigation(4)
3:25.887 Waiting     0.200 sec 28.6/100: 29% focus predator, quick_navigation(4)
3:26.087 default E serpent_sting Fluffy_Pillow 29.8/100: 30% focus predator, quick_navigation(4)
3:27.323 default C kill_command Fluffy_Pillow 17.3/100: 17% focus predator, quick_navigation(4)
3:28.557 default G raptor_strike Fluffy_Pillow 39.8/100: 40% focus predator, quick_navigation(4)
3:29.792 Waiting     1.700 sec 18.2/100: 18% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(24)
3:31.492 default G raptor_strike Fluffy_Pillow 30.0/100: 30% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(22)
3:32.583 default C kill_command Fluffy_Pillow 7.5/100: 8% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(21)
3:33.681 default G raptor_strike Fluffy_Pillow 30.0/100: 30% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(20)
3:34.784 default D wildfire_bomb Fluffy_Pillow 7.5/100: 8% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(19)
3:35.893 default F flanking_strike Fluffy_Pillow 15.0/100: 15% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(18)
3:37.008 default C kill_command Fluffy_Pillow 52.5/100: 53% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(16)
3:38.136 default E serpent_sting Fluffy_Pillow 75.0/100: 75% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(15)
3:39.269 default G raptor_strike Fluffy_Pillow 62.5/100: 63% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(14)
3:40.410 default E serpent_sting Fluffy_Pillow 40.1/100: 40% focus vipers_venom, predator, frothing_rage, quick_navigation(4), overwhelming_power(13)
3:41.556 default C kill_command Fluffy_Pillow 47.6/100: 48% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(12)
3:42.707 default C kill_command Fluffy_Pillow 70.1/100: 70% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(11)
3:43.868 default G raptor_strike Fluffy_Pillow 92.6/100: 93% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(10)
3:45.033 default G raptor_strike Fluffy_Pillow 70.0/100: 70% focus predator, frothing_rage, quick_navigation(4), overwhelming_power(8)
3:46.212 default D wildfire_bomb Fluffy_Pillow 47.9/100: 48% focus predator, frothing_rage, quick_navigation_final, overwhelming_power(7)
3:47.345 default C kill_command Fluffy_Pillow 55.4/100: 55% focus predator, frothing_rage, quick_navigation_final, overwhelming_power(6)
3:48.483 default G raptor_strike Fluffy_Pillow 77.9/100: 78% focus predator, frothing_rage, quick_navigation_final, overwhelming_power(5)
3:49.629 default E serpent_sting Fluffy_Pillow 55.4/100: 55% focus predator, frothing_rage, quick_navigation_final, overwhelming_power(4)
3:50.781 default G raptor_strike Fluffy_Pillow 42.9/100: 43% focus predator, frothing_rage, quick_navigation_final, overwhelming_power(3)
3:51.939 default C kill_command Fluffy_Pillow 20.4/100: 20% focus predator, frothing_rage, quick_navigation_final, overwhelming_power(2)
3:53.104 default G raptor_strike Fluffy_Pillow 42.9/100: 43% focus predator, frothing_rage, quick_navigation_final
3:54.283 Waiting     0.600 sec 20.4/100: 20% focus predator, frothing_rage, quick_navigation_final
3:54.883 default D wildfire_bomb Fluffy_Pillow 24.2/100: 24% focus predator, frothing_rage, quick_navigation_final
3:56.382 default G raptor_strike Fluffy_Pillow 33.2/100: 33% focus predator, frothing_rage
3:57.649 default C kill_command Fluffy_Pillow 10.7/100: 11% focus vipers_venom, predator, frothing_rage
3:58.915 default C kill_command Fluffy_Pillow 33.3/100: 33% focus vipers_venom, predator, frothing_rage, quick_navigation
4:00.174 default B coordinated_assault Fluffy_Pillow 55.8/100: 56% focus vipers_venom, predator, frothing_rage, quick_navigation
4:01.501 default 9 use_items Fluffy_Pillow 64.9/100: 65% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation(2), overwhelming_power(24)
4:01.501 default E serpent_sting Fluffy_Pillow 64.9/100: 65% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation(2), overwhelming_power(24), galecallers_boon
4:02.467 default G raptor_strike Fluffy_Pillow 72.4/100: 72% focus coordinated_assault, predator, frothing_rage, quick_navigation(2), overwhelming_power(23), galecallers_boon
4:03.436 default C kill_command Fluffy_Pillow 49.9/100: 50% focus coordinated_assault, vipers_venom, predator, frothing_rage, quick_navigation(2), overwhelming_power(22), galecallers_boon
4:04.410 default E serpent_sting Fluffy_Pillow 72.4/100: 72% focus coordinated_assault, vipers_venom, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(21), galecallers_boon
4:05.386 default G raptor_strike Fluffy_Pillow 79.9/100: 80% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(20), galecallers_boon
4:06.368 default D wildfire_bomb Fluffy_Pillow 57.4/100: 57% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(19), galecallers_boon
4:07.357 default C kill_command Fluffy_Pillow 65.0/100: 65% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(18), galecallers_boon
4:08.351 default G raptor_strike Fluffy_Pillow 87.5/100: 87% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(17), galecallers_boon
4:09.347 default G raptor_strike Fluffy_Pillow 65.0/100: 65% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(16), galecallers_boon
4:10.349 default G raptor_strike Fluffy_Pillow 42.5/100: 43% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(15), galecallers_boon
4:11.357 default C kill_command Fluffy_Pillow 20.0/100: 20% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(14), galecallers_boon
4:12.369 default C kill_command Fluffy_Pillow 41.8/100: 42% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(13)
4:13.528 default C kill_command Fluffy_Pillow 64.3/100: 64% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(12)
4:14.694 default D wildfire_bomb Fluffy_Pillow 86.8/100: 87% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(11)
4:15.866 default E serpent_sting Fluffy_Pillow 94.3/100: 94% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(10)
4:17.046 default F flanking_strike Fluffy_Pillow 81.7/100: 82% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(2), overwhelming_power(8)
4:18.238 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(3), overwhelming_power(7)
4:19.433 default C kill_command Fluffy_Pillow 77.5/100: 78% focus coordinated_assault, vipers_venom, predator, frothing_rage(2), quick_navigation(3), overwhelming_power(5)
4:20.639 default E serpent_sting Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, vipers_venom, predator, frothing_rage(2), quick_navigation(3), overwhelming_power(4)
4:21.852 default G raptor_strike Fluffy_Pillow 100.0/100: 100% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(3), overwhelming_power(3)
4:23.073 default E serpent_sting Fluffy_Pillow 77.5/100: 77% focus coordinated_assault, vipers_venom, predator, frothing_rage(2), quick_navigation(3), overwhelming_power
4:24.307 default G raptor_strike Fluffy_Pillow 85.0/100: 85% focus coordinated_assault, predator, frothing_rage(2), quick_navigation(3)
4:25.550 default C kill_command Fluffy_Pillow 62.5/100: 63% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:26.794 default D wildfire_bomb Fluffy_Pillow 85.0/100: 85% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:28.036 default G raptor_strike Fluffy_Pillow 92.5/100: 93% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:29.281 default C kill_command Fluffy_Pillow 70.1/100: 70% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:30.525 default G raptor_strike Fluffy_Pillow 92.6/100: 93% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:31.768 default G raptor_strike Fluffy_Pillow 70.1/100: 70% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:33.012 default E serpent_sting Fluffy_Pillow 47.7/100: 48% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:34.257 default C kill_command Fluffy_Pillow 35.2/100: 35% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:35.501 default C kill_command Fluffy_Pillow 57.7/100: 58% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:36.745 default G raptor_strike Fluffy_Pillow 80.3/100: 80% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(3)
4:37.986 default D wildfire_bomb Fluffy_Pillow 58.9/100: 59% focus coordinated_assault, predator, frothing_rage(3), quick_navigation(4), overwhelming_power(24)
4:39.065 default G raptor_strike Fluffy_Pillow 66.4/100: 66% focus predator, frothing_rage(3), quick_navigation(4), overwhelming_power(22)
4:40.156 default C kill_command Fluffy_Pillow 43.9/100: 44% focus predator, frothing_rage(3), quick_navigation(4), overwhelming_power(21)
4:41.253 default G raptor_strike Fluffy_Pillow 66.4/100: 66% focus predator, frothing_rage(3), quick_navigation(4), overwhelming_power(20)
4:42.356 default G raptor_strike Fluffy_Pillow 43.9/100: 44% focus predator, frothing_rage(3), quick_navigation(4), overwhelming_power(19)
4:43.465 default E serpent_sting Fluffy_Pillow 21.4/100: 21% focus predator, frothing_rage(3), quick_navigation(4), overwhelming_power(18)
4:44.581 default C kill_command Fluffy_Pillow 9.0/100: 9% focus predator, frothing_rage(3), quick_navigation(4), overwhelming_power(17)
4:45.702 default C kill_command Fluffy_Pillow 31.5/100: 31% focus predator, frothing_rage(3), quick_navigation(4), overwhelming_power(16)
4:46.830 default G raptor_strike Fluffy_Pillow 54.0/100: 54% focus predator, frothing_rage(3), quick_navigation(4), overwhelming_power(15)
4:47.963 default D wildfire_bomb Fluffy_Pillow 31.6/100: 32% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(14)
4:49.054 default G raptor_strike Fluffy_Pillow 39.1/100: 39% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(12)
4:50.158 default C kill_command Fluffy_Pillow 16.6/100: 17% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(11)
4:51.268 default G raptor_strike Fluffy_Pillow 39.1/100: 39% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(10)
4:52.383 Waiting     0.500 sec 16.7/100: 17% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(9)
4:52.883 default E serpent_sting Fluffy_Pillow 20.0/100: 20% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(9)
4:54.006 Waiting     0.400 sec 7.5/100: 8% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(7)
4:54.406 default C kill_command Fluffy_Pillow 10.2/100: 10% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(7)
4:55.754 default G raptor_strike Fluffy_Pillow 34.1/100: 34% focus predator, frothing_rage(3), quick_navigation_final, overwhelming_power(6)
4:56.893 default D wildfire_bomb Fluffy_Pillow 11.6/100: 12% focus vipers_venom, predator, frothing_rage(3), quick_navigation_final, overwhelming_power(5)
4:58.040 default E serpent_sting Fluffy_Pillow 18.8/100: 19% focus vipers_venom, predator, frothing_rage(3), overwhelming_power(3)
4:59.282 default C kill_command Fluffy_Pillow 26.3/100: 26% focus predator, frothing_rage(3), overwhelming_power(2)

Stats

Level Bonus (120) Race Bonus (pandaren) Raid-Buffed Unbuffed Gear Amount
Strength 1467 0 1527 1467 0
Agility 1467 -2 6624 6101 4346 (3433)
Stamina 1001 2 9031 8210 7207
Intellect 1467 0 1679 1467 0
Spirit 0 0 0 0 0
Health 180620 164200 0
Focus 100 100 0
Crit 21.39% 21.39% 820
Haste 18.82% 18.82% 1280
Damage / Heal Versatility 4.13% 4.13% 351
Attack Power 7286 6101 0
Mastery 25.87% 25.87% 553
Armor 2738 2738 2738
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Coif of the Court Spider
ilevel: 390, stats: { 381 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Latent Poison, Overwhelming Power, Gemhide, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amalgamated Abomination Spaulders
ilevel: 390, stats: { 352 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Wilderness Survival, Overwhelming Power, Bulwark of the Masses, Azerite Empowered }
Local Chest C'thraxxi General's Hauberk
ilevel: 390, stats: { 469 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Latent Poison, Azerite Globules, Gemhide, Azerite Empowered }
Local Waist Titanspark Energy Girdle
ilevel: 385, stats: { 255 Armor, +247 AgiInt, +417 Sta, +96 Haste, +88 Crit }
Local Legs Blighted Anima Greaves
ilevel: 385, stats: { 397 Armor, +329 AgiInt, +556 Sta, +149 Haste, +96 Vers }
Local Feet Fused Monstrosity Stompers
ilevel: 385, stats: { 312 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Wrists Rubywrought Sparkguards
ilevel: 385, stats: { 198 Armor, +185 AgiInt, +312 Sta, +78 Haste, +60 Mastery }
Local Hands Oblivion Crushers
ilevel: 385, stats: { 283 Armor, +247 AgiInt, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Galecaller's Boon
ilevel: 370, stats: { +271 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Void-Binder
ilevel: 385, weapon: { 623 - 1158, 3.6 }, stats: { +329 Agi, +556 Sta, +140 Vers, +105 Haste }, enchant: quick_navigation

Talents

Level
15 Viper's Venom (Survival Hunter) Terms of Engagement (Survival Hunter) Alpha Predator (Survival Hunter)
30 Guerrilla Tactics (Survival Hunter) Hydra's Bite (Survival Hunter) Butchery (Survival Hunter)
45 Trailblazer Natural Mending Camouflage
60 Bloodseeker (Survival Hunter) Steel Trap (Survival Hunter) A Murder of Crows (Survival Hunter)
75 Born To Be Wild Posthaste Binding Shot
90 Tip of the Spear (Survival Hunter) Mongoose Bite (Survival Hunter) Flanking Strike (Survival Hunter)
100 Birds of Prey (Survival Hunter) Wildfire Infusion (Survival Hunter) Chakrams (Survival Hunter)

Profile

hunter="T22_Hunter_Survival"
spec=survival
level=120
race=pandaren
role=attack
position=back
talents=1101031

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/steel_trap
actions.precombat+=/harpoon

# Executed every time the actor is available.
actions=auto_attack
actions+=/muzzle,if=equipped.sephuzs_secret&target.debuff.casting.react&cooldown.buff_sephuzs_secret.up&!buff.sephuzs_secret.up
actions+=/use_items
actions+=/berserking,if=cooldown.coordinated_assault.remains>30
actions+=/blood_fury,if=cooldown.coordinated_assault.remains>30
actions+=/ancestral_call,if=cooldown.coordinated_assault.remains>30
actions+=/fireblood,if=cooldown.coordinated_assault.remains>30
actions+=/lights_judgment
actions+=/arcane_torrent,if=cooldown.kill_command.remains>gcd.max&focus<=30
actions+=/potion,if=buff.coordinated_assault.up&(buff.berserking.up|buff.blood_fury.up|!race.troll&!race.orc)
actions+=/variable,name=can_gcd,value=!talent.mongoose_bite.enabled|buff.mongoose_fury.down|(buff.mongoose_fury.remains-(((buff.mongoose_fury.remains*focus.regen+focus)%action.mongoose_bite.cost)*gcd.max)>gcd.max)
actions+=/steel_trap
actions+=/a_murder_of_crows
actions+=/coordinated_assault
actions+=/chakrams,if=active_enemies>1
actions+=/kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3&active_enemies<2
actions+=/wildfire_bomb,if=(focus+cast_regen<focus.max|active_enemies>1)&(dot.wildfire_bomb.refreshable&buff.mongoose_fury.down|full_recharge_time<gcd)
actions+=/kill_command,target_if=min:bloodseeker.remains,if=focus+cast_regen<focus.max&buff.tip_of_the_spear.stack<3
actions+=/butchery,if=(!talent.wildfire_infusion.enabled|full_recharge_time<gcd)&active_enemies>3|(dot.shrapnel_bomb.ticking&dot.internal_bleeding.stack<3)
actions+=/serpent_sting,if=(active_enemies<2&refreshable&(buff.mongoose_fury.down|(variable.can_gcd&!talent.vipers_venom.enabled)))|buff.vipers_venom.up
actions+=/carve,if=active_enemies>2&(active_enemies<6&active_enemies+gcd<cooldown.wildfire_bomb.remains|5+gcd<cooldown.wildfire_bomb.remains)
actions+=/harpoon,if=talent.terms_of_engagement.enabled
actions+=/flanking_strike
actions+=/chakrams
actions+=/serpent_sting,target_if=min:remains,if=refreshable&buff.mongoose_fury.down|buff.vipers_venom.up
actions+=/aspect_of_the_eagle,if=target.distance>=6
actions+=/mongoose_bite_eagle,target_if=min:dot.internal_bleeding.stack,if=buff.mongoose_fury.up|focus>60
actions+=/mongoose_bite,target_if=min:dot.internal_bleeding.stack,if=buff.mongoose_fury.up|focus>60
actions+=/raptor_strike_eagle,target_if=min:dot.internal_bleeding.stack
actions+=/raptor_strike,target_if=min:dot.internal_bleeding.stack

head=coif_of_the_court_spider,id=159358,bonus_id=1557/4819/4775/4786,azerite_powers=3/163/30/85/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=amalgamated_abomination_spaulders,id=159385,bonus_id=1557/4819/4775/4786,azerite_powers=3/372/30/84/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=cthraxxi_generals_hauberk,id=160725,bonus_id=4824/1507/4775,azerite_powers=3/163/462/85/13
wrists=rubywrought_sparkguards,id=160629,bonus_id=4800/1507
hands=oblivion_crushers,id=160721,bonus_id=4800/1507
waist=titanspark_energy_girdle,id=160633,bonus_id=4800/1507
legs=blighted_anima_greaves,id=160716,bonus_id=4800/1507
feet=fused_monstrosity_stompers,id=160628,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=galecallers_boon,id=159614,bonus_id=1542/4779
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=voidbinder,id=160688,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=385.27
# gear_agility=4346
# gear_stamina=7207
# gear_crit_rating=820
# gear_haste_rating=1280
# gear_mastery_rating=553
# gear_versatility_rating=351
# gear_armor=2738

T22_Paladin_Retribution : 18049 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
18049.2 18049.2 12.9 / 0.072% 2224.8 / 12.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 8.66% 52.1 100.0% 100%
Talents
  • 15: Righteous Verdict (Retribution Paladin)
  • 30: Hammer of Wrath (Retribution Paladin)
  • 60: Wake of Ashes (Retribution Paladin)
  • 100: Inquisition (Retribution Paladin)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Paladin_Retribution 18049
Blade of Justice 1581 8.8% 45.2 6.67sec 10488 9890 Direct 45.2 8153 17061 10488 26.2%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.17 45.17 0.00 0.00 1.0605 0.0000 473726.89 677249.48 30.05 9889.91 9889.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.33 73.79% 8153.00 7203 10475 8154.64 7772 8605 271717 388452 30.05
crit 11.84 26.21% 17060.64 14405 20950 17083.79 15469 20873 202010 288797 30.05
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power=3&(cooldown.hammer_of_wrath.remains>gcd*2|variable.HoW))
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Pierces an enemy with a blade of light, dealing ${{$s2=0}*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Crusader Strike 1125 6.2% 61.8 4.66sec 5456 5032 Direct 61.8 4265 8876 5456 25.8%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.77 61.77 0.00 0.00 1.0843 0.0000 337042.04 481842.07 30.05 5032.06 5032.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.81 74.16% 4265.02 3800 5526 4265.90 4106 4487 195388 279331 30.05
crit 15.96 25.84% 8875.61 7648 11053 8885.02 8161 10083 141654 202511 30.05
 
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2&cooldown.consecration.remains>gcd*2)
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:Strike the target for {$s1=0} Physical damage.{$?s137027=false}[ |cFFFFFFFFGenerates {$s2=0} Holy Power.][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Hammer of Wrath 869 4.8% 18.0 17.04sec 14494 13529 Direct 18.0 10562 22336 14509 33.5%  

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.99 17.97 0.00 0.00 1.0714 0.0000 260681.44 260681.44 0.00 13528.54 13528.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.95 66.49% 10562.46 8563 12454 10574.69 9245 11861 126179 126179 0.00
crit 6.02 33.51% 22336.44 17126 24907 22373.63 0 24907 134502 134502 0.00
 
 

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:7.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=4
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:
  • description:Hurls a divine hammer that strikes an enemy for {$s1=0} Holy damage. Only usable on enemies that have less than 20% health, or while you are empowered by {$?s231895=false}[Crusade][Avenging Wrath]. |cFFFFFFFFGenerates {$s2=1} Holy Power.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Heed My Call 167 (238) 0.9% (1.3%) 7.8 35.42sec 9147 0 Direct 7.8 5060 10121 6412 26.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 50117.95 50117.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.73 73.30% 5060.45 5060 5060 5056.40 0 5060 28992 28992 0.00
crit 2.09 26.70% 10120.90 10121 10121 8918.38 0 10121 21126 21126 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 71 0.4% 7.8 35.42sec 2735 0 Direct 7.8 2169 4338 2735 26.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 21381.37 21381.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.77 73.87% 2168.76 2169 2169 2167.32 0 2169 12523 12523 0.00
crit 2.04 26.13% 4337.53 4338 4338 3807.12 0 4338 8858 8858 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Judgment 1368 7.6% 33.3 9.08sec 12322 11710 Direct 33.3 9596 20042 12327 26.1%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.27 33.25 0.00 0.00 1.0523 0.0000 409904.78 409904.78 0.00 11710.23 11710.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.56 73.86% 9596.18 8489 12345 9596.80 9144 10093 235675 235675 0.00
crit 8.69 26.14% 20041.53 16978 24691 20067.45 0 24488 174229 174229 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=4&(cooldown.blade_of_justice.remains>gcd*2|variable.HoW))
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target, dealing {$s1=0} Holy damage{$?s231663=true}[, and causing them to take {$197277s1=25}% increased damage from your next ability that costs Holy Power.][]{$?s137027=false}[ |cFFFFFFFFGenerates {$220637s1=1} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Laser Matrix 1373 7.6% 15.8 18.71sec 26133 0 Direct 15.8 20702 41404 26133 26.2%  

Stats details: laser_matrix

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.75 15.75 0.00 0.00 0.0000 0.0000 411607.40 411607.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.62 73.76% 20701.84 20702 20702 20701.84 20702 20702 240521 240521 0.00
crit 4.13 26.24% 41403.67 41404 41404 40950.93 0 41404 171086 171086 0.00
 
 

Action details: laser_matrix

Static Values
  • id:280705
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:280705
  • name:Laser Matrix
  • school:arcane
  • tooltip:
  • description:{$@spelldesc280559=Your spells and abilities have a chance to release a barrage of lasers, dealing {$s1=4508} Arcane damage split among all enemies and restoring {$s2=5635} health split among injured allies. Enables $@spellname280573 within Uldir.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18900.00
  • base_dd_max:18900.00
 
melee 2014 11.2% 115.5 2.59sec 5229 2019 Direct 115.5 4113 8325 5229 26.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.46 115.46 0.00 0.00 2.5905 0.0000 603744.10 863124.69 30.05 2018.57 2018.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.88 73.51% 4113.48 4015 4556 4114.25 4068 4169 349142 499140 30.05
crit 30.58 26.49% 8324.98 8029 9112 8328.53 8093 8674 254602 363985 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
shield_of_vengeance_proc 467 2.6% 3.0 119.83sec 46545 0 Direct 2.9 48574 0 48574 0.0%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.87 0.00 0.00 0.0000 0.0000 139381.31 139381.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.87 100.00% 48574.12 46323 52468 48610.00 48130 49757 139381 139381 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:46902.57
  • base_dd_max:46902.57
 
Templar's Verdict 7867 43.6% 70.2 4.21sec 33592 31007 Direct 70.2 25860 54238 33593 27.2%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.19 70.19 0.00 0.00 1.0834 0.0000 2357839.20 2357839.20 0.00 31007.47 31007.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.06 72.75% 25859.68 19321 37750 25870.52 24578 27386 1320491 1320491 0.00
crit 19.13 27.25% 54238.31 38642 75501 54307.39 47748 61890 1037348 1037348 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.divine_purpose.react&(!talent.execution_sentence.enabled|cooldown.execution_sentence.remains>gcd)
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:Unleashes a powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage to an enemy target.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Voided Sectors 387 2.1% 9.8 28.77sec 11809 0 Direct 9.8 9354 18708 11809 26.2%  

Stats details: voided_sectors

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.82 9.82 0.00 0.00 0.0000 0.0000 116013.33 116013.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.25 73.75% 9354.16 9354 9354 9354.16 9354 9354 67774 67774 0.00
crit 2.58 26.25% 18708.33 18708 18708 17351.17 0 18708 48239 48239 0.00
 
 

Action details: voided_sectors

Static Values
  • id:278153
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278153
  • name:Voided Sectors
  • school:shadow
  • tooltip:
  • description:{$@spelldesc278152=Your attacks have a chance to cause a Void Sector, instantly dealing {$278153s1=4256} Shadow damage split among all targets in a cone in front of you.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8539.61
  • base_dd_max:8539.61
 
Wake of Ashes 655 3.6% 6.7 47.79sec 29291 30542 Direct 6.7 22562 47366 29292 27.1%  

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.69 6.69 0.00 0.00 0.9591 0.0000 195928.05 195928.05 0.00 30542.17 30542.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.87 72.87% 22562.42 20915 28427 22537.47 20915 28427 109980 109980 0.00
crit 1.81 27.13% 47365.56 41829 56854 41899.28 0 56854 85948 85948 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:255937
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!raid_event.adds.exists|raid_event.adds.in>20)&(holy_power<=0|holy_power=1&cooldown.blade_of_justice.remains>gcd)
Spelldata
  • id:255937
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Lash out at your enemies, dealing $sw1 Radiant damage to all enemies within $a1 yd in front of you and reducing their movement speed by {$s2=50}% for {$d=5 seconds}. Demon and Undead enemies are also stunned for {$255941d=5 seconds}. |cFFFFFFFFGenerates {$s3=5} Holy Power.
 
Wasting Infection 105 0.6% 7.8 35.44sec 4025 0 Periodic 43.0 577 1154 731 26.7% 28.3%

Stats details: wasting_infection

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.81 0.00 42.99 42.99 0.0000 1.9765 31437.54 31437.54 0.00 369.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.5 73.27% 577.12 0 584 577.64 537 584 18178 18178 0.00
crit 11.5 26.73% 1153.87 1 1168 1154.43 0 1168 13260 13260 0.00
 
 

Action details: wasting_infection

Static Values
  • id:278110
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278110
  • name:Wasting Infection
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. The caster's attacks will grant them Critical Strike.
  • description:
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:533.46
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
T22_Paladin_Retribution
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:
 
Avenging Wrath 3.0 120.33sec

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.7469 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.inquisition.up|!talent.inquisition.enabled
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:Damage, healing, and critical strike chance increased by $w1%.
  • description:Call upon the Light to become an avatar of retribution, increasing your damage, healing, and critical strike chance by {$s1=20}% for {$d=20 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:
 
Inquisition 7.3 43.89sec

Stats details: inquisition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 7.25 0.00 13.92 0.00 0.9711 7.5207 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:buff.inquisition.down|buff.inquisition.remains<5&holy_power>=3|talent.execution_sentence.enabled&cooldown.execution_sentence.remains<10&buff.inquisition.remains<15|cooldown.avenging_wrath.remains<15&buff.inquisition.remains<20&holy_power>=3
Spelldata
  • id:84963
  • name:Inquisition
  • school:holy
  • tooltip:Damage done increased by $w1%. Haste increased by $w3%.
  • description:Consumes up to 3 Holy Power to increase your damage done and Haste by {$s1=7}%. Lasts {$d=15 seconds} per Holy Power consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rebuke 10.4 30.06sec

Stats details: rebuke

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.37 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rebuke

Static Values
  • id:96231
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96231
  • name:Rebuke
  • school:physical
  • tooltip:
  • description:Interrupts spellcasting and prevents any spell in that school from being cast for {$d=4 seconds}.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Shield of Vengeance 3.0 120.33sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 2.99 2.99 0.00 0.00 0.7500 0.0000 0.00 145220.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.99 100.00% 0.00 0 0 0.00 0 0 0 145220 100.00
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Paladin_Retribution
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs ${{$s2=30}/100*$MHP} damage for {$d=15 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avenging Wrath 3.0 0.0 120.3sec 120.3sec 19.28% 13.26% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • avenging_wrath_1:19.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:Damage, healing, and critical strike chance increased by $w1%.
  • description:Call upon the Light to become an avatar of retribution, increasing your damage, healing, and critical strike chance by {$s1=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Battle Potion of Strength 2.0 0.0 125.7sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_battle_potion_of_strength
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:900.00

Stack Uptimes

  • battle_potion_of_strength_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279153
  • name:Battle Potion of Strength
  • tooltip:Strength increased by $w1.
  • description:Increases your Strength by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259456
  • name:Well Fed
  • tooltip:Strength increased by $w1.
  • description:Strength increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Critical Prowess 1.0 149.4 0.0sec 2.0sec 99.57% 0.00% 145.4(145.4) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_critical_prowess
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Syringe of Bloodborne Infirmity

Stat Buff details

  • stat:crit_rating
  • amount:101.29

Stack Uptimes

  • critical_prowess_1:0.43%
  • critical_prowess_2:0.74%
  • critical_prowess_3:0.42%
  • critical_prowess_4:0.61%
  • critical_prowess_5:97.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278108
  • name:Critical Prowess
  • tooltip:Increases your Critical Strike by $w1.
  • description:
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Earthlink 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_earthlink
  • max_stacks:6
  • duration:900.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:strength
  • amount:24.00

Stack Uptimes

  • earthlink_1:16.67%
  • earthlink_2:16.67%
  • earthlink_3:16.67%
  • earthlink_4:16.67%
  • earthlink_5:16.67%
  • earthlink_6:16.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279928
  • name:Earthlink
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by $w1.
  • description:{$@spelldesc279926=Azerite energy courses through you, reaching ${{$s1=11}*6} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] and then diminishing down to {$s1=11} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat], cycling every 6 sec.}
  • max_stacks:6
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of the Undertow 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_flask_of_the_undertow
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:strength
  • amount:238.00

Stack Uptimes

  • flask_of_the_undertow_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251839
  • name:Flask of the Undertow
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inquisition 1.5 5.7 121.0sec 43.9sec 98.77% 99.07% 14.3(14.3) 0.5

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_inquisition
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:15.00

Stack Uptimes

  • inquisition_1:98.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:84963
  • name:Inquisition
  • tooltip:Damage done increased by $w1%. Haste increased by $w3%.
  • description:Consumes up to 3 Holy Power to increase your damage done and Haste by {$s1=7}%. Lasts {$d=15 seconds} per Holy Power consumed.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 5.1 0.0 57.4sec 35.5sec 39.38% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.54%
  • overwhelming_power_2:1.55%
  • overwhelming_power_3:1.55%
  • overwhelming_power_4:1.56%
  • overwhelming_power_5:1.57%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.57%
  • overwhelming_power_8:1.58%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.59%
  • overwhelming_power_11:1.59%
  • overwhelming_power_12:1.60%
  • overwhelming_power_13:1.61%
  • overwhelming_power_14:1.61%
  • overwhelming_power_15:1.61%
  • overwhelming_power_16:1.62%
  • overwhelming_power_17:1.63%
  • overwhelming_power_18:1.63%
  • overwhelming_power_19:1.64%
  • overwhelming_power_20:1.64%
  • overwhelming_power_21:1.64%
  • overwhelming_power_22:1.65%
  • overwhelming_power_23:1.66%
  • overwhelming_power_24:1.69%
  • overwhelming_power_25:0.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.0 52.1sec 10.3sec 68.76% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.93%
  • quick_navigation_2:17.46%
  • quick_navigation_3:16.99%
  • quick_navigation_4:16.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.02% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Relentless Inquisitor 3.4 66.8 71.5sec 4.2sec 96.77% 0.00% 50.0(143.6) 2.4

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_relentless_inquisitor
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:14.00

Stack Uptimes

  • relentless_inquisitor_3:3.67%
  • relentless_inquisitor_6:3.59%
  • relentless_inquisitor_9:4.11%
  • relentless_inquisitor_12:4.19%
  • relentless_inquisitor_15:3.64%
  • relentless_inquisitor_18:4.31%
  • relentless_inquisitor_20:73.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279204
  • name:Relentless Inquisitor
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc278617=Spending Holy Power grants you {$s1=0} haste for {$279204d=10 seconds} per Holy Power spent, stacking up to {$279204u=20} times. }
  • max_stacks:20
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Righteous Verdict 70.2 0.0 4.2sec 4.2sec 89.02% 83.57% 0.0(0.0) 10.6

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_righteous_verdict
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • righteous_verdict_1:89.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267611
  • name:Righteous Verdict
  • tooltip:Damage done by Templar's Verdict increased by {$s1=15}%.
  • description:{$@spelldesc267610=Templar's Verdict increases the damage of your next Templar's Verdict by {$267611s1=15}% for {$267611d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shield of Vengeance 3.0 0.0 120.3sec 120.3sec 14.79% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shield_of_vengeance_1:14.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when the barrier fades or is fully consumed.
  • description:Creates a barrier of holy light that absorbs ${{$s2=30}/100*$MHP} damage for {$d=15 seconds}. When the shield expires, it bursts to inflict Holy damage equal to the total amount absorbed, divided among all nearby enemies.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
art_of_war 15.7 18.7sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Rebuke15.5050.00134.108145.782104.004207.294
Shield of Vengeance0.4600.0011.1400.6260.0002.062
Avenging Wrath0.4240.0011.1440.6430.0001.974
Wake of Ashes3.0670.00126.72916.0790.47040.756
Blade of Justice0.6210.0016.84220.4056.11040.304
Judgment0.6390.00111.82114.8463.66332.300
Hammer of Wrath0.7480.0019.63910.6901.33229.483
Crusader Strike2.2320.00124.45522.4242.75952.468

Resources

Resource Usage Type Count Total Average RPE APR
T22_Paladin_Retribution
inquisition Holy Power 7.3 21.7 3.0 3.0 0.0
templars_verdict Holy Power 70.2 210.6 3.0 3.0 11197.4
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 6.69 31.23 (13.31%) 4.67 2.22 6.64%
blade_of_justice Holy Power 45.17 90.34 (38.51%) 2.00 0.00 0.00%
judgment Holy Power 33.25 33.25 (14.18%) 1.00 0.00 0.00%
hammer_of_wrath Holy Power 17.99 17.99 (7.67%) 1.00 0.00 0.00%
crusader_strike Holy Power 61.77 61.77 (26.33%) 1.00 0.00 0.00%
mana_regen Mana 660.86 0.00 (0.00%) 0.00 89854.93 100.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.78 0.77
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Holy Power 2.30 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T22_Paladin_Retribution Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Paladin_Retribution Damage Per Second
Count 7499
Mean 18049.16
Minimum 16105.00
Maximum 20541.94
Spread ( max - min ) 4436.94
Range [ ( max - min ) / 2 * 100% ] 12.29%
Standard Deviation 571.1366
5th Percentile 17136.62
95th Percentile 19012.50
( 95th Percentile - 5th Percentile ) 1875.88
Mean Distribution
Standard Deviation 6.5954
95.00% Confidence Intervall ( 18036.23 - 18062.09 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3847
0.1 Scale Factor Error with Delta=300 2785
0.05 Scale Factor Error with Delta=300 11139
0.01 Scale Factor Error with Delta=300 278461
Priority Target DPS
Sample Data T22_Paladin_Retribution Priority Target Damage Per Second
Count 7499
Mean 18049.16
Minimum 16105.00
Maximum 20541.94
Spread ( max - min ) 4436.94
Range [ ( max - min ) / 2 * 100% ] 12.29%
Standard Deviation 571.1366
5th Percentile 17136.62
95th Percentile 19012.50
( 95th Percentile - 5th Percentile ) 1875.88
Mean Distribution
Standard Deviation 6.5954
95.00% Confidence Intervall ( 18036.23 - 18062.09 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3847
0.1 Scale Factor Error with Delta=300 2785
0.05 Scale Factor Error with Delta=300 11139
0.01 Scale Factor Error with Delta=300 278461
DPS(e)
Sample Data T22_Paladin_Retribution Damage Per Second (Effective)
Count 7499
Mean 18049.16
Minimum 16105.00
Maximum 20541.94
Spread ( max - min ) 4436.94
Range [ ( max - min ) / 2 * 100% ] 12.29%
Damage
Sample Data T22_Paladin_Retribution Damage
Count 7499
Mean 5408805.40
Minimum 4015648.57
Maximum 6848061.60
Spread ( max - min ) 2832413.02
Range [ ( max - min ) / 2 * 100% ] 26.18%
DTPS
Sample Data T22_Paladin_Retribution Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Paladin_Retribution Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Paladin_Retribution Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Paladin_Retribution Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Paladin_Retribution Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Paladin_Retribution Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Paladin_RetributionTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Paladin_Retribution Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 10.37 rebuke
7 0.00 call_action_list,name=opener
8 0.00 call_action_list,name=cooldowns
9 0.00 call_action_list,name=generators
actions.cooldowns
# count action,conditions
A 1.00 potion,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up&buff.crusade.remains<25|target.time_to_die<=40)
0.00 lights_judgment,if=spell_targets.lights_judgment>=2|(!raid_event.adds.exists|raid_event.adds.in>75)
B 1.99 shield_of_vengeance
C 1.96 avenging_wrath,if=buff.inquisition.up|!talent.inquisition.enabled
0.00 crusade,if=holy_power>=4
actions.finishers
# count action,conditions
0.00 variable,name=ds_castable,value=spell_targets.divine_storm>=3|!talent.righteous_verdict.enabled&talent.divine_judgment.enabled&spell_targets.divine_storm>=2|azerite.divine_right.enabled&target.health.pct<=20&buff.divine_right.down
D 6.25 inquisition,if=buff.inquisition.down|buff.inquisition.remains<5&holy_power>=3|talent.execution_sentence.enabled&cooldown.execution_sentence.remains<10&buff.inquisition.remains<15|cooldown.avenging_wrath.remains<15&buff.inquisition.remains<20&holy_power>=3
0.00 execution_sentence,if=spell_targets.divine_storm<=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 divine_storm,if=variable.ds_castable&buff.divine_purpose.react
0.00 divine_storm,if=variable.ds_castable&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 templars_verdict,if=buff.divine_purpose.react&(!talent.execution_sentence.enabled|cooldown.execution_sentence.remains>gcd)
E 70.19 templars_verdict,if=(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)&(!talent.execution_sentence.enabled|buff.crusade.up&buff.crusade.stack<10|cooldown.execution_sentence.remains>gcd*2)
actions.generators
# count action,conditions
0.00 variable,name=HoW,value=(!talent.hammer_of_wrath.enabled|target.health.pct>=20&(buff.avenging_wrath.down|buff.crusade.down))
F 0.00 call_action_list,name=finishers,if=holy_power>=5
G 5.69 wake_of_ashes,if=(!raid_event.adds.exists|raid_event.adds.in>20)&(holy_power<=0|holy_power=1&cooldown.blade_of_justice.remains>gcd)
H 44.17 blade_of_justice,if=holy_power<=2|(holy_power=3&(cooldown.hammer_of_wrath.remains>gcd*2|variable.HoW))
I 32.27 judgment,if=holy_power<=2|(holy_power<=4&(cooldown.blade_of_justice.remains>gcd*2|variable.HoW))
J 17.99 hammer_of_wrath,if=holy_power<=4
0.00 consecration,if=holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2
K 0.00 call_action_list,name=finishers,if=talent.hammer_of_wrath.enabled&(target.health.pct<=20|buff.avenging_wrath.up|buff.crusade.up)&(buff.divine_purpose.up|buff.crusade.stack<10)
L 14.22 crusader_strike,if=cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2&cooldown.consecration.remains>gcd*2)
M 0.00 call_action_list,name=finishers
N 47.55 crusader_strike,if=holy_power<=4
0.00 arcane_torrent,if=(debuff.execution_sentence.up|(talent.hammer_of_wrath.enabled&(target.health.pct>=20|buff.avenging_wrath.down|buff.crusade.down))|!talent.execution_sentence.enabled|!talent.hammer_of_wrath.enabled)&holy_power<=4
actions.opener
# count action,conditions
0.00 sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&talent.execution_sentence.enabled&!talent.hammer_of_wrath.enabled,name=wake_opener_ES_CS:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:crusader_strike:execution_sentence
0.00 sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&!talent.execution_sentence.enabled&!talent.hammer_of_wrath.enabled,name=wake_opener_CS:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:crusader_strike:templars_verdict
0.00 sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&talent.execution_sentence.enabled&talent.hammer_of_wrath.enabled,name=wake_opener_ES_HoW:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:hammer_of_wrath:execution_sentence
0.00 sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&!talent.execution_sentence.enabled&talent.hammer_of_wrath.enabled,name=wake_opener_HoW:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:hammer_of_wrath:templars_verdict
O 6.00 sequence,if=talent.wake_of_ashes.enabled&talent.inquisition.enabled,name=wake_opener_Inq:shield_of_vengeance:blade_of_justice:judgment:inquisition:avenging_wrath:wake_of_ashes

Sample Sequence

01245OO6OOOOEJHEIEJLNHEJIENNHEJEINHENNHEIENHENIN6HENDIHEGELENHIENNEHIENNHEIN6EHNEINHDNIEGEHELNHEIENNHEI6NHENDBIHCAJELNEHIJENHEJNIEHEGELEI6HLENNEHIENNHEINENHHDIENNHEN6IEGEHELNIEHENN6IEHNHENIEHDNNI6EHNENIHEGENBJEHCIJ6ELEHJEILNJEHE6HIJDLNEHJIELNJEHEGEIJEH6ELJNEIHJE

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Paladin_Retribution 20000.0/20000: 100% mana | 0.0/5: 0% holy_power
Pre precombat 1 food T22_Paladin_Retribution 20000.0/20000: 100% mana | 0.0/5: 0% holy_power
Pre precombat 2 augmentation T22_Paladin_Retribution 20000.0/20000: 100% mana | 0.0/5: 0% holy_power
Pre precombat 4 potion Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power battle_potion_of_strength
0:00.000 default 5 auto_attack Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power battle_potion_of_strength
0:00.000 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power battle_potion_of_strength
0:01.285 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, shield_of_vengeance, battle_potion_of_strength
0:02.274 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, shield_of_vengeance, quick_navigation, critical_prowess, battle_potion_of_strength
0:02.274 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, shield_of_vengeance, quick_navigation, critical_prowess, battle_potion_of_strength
0:03.256 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, shield_of_vengeance, quick_navigation, critical_prowess(2), battle_potion_of_strength
0:04.238 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, inquisition, shield_of_vengeance, quick_navigation, critical_prowess(2), battle_potion_of_strength
0:05.156 opener O wake_opener_Inq Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, inquisition, shield_of_vengeance, avenging_wrath, quick_navigation, critical_prowess(3), battle_potion_of_strength
0:06.074 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power bloodlust, inquisition, shield_of_vengeance, avenging_wrath, quick_navigation, overwhelming_power(24), critical_prowess(3), battle_potion_of_strength
0:06.931 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation, overwhelming_power(24), critical_prowess(4), battle_potion_of_strength
0:07.784 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation, overwhelming_power(23), critical_prowess(4), battle_potion_of_strength
0:08.639 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation, overwhelming_power(22), critical_prowess(5), battle_potion_of_strength
0:09.496 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation, overwhelming_power(21), critical_prowess(5), battle_potion_of_strength
0:10.353 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation, overwhelming_power(20), critical_prowess(5), battle_potion_of_strength
0:11.212 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(9), avenging_wrath, quick_navigation, overwhelming_power(19), critical_prowess(5), battle_potion_of_strength
0:12.069 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(9), avenging_wrath, quick_navigation, overwhelming_power(18), critical_prowess(5), battle_potion_of_strength
0:12.928 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(9), avenging_wrath, quick_navigation, overwhelming_power(18), critical_prowess(5), battle_potion_of_strength
0:13.787 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(9), avenging_wrath, quick_navigation, overwhelming_power(17), critical_prowess(5), battle_potion_of_strength
0:14.651 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power bloodlust, righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(9), avenging_wrath, quick_navigation, overwhelming_power(16), critical_prowess(5), battle_potion_of_strength
0:15.516 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation, overwhelming_power(15), critical_prowess(5), battle_potion_of_strength
0:16.380 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation, overwhelming_power(14), critical_prowess(5), battle_potion_of_strength
0:17.247 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation, overwhelming_power(13), critical_prowess(5), battle_potion_of_strength
0:18.115 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(15), avenging_wrath, quick_navigation, overwhelming_power(12), critical_prowess(5), battle_potion_of_strength
0:18.982 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(15), avenging_wrath, quick_navigation, overwhelming_power(12), critical_prowess(5), battle_potion_of_strength
0:19.847 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(15), avenging_wrath, quick_navigation(3), overwhelming_power(11), critical_prowess(5), battle_potion_of_strength
0:20.705 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(15), avenging_wrath, quick_navigation(3), overwhelming_power(10), critical_prowess(5), battle_potion_of_strength
0:21.567 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(18), avenging_wrath, quick_navigation(3), overwhelming_power(9), critical_prowess(5), battle_potion_of_strength
0:22.427 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(18), avenging_wrath, quick_navigation(3), overwhelming_power(8), critical_prowess(5), battle_potion_of_strength
0:23.289 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), overwhelming_power(7), critical_prowess(5)
0:24.151 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), overwhelming_power(6), critical_prowess(5)
0:25.013 Waiting     0.600 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(5), critical_prowess(5)
0:25.613 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(5), critical_prowess(5)
0:26.699 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(4), critical_prowess(5)
0:27.563 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(3), critical_prowess(5)
0:28.429 Waiting     0.600 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(2), critical_prowess(5)
0:29.029 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power, critical_prowess(5)
0:30.104 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:30.978 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:31.852 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:32.727 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:33.602 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:34.475 Waiting     1.500 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:35.975 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:37.072 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:37.945 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:38.820 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:39.694 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:40.569 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:40.569 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power bloodlust, righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:41.443 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
0:42.576 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
0:43.476 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
0:44.778 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
0:45.862 Waiting     0.900 sec 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
0:46.762 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
0:48.035 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
0:49.123 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
0:50.206 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
0:51.288 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
0:52.370 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
0:53.534 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
0:54.698 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
0:55.861 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
0:57.023 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
0:58.187 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
0:59.349 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:00.506 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:01.406 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:02.809 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:03.967 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:05.124 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:06.024 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:07.406 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:08.561 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:09.716 Waiting     1.000 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:10.716 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:12.032 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:13.193 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:14.351 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:15.251 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:16.629 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:17.783 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
1:17.783 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
1:18.933 Waiting     0.900 sec 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
1:19.833 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
1:21.232 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
1:22.382 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(24), critical_prowess(5)
1:23.453 Waiting     0.800 sec 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(23), critical_prowess(5)
1:24.253 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(22), critical_prowess(5)
1:25.487 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(21), critical_prowess(5)
1:26.568 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(20), critical_prowess(5)
1:27.468 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(19), critical_prowess(5)
1:28.749 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 4.0/5: 80% holy_power inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(18), critical_prowess(5)
1:29.839 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(17), critical_prowess(5)
1:30.935 Waiting     2.000 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(16), critical_prowess(5)
1:32.935 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, quick_navigation(2), overwhelming_power(14), critical_prowess(5)
1:34.269 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, quick_navigation(2), overwhelming_power(12), critical_prowess(5)
1:35.417 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(2), overwhelming_power(10), critical_prowess(5)
1:36.566 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(3), quick_navigation(4), overwhelming_power(9), critical_prowess(5)
1:37.705 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation(4), overwhelming_power(8), critical_prowess(5)
1:38.841 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), quick_navigation_final, overwhelming_power(7), critical_prowess(5)
1:39.927 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation_final, overwhelming_power(6), critical_prowess(5)
1:41.013 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation_final, overwhelming_power(4), critical_prowess(5)
1:42.103 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation_final, overwhelming_power(3), critical_prowess(5)
1:43.197 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), quick_navigation_final, overwhelming_power(2), critical_prowess(5)
1:44.292 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation_final, overwhelming_power, critical_prowess(5)
1:45.386 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), quick_navigation_final, critical_prowess(5)
1:46.481 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, critical_prowess(5)
1:47.574 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, critical_prowess(5)
1:48.474 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), critical_prowess(5)
1:49.870 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), critical_prowess(5)
1:51.051 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation, critical_prowess(5)
1:52.218 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation, critical_prowess(5)
1:53.118 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation, critical_prowess(5)
1:54.523 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation, critical_prowess(5)
1:54.523 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation, critical_prowess(5)
1:55.683 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation, critical_prowess(5)
1:56.843 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation, critical_prowess(5)
1:58.007 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
1:59.163 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:00.318 cooldowns B shield_of_vengeance T22_Paladin_Retribution 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:01.474 Waiting     0.900 sec 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:02.374 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:03.732 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:04.885 cooldowns C avenging_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
2:06.033 cooldowns A potion Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
2:06.033 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5), battle_potion_of_strength
2:07.183 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power inquisition, shield_of_vengeance, avenging_wrath, quick_navigation(2), critical_prowess(5), battle_potion_of_strength
2:08.373 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation(3), critical_prowess(5), battle_potion_of_strength
2:09.550 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation(3), critical_prowess(5), battle_potion_of_strength
2:10.727 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(3), avenging_wrath, quick_navigation(3), critical_prowess(5), battle_potion_of_strength
2:11.905 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation(3), critical_prowess(5), battle_potion_of_strength
2:13.075 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation(3), critical_prowess(5), battle_potion_of_strength
2:14.247 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(6), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:15.412 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(6), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:16.576 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:17.734 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:18.894 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(9), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:20.052 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:21.203 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:22.354 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:23.504 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(12), avenging_wrath, quick_navigation(4), critical_prowess(5), battle_potion_of_strength
2:24.656 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), avenging_wrath, quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:25.749 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(15), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:26.840 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:27.926 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(18), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:29.014 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:30.096 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5), battle_potion_of_strength
2:31.180 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
2:32.262 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
2:32.262 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
2:33.346 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
2:34.428 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
2:35.594 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
2:36.757 Waiting     1.000 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
2:37.757 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
2:39.138 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
2:40.295 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), overwhelming_power(24), critical_prowess(5)
2:41.368 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(23), critical_prowess(5)
2:42.437 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), overwhelming_power(22), critical_prowess(5)
2:43.510 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(21), critical_prowess(5)
2:44.578 Waiting     1.800 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(20), critical_prowess(5)
2:46.378 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(18), critical_prowess(5)
2:47.659 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(17), critical_prowess(5)
2:48.845 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(16), critical_prowess(5)
2:49.928 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(15), critical_prowess(5)
2:51.022 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(13), critical_prowess(5)
2:52.115 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(12), critical_prowess(5)
2:53.211 Waiting     1.900 sec 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(11), critical_prowess(5)
2:55.111 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), overwhelming_power(9), critical_prowess(5)
2:56.380 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(8), critical_prowess(5)
2:57.439 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(7), critical_prowess(5)
2:58.502 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 5.0/5: 100% holy_power relentless_inquisitor(20), quick_navigation_final, overwhelming_power(6), critical_prowess(5)
2:59.643 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(5), critical_prowess(5)
3:00.711 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(4), critical_prowess(5)
3:01.783 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(3), critical_prowess(5)
3:02.858 Waiting     0.800 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(2), critical_prowess(5)
3:03.658 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power, critical_prowess(5)
3:04.918 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
3:06.057 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:07.219 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:08.119 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:09.532 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:09.532 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:10.696 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:11.859 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
3:13.020 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:14.176 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:15.334 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:16.490 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:17.647 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:18.803 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:19.960 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:21.116 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:22.016 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:23.402 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
3:24.555 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
3:25.705 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
3:26.605 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
3:27.944 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
3:27.944 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
3:29.117 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
3:30.258 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
3:31.400 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(3), critical_prowess(5)
3:32.542 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:33.676 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:34.811 Waiting     0.900 sec 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:35.711 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:37.019 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:38.186 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:39.322 Waiting     0.900 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:40.222 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:41.601 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:42.736 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
3:43.872 Waiting     0.600 sec 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(24), critical_prowess(5)
3:44.472 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(23), critical_prowess(5)
3:45.713 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(22), critical_prowess(5)
3:46.763 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(21), critical_prowess(5)
3:46.763 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(21), critical_prowess(5)
3:47.786 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(20), critical_prowess(5)
3:48.821 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(19), critical_prowess(5)
3:49.850 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(18), critical_prowess(5)
3:50.880 Waiting     1.800 sec 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(17), critical_prowess(5)
3:52.680 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, overwhelming_power(15), critical_prowess(5)
3:54.009 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), overwhelming_power(13), critical_prowess(5)
3:55.163 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(12), critical_prowess(5)
3:56.286 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(11), critical_prowess(5)
3:57.404 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(10), critical_prowess(5)
3:58.526 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(9), critical_prowess(5)
3:59.650 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(7), critical_prowess(5)
4:00.782 cooldowns B shield_of_vengeance T22_Paladin_Retribution 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, overwhelming_power(6), critical_prowess(5)
4:01.917 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation, overwhelming_power(5), critical_prowess(5)
4:03.055 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation, overwhelming_power(3), critical_prowess(5)
4:04.202 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation, overwhelming_power, critical_prowess(5)
4:05.357 cooldowns C avenging_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
4:06.514 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:07.669 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:08.823 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:08.823 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:09.980 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:11.135 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:12.291 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation, critical_prowess(5)
4:13.447 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:14.596 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:15.746 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, shield_of_vengeance, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:16.895 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:18.045 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:19.195 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:20.345 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:21.494 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:22.643 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:23.795 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(2), critical_prowess(5)
4:23.823 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), critical_prowess(5)
4:24.965 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), avenging_wrath, quick_navigation(3), critical_prowess(5)
4:26.107 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:27.242 finishers D inquisition T22_Paladin_Retribution 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:28.376 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:29.510 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:30.646 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power inquisition, relentless_inquisitor(20), quick_navigation(4), critical_prowess(5)
4:31.782 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:32.865 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:33.947 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:35.030 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:36.114 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:37.198 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:38.282 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:39.367 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:40.451 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation_final, critical_prowess(5)
4:41.535 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
4:42.698 generators G wake_of_ashes Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
4:43.860 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/5: 100% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
4:45.022 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
4:46.186 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
4:47.350 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
4:48.513 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), critical_prowess(5)
4:49.720 default 6 rebuke Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
4:49.720 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
4:50.876 generators L crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
4:52.033 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
4:53.191 generators N crusader_strike Fluffy_Pillow 20000.0/20000: 100% mana | 2.0/5: 40% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
4:54.348 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation, critical_prowess(5)
4:55.507 generators I judgment Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/5: 0% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
4:56.657 generators H blade_of_justice Fluffy_Pillow 20000.0/20000: 100% mana | 1.0/5: 20% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
4:57.806 generators J hammer_of_wrath Fluffy_Pillow 20000.0/20000: 100% mana | 3.0/5: 60% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)
4:58.957 finishers E templars_verdict Fluffy_Pillow 20000.0/20000: 100% mana | 4.0/5: 80% holy_power righteous_verdict, inquisition, relentless_inquisitor(20), quick_navigation(2), critical_prowess(5)

Stats

Level Bonus (120) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength 1467 0 6565 6147 4388 (3433)
Agility 1467 0 1467 1467 0
Stamina 1001 0 13091 11901 7207
Intellect 1467 0 1613 1467 0
Spirit 0 0 0 0 0
Health 261820 238020 0
Mana 20000 20000 0
Holy Power 5 5 0
Spell Power 8500 7326 0
Crit 15.32% 15.32% 743
Haste 16.65% 16.65% 1132
Damage / Heal Versatility 4.32% 4.32% 367
ManaReg per Second 300 300 0
Attack Power 7222 6147 0
Mastery 31.07% 31.07% 822
Armor 4055 4055 4055
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Helm of the Defiled Laboratorium
ilevel: 390, stats: { 571 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Laser Matrix, Heed My Call, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Pauldrons of the Horned Horror
ilevel: 390, stats: { 527 Armor, +491 StrInt, +892 Sta }
azerite powers: { Relentless Inquisitor, Overwhelming Power, Azerite Empowered }
Local Chest Chestplate of Apocalyptic Machinations
ilevel: 390, stats: { 702 Armor, +655 StrInt, +1189 Sta }
azerite powers: { Laser Matrix, Earthlink, Azerite Empowered }
Local Waist Decontaminator's Greatbelt
ilevel: 385, stats: { 382 Armor, +247 StrInt, +417 Sta, +123 Mastery, +60 Crit }
Local Legs Greaves of Unending Vigil
ilevel: 385, stats: { 594 Armor, +329 StrInt, +556 Sta, +165 Haste, +81 Mastery }
Local Feet Warboots of Absolute Eradication
ilevel: 385, stats: { 467 Armor, +247 StrInt, +417 Sta, +111 Haste, +72 Vers }
Local Wrists Imperious Vambraces
ilevel: 385, stats: { 297 Armor, +185 StrInt, +312 Sta, +83 Vers, +54 Haste }
Local Hands Waste Disposal Crushers
ilevel: 385, stats: { 424 Armor, +247 StrInt, +417 Sta, +115 Crit, +68 Vers }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Syringe of Bloodborne Infirmity
ilevel: 385, stats: { +313 Str }
Local Trinket2 Disc of Systematic Regression
ilevel: 385, stats: { +313 Str }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Voror, Gleaming Blade of the Stalwart
ilevel: 385, weapon: { 667 - 1114, 3.6 }, stats: { +329 Str, +556 Sta, +137 Vers, +109 Mastery }, enchant: quick_navigation

Talents

Level
15 Zeal (Retribution Paladin) Righteous Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin)
30 Fires of Justice (Retribution Paladin) Blade of Wrath (Retribution Paladin) Hammer of Wrath (Retribution Paladin)
45 Fist of Justice (Retribution Paladin) Repentance Blinding Light
60 Divine Judgment (Retribution Paladin) Consecration (Retribution Paladin) Wake of Ashes (Retribution Paladin)
75 Unbreakable Spirit (Retribution Paladin) Cavalier (Retribution Paladin) Eye for an Eye (Retribution Paladin)
90 Selfless Healer (Retribution Paladin) Justicar's Vengeance (Retribution Paladin) Word of Glory (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Inquisition (Retribution Paladin)

Profile

paladin="T22_Paladin_Retribution"
spec=retribution
level=120
race=human
role=attack
position=back
talents=2303003

# Default consumables
potion=battle_potion_of_strength
flask=flask_of_the_undertow
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/call_action_list,name=opener
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=generators

actions.cooldowns=potion,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up&buff.crusade.remains<25|target.time_to_die<=40)
actions.cooldowns+=/lights_judgment,if=spell_targets.lights_judgment>=2|(!raid_event.adds.exists|raid_event.adds.in>75)
actions.cooldowns+=/shield_of_vengeance
actions.cooldowns+=/avenging_wrath,if=buff.inquisition.up|!talent.inquisition.enabled
actions.cooldowns+=/crusade,if=holy_power>=4

actions.finishers=variable,name=ds_castable,value=spell_targets.divine_storm>=3|!talent.righteous_verdict.enabled&talent.divine_judgment.enabled&spell_targets.divine_storm>=2|azerite.divine_right.enabled&target.health.pct<=20&buff.divine_right.down
actions.finishers+=/inquisition,if=buff.inquisition.down|buff.inquisition.remains<5&holy_power>=3|talent.execution_sentence.enabled&cooldown.execution_sentence.remains<10&buff.inquisition.remains<15|cooldown.avenging_wrath.remains<15&buff.inquisition.remains<20&holy_power>=3
actions.finishers+=/execution_sentence,if=spell_targets.divine_storm<=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions.finishers+=/divine_storm,if=variable.ds_castable&buff.divine_purpose.react
actions.finishers+=/divine_storm,if=variable.ds_castable&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions.finishers+=/templars_verdict,if=buff.divine_purpose.react&(!talent.execution_sentence.enabled|cooldown.execution_sentence.remains>gcd)
actions.finishers+=/templars_verdict,if=(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)&(!talent.execution_sentence.enabled|buff.crusade.up&buff.crusade.stack<10|cooldown.execution_sentence.remains>gcd*2)

actions.generators=variable,name=HoW,value=(!talent.hammer_of_wrath.enabled|target.health.pct>=20&(buff.avenging_wrath.down|buff.crusade.down))
actions.generators+=/call_action_list,name=finishers,if=holy_power>=5
actions.generators+=/wake_of_ashes,if=(!raid_event.adds.exists|raid_event.adds.in>20)&(holy_power<=0|holy_power=1&cooldown.blade_of_justice.remains>gcd)
actions.generators+=/blade_of_justice,if=holy_power<=2|(holy_power=3&(cooldown.hammer_of_wrath.remains>gcd*2|variable.HoW))
actions.generators+=/judgment,if=holy_power<=2|(holy_power<=4&(cooldown.blade_of_justice.remains>gcd*2|variable.HoW))
actions.generators+=/hammer_of_wrath,if=holy_power<=4
actions.generators+=/consecration,if=holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2
actions.generators+=/call_action_list,name=finishers,if=talent.hammer_of_wrath.enabled&(target.health.pct<=20|buff.avenging_wrath.up|buff.crusade.up)&(buff.divine_purpose.up|buff.crusade.stack<10)
actions.generators+=/crusader_strike,if=cooldown.crusader_strike.charges_fractional>=1.75&(holy_power<=2|holy_power<=3&cooldown.blade_of_justice.remains>gcd*2|holy_power=4&cooldown.blade_of_justice.remains>gcd*2&cooldown.judgment.remains>gcd*2&cooldown.consecration.remains>gcd*2)
actions.generators+=/call_action_list,name=finishers
actions.generators+=/crusader_strike,if=holy_power<=4
actions.generators+=/arcane_torrent,if=(debuff.execution_sentence.up|(talent.hammer_of_wrath.enabled&(target.health.pct>=20|buff.avenging_wrath.down|buff.crusade.down))|!talent.execution_sentence.enabled|!talent.hammer_of_wrath.enabled)&holy_power<=4

actions.opener=sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&talent.execution_sentence.enabled&!talent.hammer_of_wrath.enabled,name=wake_opener_ES_CS:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:crusader_strike:execution_sentence
actions.opener+=/sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&!talent.execution_sentence.enabled&!talent.hammer_of_wrath.enabled,name=wake_opener_CS:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:crusader_strike:templars_verdict
actions.opener+=/sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&talent.execution_sentence.enabled&talent.hammer_of_wrath.enabled,name=wake_opener_ES_HoW:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:hammer_of_wrath:execution_sentence
actions.opener+=/sequence,if=talent.wake_of_ashes.enabled&talent.crusade.enabled&!talent.execution_sentence.enabled&talent.hammer_of_wrath.enabled,name=wake_opener_HoW:shield_of_vengeance:blade_of_justice:judgment:crusade:templars_verdict:wake_of_ashes:templars_verdict:hammer_of_wrath:templars_verdict
actions.opener+=/sequence,if=talent.wake_of_ashes.enabled&talent.inquisition.enabled,name=wake_opener_Inq:shield_of_vengeance:blade_of_justice:judgment:inquisition:avenging_wrath:wake_of_ashes

head=helm_of_the_defiled_laboratorium,id=160732,bonus_id=4824/1507/4775,azerite_powers=485/22/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=pauldrons_of_the_horned_horror,id=159455,bonus_id=1557/4819/4775/4786,azerite_powers=154/30/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=chestplate_of_apocalyptic_machinations,id=160722,bonus_id=4824/1507/4775,azerite_powers=485/461/13
wrists=imperious_vambraces,id=160723,bonus_id=4800/1507
hands=waste_disposal_crushers,id=160635,bonus_id=4800/1507
waist=decontaminators_greatbelt,id=160638,bonus_id=4800/1507
legs=greaves_of_unending_vigil,id=160639,bonus_id=4800/1507
feet=warboots_of_absolute_eradication,id=160640,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=syringe_of_bloodborne_infirmity,id=160655,bonus_id=4800/1507
trinket2=disc_of_systematic_regression,id=160650,bonus_id=4800/1507
main_hand=voror_gleaming_blade_of_the_stalwart,id=160686,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=386.27
# gear_strength=4388
# gear_stamina=7207
# gear_crit_rating=728
# gear_haste_rating=1110
# gear_mastery_rating=806
# gear_versatility_rating=360
# gear_armor=4055

T22_Priest_Shadow : 13809 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
13808.8 13808.8 7.8 / 0.056% 1329.8 / 9.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 43.4 100.0% 100%
Talents
  • 15: Shadow Word: Void (Shadow Priest)
  • 30: Body and Soul
  • 45: Twist of Fate (Shadow Priest)
  • 60: Last Word (Shadow Priest)
  • 75: Shadow Crash (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Dark Ascension (Shadow Priest)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
T22_Priest_Shadow 13809
Dark Ascension 0 (454) 0.0% (3.3%) 5.5 60.38sec 24806 20686

Stats details: dark_ascension

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1992 0.0000 0.00 0.00 0.00 20685.93 20685.93
 
 

Action details: dark_ascension

Static Values
  • id:280711
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.voidform.down
Spelldata
  • id:280711
  • name:Dark Ascension
  • school:shadow
  • tooltip:
  • description:Immediately activates a new Voidform, then releases an explosive blast of pure void energy, causing ${{$280800s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. |cFFFFFFFFGenerates ${{$s2=5000}/100} Insanity.|r
 
    Dark Ascension (_damage) 454 3.3% 5.5 60.38sec 24806 0 Direct 10.9 8608 25611 12438 22.5%  

Stats details: dark_ascension_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 10.91 0.00 0.00 0.0000 0.0000 135658.32 135658.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.45 77.48% 8608.49 7808 10815 8612.34 0 10660 72744 72744 0.00
crit 2.46 22.52% 25610.67 15616 43262 19188.07 0 32446 62914 62914 0.00
 
 

Action details: dark_ascension_damage

Static Values
  • id:280800
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:27.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:280800
  • name:Dark Ascension
  • school:shadow
  • tooltip:
  • description:{$@spelldesc280711=Immediately activates a new Voidform, then releases an explosive blast of pure void energy, causing ${{$280800s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. |cFFFFFFFFGenerates ${{$s2=5000}/100} Insanity.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 145 (207) 1.0% (1.5%) 7.4 37.49sec 8406 0 Direct 7.4 4824 9650 5883 22.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.37 7.37 0.00 0.00 0.0000 0.0000 43366.88 43366.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.75 78.04% 4823.63 4714 5185 4819.87 0 5185 27749 27749 0.00
crit 1.62 21.96% 9649.71 9427 10370 7780.51 0 10370 15618 15618 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4422.00
  • base_dd_max:4422.00
 
    Heed My Call (_aoe) 62 0.4% 7.4 37.49sec 2523 0 Direct 7.4 2067 4135 2523 22.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.37 7.37 0.00 0.00 0.0000 0.0000 18597.85 18597.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.75 77.95% 2067.17 2020 2222 2065.04 0 2222 11878 11878 0.00
crit 1.63 22.05% 4134.85 4040 4444 3354.59 0 4444 6720 6720 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1895.00
  • base_dd_max:1895.00
 
Shadow Word: Void (mind_blast) 2559 18.5% 49.2 5.99sec 15584 13556 Direct 50.2 12481 24865 15273 22.5%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.20 50.20 0.00 0.00 1.1496 0.0000 766788.02 766788.02 0.00 13555.87 13555.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.88 77.45% 12480.82 11449 15725 12484.95 12053 13097 485309 485309 0.00
crit 11.32 22.55% 24865.25 22898 31450 24869.46 22898 28297 281479 281479 0.00
 
 

Action details: mind_blast

Static Values
  • id:205351
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • cooldown hasted:true
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205351
  • name:Shadow Word: Void
  • school:shadow
  • tooltip:
  • description:Blasts the target with a word of void for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=15} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 2451 17.8% 76.2 3.84sec 9636 6359 Periodic 198.1 3024 6014 3708 22.9% 37.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.23 0.00 198.11 198.11 1.5154 0.5717 734510.59 734510.59 0.00 6358.57 6358.57
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 152.8 77.13% 3023.85 2774 3842 3024.62 2944 3138 462080 462080 0.00
crit 45.3 22.87% 6013.60 5548 7685 6013.91 5745 6351 272431 272431 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:Movement speed slowed by {$s2=50}% and taking Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds} and slowing their movement speed by {$s2=50}%.$?a185916[ |cFFFFFFFFGenerates ${{$s4=4}*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.337500
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Crash 0 (546) 0.0% (4.0%) 14.8 20.76sec 11061 9529

Stats details: shadow_crash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.81 0.00 0.00 0.00 1.1608 0.0000 0.00 0.00 0.00 9528.94 9528.94
 
 

Action details: shadow_crash

Static Values
  • id:205385
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:1.5000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:raid_event.adds.in>5&raid_event.adds.duration<20
Spelldata
  • id:205385
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within $205386A1 yards. |cFFFFFFFFGenerates {$/100;s2=20} Insanity.|r
 
    Shadow Crash (_damage) 546 4.0% 14.7 20.76sec 11113 0 Direct 14.7 9176 18288 11113 21.3%  

Stats details: shadow_crash_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.74 14.74 0.00 0.00 0.0000 0.0000 163812.02 163812.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.61 78.74% 9175.94 8423 11667 9178.15 8602 9909 106504 106504 0.00
crit 3.13 21.26% 18288.06 16846 23335 17713.31 0 23335 57308 57308 0.00
 
 

Action details: shadow_crash_damage

Static Values
  • id:205386
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205386
  • name:Shadow Crash
  • school:shadow
  • tooltip:
  • description:{$@spelldesc205385=Hurl a bolt of slow-moving Shadow energy at the destination, dealing {$205386s1=0} Shadow damage to all targets within $205386A1 yards. |cFFFFFFFFGenerates {$/100;s2=20} Insanity.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Pain 1551 11.2% 7.5 41.46sec 71839 61382 Direct 7.5 1981 3953 2415 22.0%  
Periodic 192.4 1904 3794 2322 22.1% 98.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.54 7.54 192.39 192.39 1.1704 1.5312 464835.26 464835.26 0.00 1784.42 61381.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.88 77.97% 1981.16 1808 2505 1982.49 1808 2277 11641 11641 0.00
crit 1.66 22.03% 3952.61 3616 5009 3338.54 0 5009 6562 6562 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 149.9 77.93% 1904.48 4 2365 1904.95 1855 1978 285535 285535 0.00
crit 42.5 22.07% 3794.24 8 4730 3794.92 3582 4024 161097 161097 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=0} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=16 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.220000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.165000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Shadowy Apparitions 0 (256) 0.0% (1.9%) 42.5 6.84sec 1803 0

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
 
        Shadowy Apparition 256 1.9% 41.9 6.83sec 1828 0 Direct 41.9 1828 0 1828 0.0%  

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.88 41.88 0.00 0.00 0.0000 0.0000 76551.53 76551.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.88 100.00% 1827.95 1685 2333 1828.42 1747 1931 76552 76552 0.00
 
 

Action details: shadowy_apparition

Static Values
  • id:148859
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148859
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.250000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 1275 9.2% 5.8 54.20sec 65353 56767 Periodic 127.1 2465 4909 3008 22.2% 97.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.85 0.00 127.06 127.06 1.1513 2.3033 382210.27 382210.27 0.00 1276.63 56766.71
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.8 77.78% 2465.17 2 3131 2465.96 2397 2575 243640 243640 0.00
crit 28.2 22.22% 4908.93 74 6262 4909.98 4651 5295 138570 138570 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(target.time_to_die>6)
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=21 seconds}, and heals you for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.275000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 2775 20.1% 63.8 4.70sec 13031 11512 Direct 63.7 10822 21608 13058 20.7%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.79 63.66 0.00 0.00 1.1319 0.0000 831219.08 831219.08 0.00 11512.25 11512.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.46 79.27% 10822.30 9862 13662 10826.51 10408 11343 546113 546113 0.00
crit 13.19 20.73% 21607.87 19725 27323 21611.51 19853 24531 285106 285106 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dark_void.enabled&dot.shadow_word_pain.remains>travel_time
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=0} Shadow damage$?a231688[ and extending the duration of Shadow Word: Pain and Vampiric Touch on all nearby targets by ${{$231688s1=3000}/1000}.1 sec][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Void Eruption 0 (389) 0.0% (2.8%) 4.9 60.04sec 24074 12062

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.85 0.00 0.00 0.00 1.9960 0.0000 0.00 0.00 0.00 12061.92 12061.92
 
 

Action details: void_eruption

Static Values
  • id:228260
  • school:shadow
  • resource:insanity
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • cooldown hasted:true
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228260
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:Releases an explosive blast of pure void energy, activating Voidform and causing ${{$228360s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r
 
    Void Eruption (_damage) 389 2.8% 4.9 60.04sec 24074 0 Direct 9.7 8403 25088 12069 22.0%  

Stats details: void_eruption_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.85 9.68 0.00 0.00 0.0000 0.0000 116819.73 116819.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.55 78.03% 8403.22 7808 10815 8391.25 0 10722 63474 63474 0.00
crit 2.13 21.97% 25087.79 15616 43262 17657.97 0 32446 53346 53346 0.00
 
 

Action details: void_eruption_damage

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing ${{$228360s1=0}*2} Shadow damage to all enemies within $a1 yds of your target. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.950000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 173 1.3% 7.4 37.27sec 7027 0 Direct 7.3 5802 11608 7093 22.2%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.37 7.30 0.00 0.00 0.0000 0.0000 51766.64 51766.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.68 77.76% 5802.08 5671 6238 5794.78 0 6238 32929 32929 0.00
crit 1.62 22.24% 11608.41 11342 12476 9438.75 0 12476 18838 18838 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=5320} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5320.32
  • base_dd_max:5320.32
 
pet - mindbender 4432 / 1174
melee 4432 8.5% 69.9 4.05sec 5025 4596 Direct 69.9 4180 8359 5025 20.2%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.88 69.88 0.00 0.00 1.0934 0.0000 351178.37 351178.37 0.00 4596.03 4596.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.74 79.77% 4179.66 3982 4558 4182.21 4079 4304 232995 232995 0.00
crit 14.14 20.23% 8359.14 7963 9116 8363.69 7989 9059 118184 118184 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Priest_Shadow
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Priest_Shadow
  • harmful:false
  • if_expr:
 
Berserking 2.0 0.00sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Priest_Shadow
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Priest_Shadow
  • harmful:false
  • if_expr:
 
Mindbender 5.4 60.68sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.42 0.00 0.00 0.00 1.1345 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates ${{$200010s1=600}/100} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Spell damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Potion of Intellect 2.0 0.0 195.8sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 180.7sec 0.0sec 6.76% 7.05% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
chorus_of_insanity 9.6 0.0 30.0sec 30.0sec 22.65% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_chorus_of_insanity
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:crit_rating
  • amount:48.00

Stack Uptimes

  • chorus_of_insanity_1:0.90%
  • chorus_of_insanity_2:1.05%
  • chorus_of_insanity_3:0.88%
  • chorus_of_insanity_4:1.04%
  • chorus_of_insanity_5:0.90%
  • chorus_of_insanity_6:1.05%
  • chorus_of_insanity_7:0.87%
  • chorus_of_insanity_8:1.04%
  • chorus_of_insanity_9:0.92%
  • chorus_of_insanity_10:1.05%
  • chorus_of_insanity_11:0.87%
  • chorus_of_insanity_12:1.04%
  • chorus_of_insanity_13:0.90%
  • chorus_of_insanity_14:1.06%
  • chorus_of_insanity_15:0.88%
  • chorus_of_insanity_16:1.04%
  • chorus_of_insanity_17:0.90%
  • chorus_of_insanity_18:1.06%
  • chorus_of_insanity_19:0.87%
  • chorus_of_insanity_20:1.04%
  • chorus_of_insanity_21:0.75%
  • chorus_of_insanity_22:0.60%
  • chorus_of_insanity_23:0.58%
  • chorus_of_insanity_24:0.39%
  • chorus_of_insanity_25:0.34%
  • chorus_of_insanity_26:0.34%
  • chorus_of_insanity_27:0.28%
  • chorus_of_insanity_28:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Earthlink 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_earthlink
  • max_stacks:6
  • duration:900.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:23.00

Stack Uptimes

  • earthlink_1:16.67%
  • earthlink_2:16.67%
  • earthlink_3:16.67%
  • earthlink_4:16.67%
  • earthlink_5:16.67%
  • earthlink_6:16.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279928
  • name:Earthlink
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by $w1.
  • description:{$@spelldesc279926=Azerite energy courses through you, reaching ${{$s1=11}*6} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] and then diminishing down to {$s1=11} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat], cycling every 6 sec.}
  • max_stacks:6
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
insanity_drain_stacks 10.3 212.1 30.5sec 29.6sec 72.30% 0.00% 212.1(212.1) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • insanity_drain_stacks_1:72.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Overwhelming Power 4.9 0.0 60.0sec 37.9sec 37.50% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:24.00

Stack Uptimes

  • overwhelming_power_1:1.47%
  • overwhelming_power_2:1.48%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.49%
  • overwhelming_power_6:1.50%
  • overwhelming_power_7:1.50%
  • overwhelming_power_8:1.50%
  • overwhelming_power_9:1.51%
  • overwhelming_power_10:1.51%
  • overwhelming_power_11:1.52%
  • overwhelming_power_12:1.52%
  • overwhelming_power_13:1.53%
  • overwhelming_power_14:1.53%
  • overwhelming_power_15:1.54%
  • overwhelming_power_16:1.54%
  • overwhelming_power_17:1.55%
  • overwhelming_power_18:1.55%
  • overwhelming_power_19:1.56%
  • overwhelming_power_20:1.56%
  • overwhelming_power_21:1.57%
  • overwhelming_power_22:1.57%
  • overwhelming_power_23:1.58%
  • overwhelming_power_24:1.61%
  • overwhelming_power_25:0.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Shadowform 10.6 0.0 29.6sec 30.0sec 27.70% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shadowform_1:27.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Spell damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your spell damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.4 1.2 61.3sec 45.8sec 24.46% 0.00% 1.2(1.2) 4.2

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:24.46%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 1.0 137.7 0.0sec 0.7sec 34.70% 0.00% 137.7(137.7) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • twist_of_fate_1:34.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:123254
  • name:Twist of Fate
  • tooltip:Increases damage and healing by {$s1=10}%.
  • description:{$@spelldesc109142=After damaging a target below {$s1=35}% health, you gain {$123254s2=10}% increased damage and healing for {$123254d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging a target below {$s1=35}% health, you gain {$123254s2=10}% increased damage and healing for {$123254d=8 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Voidform 10.3 0.0 30.5sec 29.6sec 72.30% 67.47% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stack Uptimes

  • voidform_1:3.44%
  • voidform_2:3.43%
  • voidform_3:3.42%
  • voidform_4:3.41%
  • voidform_5:3.39%
  • voidform_6:3.38%
  • voidform_7:3.37%
  • voidform_8:3.36%
  • voidform_9:3.35%
  • voidform_10:3.34%
  • voidform_11:3.33%
  • voidform_12:3.31%
  • voidform_13:3.30%
  • voidform_14:3.29%
  • voidform_15:3.28%
  • voidform_16:3.27%
  • voidform_17:3.26%
  • voidform_18:3.25%
  • voidform_19:3.22%
  • voidform_20:2.82%
  • voidform_21:1.94%
  • voidform_22:1.69%
  • voidform_23:1.18%
  • voidform_24:0.52%
  • voidform_25:0.35%
  • voidform_26:0.34%
  • voidform_27:0.08%
  • voidform_28:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:{$?s205351=false}[Shadow Word: Void][Mind Blast] cooldown reduced by ${$w6/1000}.1 sec. Spell damage dealt increased by $w1%. Haste increased by ${$W4}.1%. Losing ${$w3/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing spell damage you deal by {$194249s1=10}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000}.1 sec,][] and granting an additional ${{$s2=5}/10}.1% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Whispers of the Damned 1.0 62.8 0.0sec 4.7sec 99.63% 0.00% 62.8(62.8) 0.0

Buff details

  • buff initial source:T22_Priest_Shadow
  • cooldown name:buff_whispers_of_the_damned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • whispers_of_the_damned_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:275725
  • name:Whispers of the Damned
  • tooltip:
  • description:{$@spelldesc275722=Void Bolt increases the damage of {$?s205351=false}[Shadow Word: Void][Mind Blast] by {$s1=375} for {$275726d=6 seconds}, stacking up to 6 times.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 42.5 6.8sec

Resources

Resource Usage Type Count Total Average RPE APR
T22_Priest_Shadow
Resource RPS-Gain RPS-Loss
Insanity 10.35 10.13
Combat End Resource Mean Min Max
Mana 19999.00 19999.00 19999.00
Insanity 63.87 0.05 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T22_Priest_Shadow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Priest_Shadow Damage Per Second
Count 7499
Mean 13808.80
Minimum 12799.24
Maximum 15304.21
Spread ( max - min ) 2504.97
Range [ ( max - min ) / 2 * 100% ] 9.07%
Standard Deviation 343.4661
5th Percentile 13273.05
95th Percentile 14405.20
( 95th Percentile - 5th Percentile ) 1132.15
Mean Distribution
Standard Deviation 3.9663
95.00% Confidence Intervall ( 13801.03 - 13816.57 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2377
0.1 Scale Factor Error with Delta=300 1008
0.05 Scale Factor Error with Delta=300 4029
0.01 Scale Factor Error with Delta=300 100706
Priority Target DPS
Sample Data T22_Priest_Shadow Priority Target Damage Per Second
Count 7499
Mean 13808.80
Minimum 12799.24
Maximum 15304.21
Spread ( max - min ) 2504.97
Range [ ( max - min ) / 2 * 100% ] 9.07%
Standard Deviation 343.4661
5th Percentile 13273.05
95th Percentile 14405.20
( 95th Percentile - 5th Percentile ) 1132.15
Mean Distribution
Standard Deviation 3.9663
95.00% Confidence Intervall ( 13801.03 - 13816.57 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2377
0.1 Scale Factor Error with Delta=300 1008
0.05 Scale Factor Error with Delta=300 4029
0.01 Scale Factor Error with Delta=300 100706
DPS(e)
Sample Data T22_Priest_Shadow Damage Per Second (Effective)
Count 7499
Mean 13808.80
Minimum 12799.24
Maximum 15304.21
Spread ( max - min ) 2504.97
Range [ ( max - min ) / 2 * 100% ] 9.07%
Damage
Sample Data T22_Priest_Shadow Damage
Count 7499
Mean 3786136.21
Minimum 2886664.34
Maximum 4718889.35
Spread ( max - min ) 1832225.01
Range [ ( max - min ) / 2 * 100% ] 24.20%
DTPS
Sample Data T22_Priest_Shadow Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Priest_Shadow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Priest_Shadow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Priest_Shadow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Priest_Shadow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Priest_Shadow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Priest_ShadowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Priest_Shadow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
7 0.00 shadow_word_void
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=80|target.health.pct<35
0.00 variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
9 2.00 berserking
A 0.00 run_action_list,name=aoe,if=spell_targets.mind_sear>(5+1*talent.misery.enabled)
B 0.00 run_action_list,name=cleave,if=active_enemies>1
C 0.00 run_action_list,name=single,if=active_enemies=1
actions.single
# count action,conditions
D 4.89 void_eruption
E 5.47 dark_ascension,if=buff.voidform.down
F 63.79 void_bolt
0.00 shadow_word_death,if=target.time_to_die<3|cooldown.shadow_word_death.charges=2|(cooldown.shadow_word_death.charges=1&cooldown.shadow_word_death.remains<gcd.max)
0.00 surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)&target.time_to_die>200|target.time_to_die<75
0.00 dark_void,if=raid_event.adds.in>10
G 5.42 mindbender
0.00 shadow_word_death,if=!buff.voidform.up|(cooldown.shadow_word_death.charges=2&buff.voidform.stack<15)
H 14.81 shadow_crash,if=raid_event.adds.in>5&raid_event.adds.duration<20
I 49.39 mind_blast,if=variable.dots_up
0.00 void_torrent,if=dot.shadow_word_pain.remains>4&dot.vampiric_touch.remains>4
J 7.54 shadow_word_pain,if=refreshable&target.time_to_die>4&!talent.misery.enabled&!talent.dark_void.enabled
K 5.85 vampiric_touch,if=refreshable&target.time_to_die>6|(talent.misery.enabled&dot.shadow_word_pain.refreshable)
L 56.94 mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
0.00 shadow_word_pain

Sample Sequence

0124569EFGHFJKFIIFLFILFLFILFILFHLFILILIDFLFIHFLIFLFILFLIEFGHFJIFLFIKFLIFLHILJLILDFLIFLFHIFLIFLFILEFGIFHKFILFLIFLFIJLHILDFILFILFLFHIFJIFLK9EFGIFLIFHLFILF8LIFLILHIJLDFIKFLFILFLHFILFILEFGIFLIFHLFILFLIFJLFILHLILKDFILFLIFLFHIFJLFI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Priest_Shadow 19999.0/19999: 100% mana | 0.0/100: 0% insanity
Pre precombat 1 food T22_Priest_Shadow 19999.0/19999: 100% mana | 0.0/100: 0% insanity
Pre precombat 2 augmentation T22_Priest_Shadow 19999.0/19999: 100% mana | 0.0/100: 0% insanity
Pre precombat 4 potion Fluffy_Pillow 19999.0/19999: 100% mana | 0.0/100: 0% insanity battle_potion_of_intellect
Pre precombat 5 shadowform Fluffy_Pillow 19999.0/19999: 100% mana | 0.0/100: 0% insanity battle_potion_of_intellect
0:00.000 precombat 6 mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 15.0/100: 15% insanity battle_potion_of_intellect
0:00.000 default 9 berserking Fluffy_Pillow 19999.0/19999: 100% mana | 15.0/100: 15% insanity battle_potion_of_intellect
0:00.000 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 15.0/100: 15% insanity berserking, battle_potion_of_intellect
0:01.111 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 58.2/100: 58% insanity bloodlust, berserking, battle_potion_of_intellect
0:01.956 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 68.5/100: 68% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:02.803 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 68.1/100: 68% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:03.645 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 87.2/100: 87% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:04.483 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 98.6/100: 99% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:05.317 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:06.146 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 100.0/100: 100% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:06.973 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 97.1/100: 97% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:07.801 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:08.624 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:09.441 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 95.5/100: 96% insanity bloodlust, berserking, whispers_of_the_damned, battle_potion_of_intellect
0:11.587 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 92.5/100: 92% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:12.514 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 91.9/100: 92% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:13.437 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:14.356 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.8/100: 95% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:15.271 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 90.0/100: 90% insanity bloodlust, whispers_of_the_damned, battle_potion_of_intellect
0:17.463 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 73.0/100: 73% insanity bloodlust, whispers_of_the_damned, overwhelming_power(25), battle_potion_of_intellect
0:18.301 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 72.4/100: 72% insanity bloodlust, whispers_of_the_damned, overwhelming_power(24), battle_potion_of_intellect
0:19.137 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 70.2/100: 70% insanity bloodlust, whispers_of_the_damned, overwhelming_power(23), battle_potion_of_intellect
0:19.974 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 58.5/100: 58% insanity bloodlust, whispers_of_the_damned, overwhelming_power(23), battle_potion_of_intellect
0:20.809 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 56.1/100: 56% insanity bloodlust, whispers_of_the_damned, overwhelming_power(22), battle_potion_of_intellect
0:21.691 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 51.2/100: 51% insanity bloodlust, whispers_of_the_damned, overwhelming_power(21), battle_potion_of_intellect
0:22.525 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 37.7/100: 38% insanity bloodlust, whispers_of_the_damned, overwhelming_power(20), battle_potion_of_intellect
0:23.356 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 33.8/100: 34% insanity bloodlust, whispers_of_the_damned, overwhelming_power(19)
0:24.186 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 33.4/100: 33% insanity bloodlust, whispers_of_the_damned, overwhelming_power(18)
0:25.015 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 18.5/100: 19% insanity bloodlust, whispers_of_the_damned, overwhelming_power(17)
0:25.843 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 13.0/100: 13% insanity bloodlust, whispers_of_the_damned, overwhelming_power(17)
0:26.670 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 23.9/100: 24% insanity bloodlust, shadowform, chorus_of_insanity(27), whispers_of_the_damned, overwhelming_power(16)
0:29.475 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 41.9/100: 42% insanity bloodlust, shadowform, chorus_of_insanity(24), whispers_of_the_damned, overwhelming_power(13)
0:30.435 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 56.9/100: 57% insanity bloodlust, shadowform, chorus_of_insanity(23), whispers_of_the_damned, overwhelming_power(12)
0:35.171 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 86.9/100: 87% insanity bloodlust, shadowform, chorus_of_insanity(19), whispers_of_the_damned, overwhelming_power(6)
0:36.154 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 100.0/100: 100% insanity bloodlust, shadowform, chorus_of_insanity(18), whispers_of_the_damned, overwhelming_power(5)
0:37.766 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 100.0/100: 100% insanity bloodlust, voidform, insanity_drain_stacks, chorus_of_insanity(16), whispers_of_the_damned, overwhelming_power(4)
0:38.733 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 94.2/100: 94% insanity bloodlust, voidform, insanity_drain_stacks, chorus_of_insanity(15), whispers_of_the_damned, overwhelming_power(3)
0:41.146 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 91.4/100: 91% insanity voidform(4), insanity_drain_stacks, chorus_of_insanity(13), whispers_of_the_damned
0:42.397 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 89.0/100: 89% insanity voidform(5), insanity_drain_stacks, chorus_of_insanity(11), whispers_of_the_damned
0:43.644 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 91.8/100: 92% insanity voidform(6), insanity_drain_stacks, chorus_of_insanity(10), whispers_of_the_damned
0:44.884 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 86.6/100: 87% insanity voidform(8), insanity_drain_stacks, chorus_of_insanity(9), whispers_of_the_damned
0:46.112 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 85.5/100: 85% insanity voidform(9), insanity_drain_stacks, chorus_of_insanity(8), whispers_of_the_damned
0:47.334 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 75.9/100: 76% insanity voidform(10), insanity_drain_stacks, chorus_of_insanity(6), whispers_of_the_damned, overwhelming_power(24)
0:48.470 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 75.3/100: 75% insanity voidform(11), insanity_drain_stacks, chorus_of_insanity(5), whispers_of_the_damned, overwhelming_power(23)
0:49.601 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 74.8/100: 75% insanity voidform(12), insanity_drain_stacks, chorus_of_insanity(4), whispers_of_the_damned, overwhelming_power(22)
0:52.417 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 44.1/100: 44% insanity voidform(15), insanity_drain_stacks, chorus_of_insanity, whispers_of_the_damned, overwhelming_power(19)
0:53.541 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 40.2/100: 40% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(18)
0:54.661 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 34.3/100: 34% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(17)
0:55.782 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 18.4/100: 18% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(16)
0:56.896 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 11.6/100: 12% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(15)
0:58.558 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 20.6/100: 21% insanity shadowform, chorus_of_insanity(18), whispers_of_the_damned, overwhelming_power(13)
0:59.788 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 35.6/100: 36% insanity shadowform, chorus_of_insanity(16), whispers_of_the_damned, overwhelming_power(12)
1:01.234 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 78.0/100: 78% insanity voidform(2), insanity_drain_stacks, chorus_of_insanity(14), whispers_of_the_damned, overwhelming_power(10)
1:02.462 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 85.3/100: 85% insanity voidform(3), insanity_drain_stacks, chorus_of_insanity(10), whispers_of_the_damned, overwhelming_power(9)
1:03.686 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 81.4/100: 81% insanity voidform(4), insanity_drain_stacks, chorus_of_insanity(8), whispers_of_the_damned, overwhelming_power(8)
1:04.909 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 95.0/100: 95% insanity voidform(5), insanity_drain_stacks, chorus_of_insanity(6), whispers_of_the_damned, overwhelming_power(7)
1:06.130 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 93.8/100: 94% insanity voidform(7), insanity_drain_stacks, chorus_of_insanity(4), whispers_of_the_damned, overwhelming_power(5)
1:07.345 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 90.4/100: 90% insanity voidform(8), insanity_drain_stacks, chorus_of_insanity, whispers_of_the_damned, overwhelming_power(4)
1:08.558 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 96.8/100: 97% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(2)
1:09.773 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 90.3/100: 90% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power
1:12.454 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 75.4/100: 75% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
1:13.653 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 78.2/100: 78% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned
1:14.845 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 79.0/100: 79% insanity voidform(15), insanity_drain_stacks, whispers_of_the_damned
1:16.032 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 69.7/100: 70% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned
1:17.207 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 69.5/100: 69% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned
1:18.378 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 52.2/100: 52% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned
1:19.542 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 43.0/100: 43% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned
1:20.702 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 33.9/100: 34% insanity voidform(21), insanity_drain_stacks, whispers_of_the_damned
1:23.576 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 9.4/100: 9% insanity shadowform, chorus_of_insanity(20), whispers_of_the_damned
1:24.962 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 29.4/100: 29% insanity shadowform, chorus_of_insanity(17), whispers_of_the_damned
1:26.239 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 44.4/100: 44% insanity shadowform, chorus_of_insanity(14), whispers_of_the_damned
1:29.423 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 59.4/100: 59% insanity shadowform, chorus_of_insanity(4), whispers_of_the_damned
1:30.700 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 63.4/100: 63% insanity shadowform, whispers_of_the_damned
1:31.977 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 69.4/100: 69% insanity shadowform, whispers_of_the_damned
1:33.255 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 84.4/100: 84% insanity shadowform, whispers_of_the_damned
1:34.532 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 90.4/100: 90% insanity shadowform, whispers_of_the_damned
1:36.656 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 90.4/100: 90% insanity voidform, insanity_drain_stacks, whispers_of_the_damned
1:37.925 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 92.2/100: 92% insanity voidform(2), insanity_drain_stacks, whispers_of_the_damned
1:39.189 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 89.1/100: 89% insanity voidform(3), insanity_drain_stacks, whispers_of_the_damned
1:40.448 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 93.9/100: 94% insanity voidform(4), insanity_drain_stacks, whispers_of_the_damned
1:41.699 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 88.6/100: 89% insanity voidform(6), insanity_drain_stacks, whispers_of_the_damned
1:44.238 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 73.5/100: 73% insanity voidform(8), insanity_drain_stacks, whispers_of_the_damned
1:45.464 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 74.6/100: 75% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned
1:46.686 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 78.6/100: 79% insanity voidform(11), insanity_drain_stacks, whispers_of_the_damned
1:47.895 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 76.5/100: 76% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned
1:49.101 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 74.3/100: 74% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
1:50.895 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 54.1/100: 54% insanity voidform(15), insanity_drain_stacks, whispers_of_the_damned
1:52.084 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 48.3/100: 48% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(25)
1:53.183 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 44.1/100: 44% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(24)
1:55.919 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 4.6/100: 5% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(22)
1:57.008 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 5.1/100: 5% insanity shadowform, chorus_of_insanity(21), whispers_of_the_damned, overwhelming_power(20)
1:58.214 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 20.1/100: 20% insanity shadowform, chorus_of_insanity(17), whispers_of_the_damned, overwhelming_power(19)
2:00.020 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 29.1/100: 29% insanity shadowform, chorus_of_insanity(9), whispers_of_the_damned, overwhelming_power(17)
2:01.235 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 71.6/100: 72% insanity voidform(2), insanity_drain_stacks, chorus_of_insanity(5), whispers_of_the_damned, overwhelming_power(16)
2:02.442 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 79.1/100: 79% insanity voidform(3), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(15)
2:03.664 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 75.3/100: 75% insanity voidform(4), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(14)
2:04.868 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 85.5/100: 85% insanity voidform(5), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(13)
2:06.065 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 94.1/100: 94% insanity voidform(7), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(11)
2:07.259 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 92.9/100: 93% insanity voidform(8), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(10)
2:08.449 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 90.8/100: 91% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(9)
2:09.636 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 90.8/100: 91% insanity voidform(10), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(8)
2:10.824 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 95.5/100: 95% insanity voidform(11), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(7)
2:12.010 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 90.1/100: 90% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(5)
2:13.196 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 87.4/100: 87% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(4)
2:14.375 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 79.7/100: 80% insanity voidform(15), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(3)
2:15.551 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 80.1/100: 80% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(2)
2:16.726 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 80.4/100: 80% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power
2:19.326 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 40.4/100: 40% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned
2:20.486 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 31.4/100: 31% insanity voidform(21), insanity_drain_stacks, whispers_of_the_damned
2:21.643 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 20.4/100: 20% insanity voidform(22), insanity_drain_stacks, whispers_of_the_damned
2:22.795 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 15.9/100: 16% insanity shadowform, chorus_of_insanity(23), whispers_of_the_damned
2:25.979 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 30.9/100: 31% insanity shadowform, chorus_of_insanity(7), whispers_of_the_damned
2:27.341 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 50.9/100: 51% insanity shadowform, chorus_of_insanity, whispers_of_the_damned
2:28.619 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 65.9/100: 66% insanity shadowform, whispers_of_the_damned
2:34.348 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 92.9/100: 93% insanity shadowform, whispers_of_the_damned
2:36.473 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 92.8/100: 93% insanity voidform, insanity_drain_stacks, whispers_of_the_damned
2:37.743 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.2/100: 92% insanity voidform(2), insanity_drain_stacks, whispers_of_the_damned
2:39.007 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 98.1/100: 98% insanity voidform(3), insanity_drain_stacks, whispers_of_the_damned
2:40.263 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.0/100: 94% insanity voidform(4), insanity_drain_stacks, whispers_of_the_damned
2:41.514 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 88.6/100: 89% insanity voidform(6), insanity_drain_stacks, whispers_of_the_damned
2:42.754 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 91.0/100: 91% insanity voidform(7), insanity_drain_stacks, whispers_of_the_damned
2:43.986 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 83.3/100: 83% insanity voidform(8), insanity_drain_stacks, whispers_of_the_damned
2:45.215 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 84.4/100: 84% insanity voidform(9), insanity_drain_stacks, whispers_of_the_damned
2:47.920 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 59.4/100: 59% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned
2:49.124 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 57.0/100: 57% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
2:50.322 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 57.7/100: 58% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:51.517 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 52.2/100: 52% insanity voidform(16), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:52.699 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 46.7/100: 47% insanity voidform(17), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:53.875 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 28.3/100: 28% insanity voidform(18), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:55.047 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 19.9/100: 20% insanity voidform(19), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:56.214 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 11.5/100: 11% insanity voidform(20), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
2:58.751 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 18.1/100: 18% insanity shadowform, chorus_of_insanity(9), whispers_of_the_damned, torrent_of_elements
3:00.025 default 9 berserking Fluffy_Pillow 19999.0/19999: 100% mana | 24.1/100: 24% insanity shadowform, chorus_of_insanity(2), whispers_of_the_damned, torrent_of_elements
3:00.025 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 24.1/100: 24% insanity berserking, shadowform, chorus_of_insanity(2), whispers_of_the_damned, torrent_of_elements
3:01.137 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 67.3/100: 67% insanity berserking, voidform(2), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
3:02.238 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 75.7/100: 76% insanity berserking, voidform(3), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
3:03.557 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 71.2/100: 71% insanity berserking, voidform(4), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements
3:04.646 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 82.6/100: 83% insanity berserking, voidform(5), insanity_drain_stacks, whispers_of_the_damned
3:05.730 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 94.0/100: 94% insanity berserking, voidform(6), insanity_drain_stacks, whispers_of_the_damned
3:06.808 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 94.6/100: 95% insanity berserking, voidform(7), insanity_drain_stacks, whispers_of_the_damned
3:07.883 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity berserking, voidform(8), insanity_drain_stacks, whispers_of_the_damned
3:08.952 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 92.9/100: 93% insanity berserking, voidform(9), insanity_drain_stacks, whispers_of_the_damned
3:10.181 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 91.9/100: 92% insanity voidform(11), insanity_drain_stacks, whispers_of_the_damned
3:11.390 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 86.7/100: 87% insanity voidform(12), insanity_drain_stacks, whispers_of_the_damned
3:12.595 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 87.7/100: 88% insanity voidform(13), insanity_drain_stacks, whispers_of_the_damned
3:13.795 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 89.4/100: 89% insanity voidform(14), insanity_drain_stacks, whispers_of_the_damned
3:14.989 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 81.0/100: 81% insanity voidform(15), insanity_drain_stacks, whispers_of_the_damned
3:16.176 default 8 potion Fluffy_Pillow 19999.0/19999: 100% mana | 81.6/100: 82% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned
3:16.176 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 81.6/100: 82% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:17.938 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 62.7/100: 63% insanity twist_of_fate, voidform(18), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:19.108 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 53.8/100: 54% insanity twist_of_fate, voidform(20), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:20.270 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 45.0/100: 45% insanity twist_of_fate, voidform(21), insanity_drain_stacks, whispers_of_the_damned, battle_potion_of_intellect
3:23.148 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 7.7/100: 8% insanity twist_of_fate, shadowform, chorus_of_insanity(22), whispers_of_the_damned, battle_potion_of_intellect
3:24.456 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 22.7/100: 23% insanity twist_of_fate, shadowform, chorus_of_insanity(13), whispers_of_the_damned, battle_potion_of_intellect
3:29.968 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 49.7/100: 50% insanity twist_of_fate, shadowform, whispers_of_the_damned, overwhelming_power(22), battle_potion_of_intellect
3:31.165 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 69.7/100: 70% insanity twist_of_fate, shadowform, whispers_of_the_damned, overwhelming_power(20), battle_potion_of_intellect
3:32.371 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 84.7/100: 85% insanity twist_of_fate, shadowform, whispers_of_the_damned, overwhelming_power(19), battle_potion_of_intellect
3:33.579 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 88.7/100: 89% insanity twist_of_fate, shadowform, whispers_of_the_damned, overwhelming_power(18), battle_potion_of_intellect
3:34.791 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 94.7/100: 95% insanity twist_of_fate, shadowform, whispers_of_the_damned, overwhelming_power(17), battle_potion_of_intellect
3:36.813 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 94.7/100: 95% insanity twist_of_fate, voidform, insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(15), battle_potion_of_intellect
3:38.028 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.5/100: 93% insanity twist_of_fate, voidform(2), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(13), battle_potion_of_intellect
3:39.245 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 98.9/100: 99% insanity twist_of_fate, voidform(3), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(12), battle_potion_of_intellect
3:40.461 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 95.1/100: 95% insanity twist_of_fate, voidform(4), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(10), battle_potion_of_intellect
3:41.677 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 89.1/100: 89% insanity twist_of_fate, voidform(5), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(9)
3:44.698 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 71.8/100: 72% insanity twist_of_fate, voidform(8), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(6)
3:45.904 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 72.8/100: 73% insanity twist_of_fate, voidform(10), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(5)
3:47.102 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 71.8/100: 72% insanity twist_of_fate, voidform(11), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(3)
3:48.304 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 60.5/100: 61% insanity twist_of_fate, voidform(12), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(2)
3:49.500 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 58.3/100: 58% insanity twist_of_fate, voidform(13), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power
3:50.696 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 44.9/100: 45% insanity twist_of_fate, voidform(14), insanity_drain_stacks, whispers_of_the_damned
3:51.889 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 44.4/100: 44% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned
3:53.071 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 38.9/100: 39% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned
3:54.247 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 31.5/100: 31% insanity twist_of_fate, voidform(18), insanity_drain_stacks, whispers_of_the_damned
3:55.419 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 14.0/100: 14% insanity twist_of_fate, voidform(19), insanity_drain_stacks, whispers_of_the_damned
3:56.585 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 5.6/100: 6% insanity twist_of_fate, voidform(20), insanity_drain_stacks, whispers_of_the_damned
3:57.748 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 15.9/100: 16% insanity twist_of_fate, shadowform, chorus_of_insanity(15), whispers_of_the_damned
4:00.929 single E dark_ascension Fluffy_Pillow 19999.0/19999: 100% mana | 30.9/100: 31% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:02.206 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 73.0/100: 73% insanity twist_of_fate, voidform(2), insanity_drain_stacks, whispers_of_the_damned
4:03.468 single G mindbender Fluffy_Pillow 19999.0/19999: 100% mana | 80.0/100: 80% insanity twist_of_fate, voidform(3), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(24)
4:04.641 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 76.5/100: 77% insanity twist_of_fate, voidform(4), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(23)
4:05.812 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 87.0/100: 87% insanity twist_of_fate, voidform(5), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(22)
4:06.981 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 94.4/100: 94% insanity twist_of_fate, voidform(7), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(21)
4:08.141 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 93.7/100: 94% insanity twist_of_fate, voidform(8), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(19)
4:09.304 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 99.9/100: 100% insanity twist_of_fate, voidform(9), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(18)
4:10.464 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 91.2/100: 91% insanity twist_of_fate, voidform(10), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(17)
4:11.853 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 90.0/100: 90% insanity twist_of_fate, voidform(11), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(16)
4:13.009 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 84.9/100: 85% insanity twist_of_fate, voidform(13), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(14)
4:14.160 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 87.9/100: 88% insanity twist_of_fate, voidform(14), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(13)
4:15.307 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 89.7/100: 90% insanity twist_of_fate, voidform(15), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(12)
4:16.453 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 81.6/100: 82% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(11)
4:17.597 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 82.5/100: 82% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(10)
4:19.308 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 63.9/100: 64% insanity twist_of_fate, voidform(19), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(8)
4:20.446 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 55.3/100: 55% insanity twist_of_fate, voidform(20), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(7)
4:21.582 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 46.7/100: 47% insanity twist_of_fate, voidform(21), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(5)
4:22.720 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 25.0/100: 25% insanity twist_of_fate, voidform(22), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(4)
4:23.857 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 4.3/100: 4% insanity twist_of_fate, voidform(23), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(3)
4:24.992 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 3.9/100: 4% insanity twist_of_fate, shadowform, chorus_of_insanity(20), whispers_of_the_damned, overwhelming_power(2)
4:26.260 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 18.9/100: 19% insanity twist_of_fate, shadowform, chorus_of_insanity(11), whispers_of_the_damned
4:30.716 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 39.9/100: 40% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:31.992 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 59.9/100: 60% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:33.268 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 65.9/100: 66% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:34.545 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 80.9/100: 81% insanity twist_of_fate, shadowform, whispers_of_the_damned
4:36.458 single K vampiric_touch Fluffy_Pillow 19999.0/19999: 100% mana | 89.9/100: 90% insanity twist_of_fate, shadowform, whispers_of_the_damned, overwhelming_power(24)
4:37.651 single D void_eruption Fluffy_Pillow 19999.0/19999: 100% mana | 95.9/100: 96% insanity twist_of_fate, shadowform, whispers_of_the_damned, overwhelming_power(23)
4:39.638 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 95.9/100: 96% insanity twist_of_fate, voidform, insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(21)
4:40.836 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 92.7/100: 93% insanity twist_of_fate, voidform(2), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(20)
4:42.029 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 99.2/100: 99% insanity twist_of_fate, voidform(3), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(18)
4:43.219 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 95.7/100: 96% insanity twist_of_fate, voidform(4), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(17)
4:44.410 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 89.4/100: 89% insanity twist_of_fate, voidform(5), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(16)
4:46.189 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 80.3/100: 80% insanity twist_of_fate, voidform(7), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(14)
4:47.375 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 81.9/100: 82% insanity twist_of_fate, voidform(8), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(13)
4:48.556 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 83.5/100: 83% insanity twist_of_fate, voidform(9), insanity_drain_stacks, whispers_of_the_damned, overwhelming_power(12)
4:51.164 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 59.5/100: 59% insanity twist_of_fate, voidform(12), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(9)
4:52.337 single H shadow_crash Fluffy_Pillow 19999.0/19999: 100% mana | 57.5/100: 58% insanity twist_of_fate, voidform(13), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(8)
4:53.508 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 58.6/100: 59% insanity twist_of_fate, voidform(14), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(7)
4:54.676 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 53.6/100: 54% insanity twist_of_fate, voidform(16), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(6)
4:55.837 single J shadow_word_pain Fluffy_Pillow 19999.0/19999: 100% mana | 48.5/100: 48% insanity twist_of_fate, voidform(17), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(5)
4:56.997 single L mind_flay Fluffy_Pillow 19999.0/19999: 100% mana | 30.4/100: 30% insanity twist_of_fate, voidform(18), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(4)
4:58.154 single F void_bolt Fluffy_Pillow 19999.0/19999: 100% mana | 13.3/100: 13% insanity twist_of_fate, voidform(19), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power(2)
4:59.313 single I mind_blast Fluffy_Pillow 19999.0/19999: 100% mana | 5.1/100: 5% insanity twist_of_fate, voidform(20), insanity_drain_stacks, whispers_of_the_damned, torrent_of_elements, overwhelming_power

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 8838 8035 7034
Intellect 1467 -3 8067 6916 5123 (377)
Spirit 0 0 0 0 0
Health 176760 160700 0
Mana 19999 19999 0
Insanity 100 100 0
Spell Power 8067 6916 0
Crit 20.12% 20.12% 1089
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 640 640 0
Mastery 21.97% 21.97% 742
Armor 1142 1142 1142
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 385, stats: { 148 Armor, +625 Int, +1127 Sta }
azerite powers: { Death Throes, Heed My Call, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 385, stats: { 137 Armor, +469 Int, +845 Sta }
azerite powers: { Whispers of the Damned, Earthlink, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 385, stats: { 183 Armor, +625 Int, +1127 Sta }
azerite powers: { Chorus of Insanity, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Twitching Tentacle of Xalzaix
ilevel: 385, stats: { +176 Crit }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: torrent_of_elements
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Fortress of the Mind (Shadow Priest) Shadowy Insight (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Body and Soul San'layn (Shadow Priest) Mania (Shadow Priest)
45 Twist of Fate (Shadow Priest) Misery (Shadow Priest) Dark Void (Shadow Priest)
60 Last Word (Shadow Priest) Mind Bomb (Shadow Priest) Psychic Horror (Shadow Priest)
75 Auspicious Spirits (Shadow Priest) Shadow Word: Death (Shadow Priest) Shadow Crash (Shadow Priest)
90 Lingering Insanity (Shadow Priest) Mindbender (Shadow Priest) Void Torrent (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Dark Ascension (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="T22_Priest_Shadow"
spec=shadow
level=120
race=troll
role=spell
position=ranged_back
talents=3111322

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast
actions.precombat+=/shadow_word_void

# Executed every time the actor is available.
actions=potion,if=buff.bloodlust.react|target.time_to_die<=80|target.health.pct<35
actions+=/variable,name=dots_up,op=set,value=dot.shadow_word_pain.ticking&dot.vampiric_touch.ticking
actions+=/berserking
actions+=/run_action_list,name=aoe,if=spell_targets.mind_sear>(5+1*talent.misery.enabled)
actions+=/run_action_list,name=cleave,if=active_enemies>1
actions+=/run_action_list,name=single,if=active_enemies=1

actions.aoe=void_eruption
actions.aoe+=/dark_ascension,if=buff.voidform.down
actions.aoe+=/void_bolt,if=talent.dark_void.enabled&dot.shadow_word_pain.remains>travel_time
actions.aoe+=/surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)
actions.aoe+=/dark_void,if=raid_event.adds.in>10
actions.aoe+=/mindbender
actions.aoe+=/shadow_crash,if=raid_event.adds.in>5&raid_event.adds.duration<20
actions.aoe+=/mind_sear,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
actions.aoe+=/shadow_word_pain

actions.cleave=void_eruption
actions.cleave+=/dark_ascension,if=buff.voidform.down
actions.cleave+=/void_bolt
actions.cleave+=/shadow_word_death,target_if=target.time_to_die<3|buff.voidform.down
actions.cleave+=/surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)
actions.cleave+=/dark_void,if=raid_event.adds.in>10
actions.cleave+=/mindbender
actions.cleave+=/mind_blast
actions.cleave+=/shadow_crash,if=(raid_event.adds.in>5&raid_event.adds.duration<2)|raid_event.adds.duration>2
actions.cleave+=/shadow_word_pain,target_if=refreshable&target.time_to_die>4,if=!talent.misery.enabled&!talent.dark_void.enabled
actions.cleave+=/vampiric_touch,target_if=refreshable,if=(target.time_to_die>6)
actions.cleave+=/vampiric_touch,target_if=dot.shadow_word_pain.refreshable,if=(talent.misery.enabled&target.time_to_die>4)
actions.cleave+=/void_torrent
actions.cleave+=/mind_sear,target_if=spell_targets.mind_sear>2,chain=1,interrupt=1
actions.cleave+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
actions.cleave+=/shadow_word_pain

actions.single=void_eruption
actions.single+=/dark_ascension,if=buff.voidform.down
actions.single+=/void_bolt
actions.single+=/shadow_word_death,if=target.time_to_die<3|cooldown.shadow_word_death.charges=2|(cooldown.shadow_word_death.charges=1&cooldown.shadow_word_death.remains<gcd.max)
actions.single+=/surrender_to_madness,if=buff.voidform.stack>=(15+buff.bloodlust.up)&target.time_to_die>200|target.time_to_die<75
actions.single+=/dark_void,if=raid_event.adds.in>10
actions.single+=/mindbender
actions.single+=/shadow_word_death,if=!buff.voidform.up|(cooldown.shadow_word_death.charges=2&buff.voidform.stack<15)
actions.single+=/shadow_crash,if=raid_event.adds.in>5&raid_event.adds.duration<20
actions.single+=/mind_blast,if=variable.dots_up
actions.single+=/void_torrent,if=dot.shadow_word_pain.remains>4&dot.vampiric_touch.remains>4
actions.single+=/shadow_word_pain,if=refreshable&target.time_to_die>4&!talent.misery.enabled&!talent.dark_void.enabled
actions.single+=/vampiric_touch,if=refreshable&target.time_to_die>6|(talent.misery.enabled&dot.shadow_word_pain.refreshable)
actions.single+=/mind_flay,chain=1,interrupt_immediate=1,interrupt_if=ticks>=2&(cooldown.void_bolt.up|cooldown.mind_blast.up)
actions.single+=/shadow_word_pain

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507,azerite_powers=404/22/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507,azerite_powers=236/461/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507,azerite_powers=405/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=twitching_tentacle_of_xalzaix,id=160656,bonus_id=4800/1507
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=torrent_of_elements
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7034
# gear_intellect=5123
# gear_crit_rating=1089
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1142

T22_Rogue_Assassination : 16341 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16341.0 16341.0 9.0 / 0.055% 1528.5 / 9.4% 660.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
24.7 24.3 Energy 38.13% 36.9 100.0% 100%
Talents
  • 15: Elaborate Planning
  • 30: Subterfuge
  • 45: Vigor
  • 90: Toxic Blade (Assassination Rogue)
  • 100: Poison Bomb (Assassination Rogue)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Rogue_Assassination 16341
auto_attack_mh 1897 11.6% 222.3 1.35sec 2557 1916 Direct 222.3 2373 4735 2557 26.9% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 222.34 222.34 0.00 0.00 1.3345 0.0000 568455.36 812675.20 30.05 1915.88 1915.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.42 54.16% 2372.67 1928 3393 2373.74 2281 2479 285723 408476 30.05
crit 59.71 26.85% 4735.21 3855 6785 4737.36 4400 5215 282732 404200 30.05
miss 42.21 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
auto_attack_oh 938 5.7% 220.3 1.36sec 1276 948 Direct 220.3 1184 2366 1276 26.9% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 220.32 220.32 0.00 0.00 1.3466 0.0000 281180.81 401981.73 30.05 947.72 947.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.25 54.12% 1184.34 964 1696 1184.89 1136 1244 141232 201909 30.05
crit 59.16 26.85% 2365.64 1928 3393 2366.61 2223 2548 139949 200073 30.05
miss 41.92 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Deadly Poison (_dot) 1091 6.7% 504.8 0.77sec 648 0 Periodic 197.9 1303 2601 1652 26.9% 0.0% 99.5%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 504.75 0.00 197.90 197.90 0.0000 1.5090 327001.09 327001.09 0.00 1095.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.6 73.09% 1303.05 948 2271 1303.76 1247 1372 188474 188474 0.00
crit 53.3 26.91% 2601.06 1897 4543 2602.29 2346 2878 138527 138527 0.00
 
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance to poison the enemy for ${$2818m1*{$2818d=12 seconds}/$2818t1} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.063000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Deadly Poison (_instant) 2034 12.4% 503.8 0.77sec 1210 0 Direct 503.8 954 1904 1210 26.9% 0.0%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 503.75 503.75 0.00 0.00 0.0000 0.0000 609358.93 609358.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 368.20 73.09% 953.86 677 1622 954.36 917 997 351208 351208 0.00
crit 135.56 26.91% 1904.38 1355 3245 1905.36 1770 2061 258151 258151 0.00
 
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
Envenom 2655 16.2% 39.6 7.50sec 20085 19995 Direct 39.6 15819 31576 20085 27.1% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.59 39.59 0.00 0.00 1.0045 0.0000 795074.42 795074.42 0.00 19995.33 19995.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.87 72.93% 15819.43 9681 28842 15828.39 13975 17945 456687 456687 0.00
crit 10.72 27.07% 31575.96 19361 57685 31603.44 22596 41257 338387 338387 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=4+talent.deeper_stratagem.enabled&(debuff.vendetta.up|debuff.toxic_blade.up|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2)&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Frenetic Blow (frentic_blow) 310 1.9% 3.6 73.03sec 25909 0 Direct 3.6 20390 40778 25908 27.1% 0.0%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.59 3.59 0.00 0.00 0.0000 0.0000 92941.96 132871.69 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.62 72.93% 20389.74 20334 20952 19884.66 0 20952 53344 76262 29.31
crit 0.97 27.07% 40777.95 40668 41903 26847.65 0 41903 39598 56610 19.78
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Garrote 2387 14.6% 16.9 18.11sec 42244 42055 Periodic 198.3 2849 5668 3607 26.9% 0.0% 99.2%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.93 0.00 198.29 198.29 1.0045 1.5008 715153.66 715153.66 0.00 2273.19 42055.49
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 145.0 73.14% 2849.39 2 6656 2852.06 2538 3128 413237 413237 0.00
crit 53.3 26.86% 5668.28 4 13312 5672.49 4490 6946 301916 301916 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.subterfuge.enabled|!(cooldown.vanish.up&cooldown.vendetta.remains<=4))&combo_points.deficit>=1&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&(target.time_to_die-remains>4&spell_targets.fan_of_knives<=1|target.time_to_die-remains>12)
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.120000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mutilate 0 (2174) 0.0% (13.3%) 93.8 3.20sec 6942 6911

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.79 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 6911.06 6911.06
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.use_filler
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of $<dmg> Physical damage. |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Mutilate (_mh) 1449 8.9% 93.8 3.20sec 4628 0 Direct 93.8 3647 7287 4628 26.9% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.79 93.79 0.00 0.00 0.0000 0.0000 434067.51 620551.63 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.52 73.06% 3647.35 2935 5081 3649.26 3486 3821 249909 357275 30.05
crit 25.27 26.94% 7287.30 5870 10162 7290.05 6485 8129 184158 263276 30.05
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Mutilate (_oh) 725 4.4% 93.8 3.20sec 2314 0 Direct 93.8 1824 3643 2314 26.9% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.79 93.79 0.00 0.00 0.0000 0.0000 217030.66 310271.39 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.52 73.06% 1823.71 1467 2541 1824.64 1741 1919 124958 178642 30.05
crit 25.27 26.94% 3643.48 2935 5081 3644.91 3313 4094 92073 131629 30.05
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for {$s2=0} Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Poison Bomb 406 2.5% 39.6 6.52sec 3067 0 Direct 39.6 2419 4829 3067 26.9% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.61 39.61 0.00 0.00 0.0000 0.0000 121467.03 121467.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.96 73.12% 2418.87 1821 3966 2420.28 1952 3387 70051 70051 0.00
crit 10.65 26.88% 4829.07 3643 7932 4831.14 0 7561 51416 51416 0.00
 
 

Action details: poison_bomb

Static Values
  • id:255546
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:255546
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc255544=Envenom and Rupture have a $<chance>% chance per combo point spent to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$255546s1=0}*{$s2=4}} Nature damage over {$255545d=2 seconds} to all enemies within it.}
 
Rupture 1936 11.9% 13.3 22.54sec 43719 43524 Periodic 196.5 2327 4647 2952 26.9% 0.0% 98.8%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.27 0.00 196.54 196.54 1.0045 1.5076 580171.28 580171.28 0.00 1873.80 43523.73
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.6 73.07% 2327.13 1 3475 2328.31 2233 2420 334180 334180 0.00
crit 52.9 26.93% 4646.98 3 6950 4648.90 4333 5010 245991 245991 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2)))
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${$o1*2} over 8 sec 2 points: ${$o1*3} over 12 sec 3 points: ${$o1*4} over 16 sec 4 points: ${$o1*5} over 20 sec 5 points: ${$o1*6} over 24 sec{$?s193531=false}[ 6 points: ${$o1*7} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.125300
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Toxic Blade 513 3.1% 12.2 25.17sec 12589 12533 Direct 12.2 9929 19797 12589 27.0% 0.0%  

Stats details: toxic_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.21 12.21 0.00 0.00 1.0045 0.0000 153687.45 153687.45 0.00 12532.61 12532.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.92 73.04% 9928.55 8017 14698 9935.20 8495 12141 88534 88534 0.00
crit 3.29 26.96% 19797.24 16033 29397 19301.83 0 28531 65153 65153 0.00
 
 

Action details: toxic_blade

Static Values
  • id:245388
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:25.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rupture.ticking
Spelldata
  • id:245388
  • name:Toxic Blade
  • school:nature
  • tooltip:
  • description:Stab your enemy with a toxic poisoned blade, dealing {$s2=0} Nature damage. Your Nature damage done against the target is increased by {$245389s1=30}% for {$245389d=9 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Rogue_Assassination
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Assassination
  • harmful:false
  • if_expr:
 
Berserking 2.0 240.20sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.vendetta.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Assassination
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Assassination
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.8 127.69sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.exsanguinate.enabled&(talent.nightstalker.enabled|talent.subterfuge.enabled&spell_targets.fan_of_knives<2)&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 3.0 120.10sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.rupture.ticking
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility. Generates ${{$256495s1=100}*{$256495d=3 seconds}/5} Energy over {$256495d=3 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:36.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=6}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Agility 2.0 0.0 129.2sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 240.2sec 240.2sec 6.43% 6.67% 0.0(0.0) 1.9

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Deadly Navigation 6.2 23.0 52.3sec 10.4sec 68.85% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_deadly_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:50.00

Stack Uptimes

  • deadly_navigation_1:18.01%
  • deadly_navigation_2:17.46%
  • deadly_navigation_3:16.90%
  • deadly_navigation_4:16.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268905
  • name:Deadly Navigation
  • tooltip:Increases Critical Strike by $w1.
  • description:{$@spelldesc268907=Permanently enchant a weapon to sometimes increase Critical Strike by $268905s for {$268905d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268904s Critical Strike for {$268904d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Deadly Navigation (_final) 5.5 0.0 52.4sec 52.4sec 18.02% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_deadly_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:600.00

Stack Uptimes

  • deadly_navigation_final_1:18.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268904
  • name:Deadly Navigation
  • tooltip:Increases Critical Strike by $w1.
  • description:{$@spelldesc268907=Permanently enchant a weapon to sometimes increase Critical Strike by $268905s for {$268905d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268904s Critical Strike for {$268904d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elaborate Planning 39.0 13.8 7.7sec 5.7sec 65.97% 53.79% 13.8(13.8) 38.4

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • elaborate_planning_1:65.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Damage done increased by {$s1=10}%.
  • description:Increases damage done by {$s1=10}% for {$d=4 seconds}.
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Elemental Whirl (_crit) 2.7 0.2 74.3sec 65.3sec 9.13% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:9.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.3sec 65.5sec 8.98% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:8.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.7 0.2 74.5sec 65.8sec 9.09% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:9.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.7 0.2 74.6sec 65.5sec 9.08% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:9.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Envenom 20.4 19.2 14.7sec 7.5sec 67.56% 68.96% 19.2(19.2) 19.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • envenom_1:67.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 5.0 12.1 63.9sec 17.4sec 75.48% 0.00% 0.0(0.0) 0.6

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:27.52%
  • frothing_rage_2:25.22%
  • frothing_rage_3:22.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Overwhelming Power 4.9 0.0 59.7sec 37.4sec 37.88% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.48%
  • overwhelming_power_2:1.49%
  • overwhelming_power_3:1.49%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.50%
  • overwhelming_power_6:1.51%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.52%
  • overwhelming_power_10:1.53%
  • overwhelming_power_11:1.53%
  • overwhelming_power_12:1.54%
  • overwhelming_power_13:1.54%
  • overwhelming_power_14:1.55%
  • overwhelming_power_15:1.55%
  • overwhelming_power_16:1.56%
  • overwhelming_power_17:1.56%
  • overwhelming_power_18:1.57%
  • overwhelming_power_19:1.57%
  • overwhelming_power_20:1.58%
  • overwhelming_power_21:1.58%
  • overwhelming_power_22:1.59%
  • overwhelming_power_23:1.59%
  • overwhelming_power_24:1.62%
  • overwhelming_power_25:0.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.1sec 10.4sec 68.88% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.04%
  • quick_navigation_2:17.41%
  • quick_navigation_3:17.00%
  • quick_navigation_4:16.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.07% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=20}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 3.8 0.0 86.5sec 128.1sec 3.75% 3.93% 0.0(0.0) 3.7

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • subterfuge_1:3.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=100}% increased damage and have no cooldown when used from Stealth and for {$115192d=3 seconds} after breaking Stealth.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Titanic Overcharge 12.3 33.3 25.0sec 6.6sec 85.08% 0.00% 3.7(3.7) 11.5

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:40.51

Stack Uptimes

  • titanic_overcharge_1:22.94%
  • titanic_overcharge_2:16.86%
  • titanic_overcharge_3:12.31%
  • titanic_overcharge_4:8.90%
  • titanic_overcharge_5:6.46%
  • titanic_overcharge_6:4.76%
  • titanic_overcharge_7:3.43%
  • titanic_overcharge_8:9.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=36} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 24.9 28.1 12.3sec 5.7sec 66.47% 0.00% 2.2(2.2) 24.2

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:31.17%
  • unstable_flames_2:16.60%
  • unstable_flames_3:8.80%
  • unstable_flames_4:4.64%
  • unstable_flames_5:5.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 2.8 0.0 127.8sec 127.8sec 0.34% 0.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vanish_1:0.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Vendetta (_energy) 3.0 0.0 120.1sec 120.1sec 2.99% 1.54% 0.0(0.0) 2.9

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_vendetta_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:20.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vendetta_energy_1:2.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:256495
  • name:Vendetta
  • tooltip:Generating ${{$s1=100}*{$d=3 seconds}/5} Energy over {$d=3 seconds}.
  • description:{$@spelldesc79140=Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility. Generates ${{$256495s1=100}*{$256495d=3 seconds}/5} Energy over {$256495d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Seal Fate 53.8 6.3sec

Resources

Resource Usage Type Count Total Average RPE APR
T22_Rogue_Assassination
envenom Energy 39.6 1385.5 35.0 35.0 573.9
envenom Combo Points 39.6 185.2 4.7 4.7 4292.2
garrote Energy 16.9 761.8 45.0 45.0 938.8
mutilate Energy 93.8 4689.5 50.0 50.0 138.8
rupture Energy 13.3 331.8 25.0 25.0 1748.8
rupture Combo Points 13.3 63.0 4.7 4.7 9210.5
toxic_blade Energy 12.2 244.2 20.0 20.0 629.4
Resource Gains Type Count Total Average Overflow
toxic_blade Combo Points 12.21 7.56 (3.01%) 0.62 4.65 38.09%
mutilate Combo Points 93.79 187.58 (74.66%) 2.00 0.00 0.00%
garrote Combo Points 16.93 16.93 (6.74%) 1.00 0.00 0.00%
energy_regen Energy 1898.52 4366.28 (59.83%) 2.30 4.63 0.11%
Seal Fate Combo Points 53.83 39.18 (15.59%) 0.73 14.65 27.22%
Vendetta Energy 28.81 167.91 (2.30%) 5.83 9.33 5.26%
Venomous Vim Energy 394.80 2763.44 (37.87%) 7.00 0.14 0.01%
Resource RPS-Gain RPS-Loss
Energy 24.33 24.71
Combo Points 0.84 0.83
Combat End Resource Mean Min Max
Energy 54.78 0.00 162.65
Combo Points 3.01 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data T22_Rogue_Assassination Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Rogue_Assassination Damage Per Second
Count 7499
Mean 16341.03
Minimum 14947.41
Maximum 17877.35
Spread ( max - min ) 2929.93
Range [ ( max - min ) / 2 * 100% ] 8.96%
Standard Deviation 395.9546
5th Percentile 15704.78
95th Percentile 17017.48
( 95th Percentile - 5th Percentile ) 1312.69
Mean Distribution
Standard Deviation 4.5724
95.00% Confidence Intervall ( 16332.07 - 16349.99 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2256
0.1 Scale Factor Error with Delta=300 1339
0.05 Scale Factor Error with Delta=300 5354
0.01 Scale Factor Error with Delta=300 133837
Priority Target DPS
Sample Data T22_Rogue_Assassination Priority Target Damage Per Second
Count 7499
Mean 16341.03
Minimum 14947.41
Maximum 17877.35
Spread ( max - min ) 2929.93
Range [ ( max - min ) / 2 * 100% ] 8.96%
Standard Deviation 395.9546
5th Percentile 15704.78
95th Percentile 17017.48
( 95th Percentile - 5th Percentile ) 1312.69
Mean Distribution
Standard Deviation 4.5724
95.00% Confidence Intervall ( 16332.07 - 16349.99 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2256
0.1 Scale Factor Error with Delta=300 1339
0.05 Scale Factor Error with Delta=300 5354
0.01 Scale Factor Error with Delta=300 133837
DPS(e)
Sample Data T22_Rogue_Assassination Damage Per Second (Effective)
Count 7499
Mean 16341.03
Minimum 14947.41
Maximum 17877.35
Spread ( max - min ) 2929.93
Range [ ( max - min ) / 2 * 100% ] 8.96%
Damage
Sample Data T22_Rogue_Assassination Damage
Count 7499
Mean 4895590.15
Minimum 3754180.21
Maximum 6018074.18
Spread ( max - min ) 2263893.97
Range [ ( max - min ) / 2 * 100% ] 23.12%
DTPS
Sample Data T22_Rogue_Assassination Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Rogue_Assassination Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Rogue_Assassination Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Rogue_Assassination Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Rogue_Assassination Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Rogue_Assassination Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Rogue_AssassinationTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Rogue_Assassination Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion
7 0.00 marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=energy_regen_combined,value=energy.regen+poisoned_bleeds*7%(2*spell_haste)
8 0.00 call_action_list,name=stealthed,if=stealthed.rogue
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=dot
B 0.00 call_action_list,name=direct
0.00 arcane_torrent,if=energy.deficit>=15+variable.energy_regen_combined
0.00 arcane_pulse
0.00 lights_judgment
actions.cds
# count action,conditions
C 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=60|debuff.vendetta.up&cooldown.vanish.remains<5
0.00 blood_fury,if=debuff.vendetta.up
D 1.96 berserking,if=debuff.vendetta.up
0.00 fireblood,if=debuff.vendetta.up
0.00 ancestral_call,if=debuff.vendetta.up
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit*1.5|(raid_event.adds.in>40&combo_points.deficit>=cp_max_spend)
E 2.97 vendetta,if=dot.rupture.ticking
0.00 vanish,if=talent.exsanguinate.enabled&(talent.nightstalker.enabled|talent.subterfuge.enabled&spell_targets.fan_of_knives<2)&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1
Vanish with Exsg + (Nightstalker, or Subterfuge only on 1T): Maximum CP and Exsg ready for next GCD
0.00 vanish,if=talent.nightstalker.enabled&!talent.exsanguinate.enabled&combo_points>=cp_max_spend&debuff.vendetta.up
Vanish with Nightstalker + No Exsg: Maximum CP and Vendetta up
F 2.76 vanish,if=talent.subterfuge.enabled&(!talent.exsanguinate.enabled|spell_targets.fan_of_knives>=2)&!stealthed.rogue&cooldown.garrote.up&dot.garrote.refreshable&(spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives|spell_targets.fan_of_knives>=4&combo_points.deficit>=4)
Vanish with Subterfuge + (No Exsg or 2T+): No stealth/subterfuge, Garrote Refreshable, enough space for incoming Garrote CP
0.00 vanish,if=talent.master_assassin.enabled&!stealthed.all&master_assassin_remains<=0&!dot.rupture.refreshable
Vanish with Master Assasin: No stealth and no active MA buff, Rupture not in refresh range
0.00 exsanguinate,if=dot.rupture.remains>4+4*cp_max_spend&!dot.garrote.refreshable
Exsanguinate when both Rupture and Garrote are up for long enough
G 12.21 toxic_blade,if=dot.rupture.ticking
actions.direct
# count action,conditions
H 39.36 envenom,if=combo_points>=4+talent.deeper_stratagem.enabled&(debuff.vendetta.up|debuff.toxic_blade.up|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2)&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)
Envenom at 4+ (5+ with DS) CP. Immediately on 2+ targets, with Vendetta, or with TB; otherwise wait for some energy. Also wait if Exsg combo is coming up.
0.00 variable,name=use_filler,value=combo_points.deficit>1|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2
0.00 poisoned_knife,if=variable.use_filler&buff.sharpened_blades.stack>=29&(azerite.sharpened_blades.rank>=2|spell_targets.fan_of_knives<=4)
Poisoned Knife at 29+ stacks of Sharpened Blades. Up to 4 targets with Rank 1, more otherwise.
0.00 fan_of_knives,if=variable.use_filler&(buff.hidden_blades.stack>=19|spell_targets.fan_of_knives>=2+stealthed.rogue|buff.the_dreadlords_deceit.stack>=29)
0.00 blindside,if=variable.use_filler&(buff.blindside.up|!talent.venom_rush.enabled)
I 93.79 mutilate,if=variable.use_filler
actions.dot
# count action,conditions
0.00 rupture,if=talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2)))
Special Rupture setup for Exsg
0.00 pool_resource,for_next=1
Garrote upkeep, also tries to use it as a special generator for the last CP before a finisher
J 13.23 garrote,cycle_targets=1,if=(!talent.subterfuge.enabled|!(cooldown.vanish.up&cooldown.vendetta.remains<=4))&combo_points.deficit>=1&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&(target.time_to_die-remains>4&spell_targets.fan_of_knives<=1|target.time_to_die-remains>12)
0.00 crimson_tempest,if=spell_targets>=2&remains<2+(spell_targets>=5)&combo_points>=4
Crimson Tempest only on multiple targets at 4+ CP when running out in 2s (up to 4 targets) or 3s (5+ targets)
K 12.83 rupture,cycle_targets=1,if=combo_points>=4&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>4
Keep up Rupture at 4+ on all targets (when living long enough and not snapshot)
actions.stealthed
# count action,conditions
L 0.44 rupture,if=combo_points>=4&(talent.nightstalker.enabled|talent.subterfuge.enabled&talent.exsanguinate.enabled&spell_targets.fan_of_knives<2|!ticking)&target.time_to_die-remains>6
Nighstalker, or Subt+Exsg on 1T: Snapshot Rupture; Also use Rupture over Envenom if it's not applied (Opener)
M 0.22 envenom,if=combo_points>=cp_max_spend
N 3.70 garrote,cycle_targets=1,if=talent.subterfuge.enabled&refreshable&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>2
Subterfuge: Apply or Refresh with buffed Garrotes
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&remains<=10&pmultiplier<=1&!exsanguinated&target.time_to_die-remains>2
Subterfuge: Override normal Garrotes with snapshot versions
0.00 pool_resource,for_next=1
Subterfuge + Exsg: Even override a snapshot Garrote right after Rupture before Exsanguination
0.00 garrote,if=talent.subterfuge.enabled&talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&prev_gcd.1.rupture&dot.rupture.remains>5+4*cp_max_spend

Sample Sequence

012456NILEDGIIHIIHIIHFNIKIIHIIHIGHIIHIJKIIHIIHJGIKIIHIIHJIHIIGKIIHJIHIHIIKJGIHIIHIIHEJIIKICGHIIHIIHFNIIKIIGHIIJHIIHIJKIIGHIIHIIKJIHIIGHIIHJIIKIIHJGIHIHIIKEDIIHJIHIIHGIHIIHFNIIKIIGHIIHJIIHII

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Rogue_Assassination 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation T22_Rogue_Assassination 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food T22_Rogue_Assassination 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 apply_poison Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points
Pre precombat 5 stealth Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 6 potion Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, battle_potion_of_agility
0:00.000 stealthed N garrote Fluffy_Pillow 170.0/170: 100% energy | 0.0/5: 0% combo_points stealth, archive_of_the_titans, resounding_protection, battle_potion_of_agility
0:01.006 direct I mutilate Fluffy_Pillow 138.4/170: 81% energy | 1.0/5: 20% combo_points bloodlust, subterfuge, frothing_rage, deadly_navigation, quick_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.011 stealthed L rupture Fluffy_Pillow 112.7/170: 66% energy | 4.0/5: 80% combo_points bloodlust, subterfuge, frothing_rage, deadly_navigation, quick_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:03.017 cds E vendetta Fluffy_Pillow 112.1/170: 66% energy | 0.0/5: 0% combo_points bloodlust, elaborate_planning, frothing_rage, deadly_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:04.022 cds D berserking Fluffy_Pillow 156.8/170: 92% energy | 0.0/5: 0% combo_points bloodlust, vendetta_energy, elaborate_planning, frothing_rage, deadly_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:04.022 cds G toxic_blade Fluffy_Pillow 156.8/170: 92% energy | 0.0/5: 0% combo_points bloodlust, berserking, vendetta_energy, elaborate_planning, frothing_rage, deadly_navigation, quick_navigation(2), unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:05.025 direct I mutilate Fluffy_Pillow 170.0/170: 100% energy | 1.0/5: 20% combo_points bloodlust, berserking, vendetta_energy, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation(2), archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:06.031 direct I mutilate Fluffy_Pillow 170.0/170: 100% energy | 3.0/5: 60% combo_points bloodlust, berserking, frothing_rage, deadly_navigation(3), quick_navigation(2), archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:07.036 direct H envenom Fluffy_Pillow 154.2/170: 91% energy | 5.0/5: 100% combo_points bloodlust, berserking, frothing_rage(2), deadly_navigation(3), quick_navigation(2), unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:08.040 direct I mutilate Fluffy_Pillow 153.5/170: 90% energy | 0.0/5: 0% combo_points bloodlust, berserking, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(3), quick_navigation(4), unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:09.045 direct I mutilate Fluffy_Pillow 137.9/170: 81% energy | 2.0/5: 40% combo_points bloodlust, berserking, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(3), quick_navigation(4), unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:10.050 direct H envenom Fluffy_Pillow 122.4/170: 72% energy | 5.0/5: 100% combo_points bloodlust, berserking, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(3), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:11.054 direct I mutilate Fluffy_Pillow 115.9/170: 68% energy | 0.0/5: 0% combo_points bloodlust, berserking, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(3), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:12.059 direct I mutilate Fluffy_Pillow 101.4/170: 60% energy | 3.0/5: 60% combo_points bloodlust, berserking, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, archive_of_the_titans(3), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:13.063 direct H envenom Fluffy_Pillow 86.8/170: 51% energy | 5.0/5: 100% combo_points bloodlust, berserking, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, archive_of_the_titans(3), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:14.067 cds F vanish Fluffy_Pillow 87.2/170: 51% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, archive_of_the_titans(3), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:14.067 stealthed N garrote Fluffy_Pillow 87.2/170: 51% energy | 0.0/5: 0% combo_points bloodlust, vanish, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, archive_of_the_titans(3), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:15.072 direct I mutilate Fluffy_Pillow 74.9/170: 44% energy | 1.0/5: 20% combo_points bloodlust, envenom, subterfuge, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, archive_of_the_titans(4), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:16.077 dot K rupture Fluffy_Pillow 57.5/170: 34% energy | 4.0/5: 80% combo_points bloodlust, envenom, subterfuge, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, archive_of_the_titans(4), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:17.084 direct I mutilate Fluffy_Pillow 58.2/170: 34% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, archive_of_the_titans(4), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:18.089 Waiting     0.400 sec 40.9/170: 24% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:18.489 direct I mutilate Fluffy_Pillow 55.4/170: 33% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(4), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:19.494 Waiting     0.200 sec 30.9/170: 18% energy | 5.0/5: 100% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:19.694 direct H envenom Fluffy_Pillow 41.6/170: 24% energy | 5.0/5: 100% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(4), resounding_protection, battle_potion_of_agility
0:20.699 Waiting     0.700 sec 31.1/170: 18% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), unstable_flames, archive_of_the_titans(5), resounding_protection, battle_potion_of_agility
0:21.399 direct I mutilate Fluffy_Pillow 57.1/170: 34% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:22.403 Waiting     0.700 sec 31.3/170: 18% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge, battle_potion_of_agility
0:23.103 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge
0:24.109 Waiting     3.300 sec 31.6/170: 19% energy | 5.0/5: 100% combo_points bloodlust, envenom, frothing_rage(2), deadly_navigation_final, unstable_flames, archive_of_the_titans(5), resounding_protection, titanic_overcharge
0:27.409 direct H envenom Fluffy_Pillow 123.2/170: 72% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage(2), deadly_navigation_final, unstable_flames, archive_of_the_titans(6), resounding_protection, titanic_overcharge
0:28.414 direct I mutilate Fluffy_Pillow 112.5/170: 66% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, archive_of_the_titans(6), resounding_protection, titanic_overcharge
0:29.419 cds G toxic_blade Fluffy_Pillow 93.8/170: 55% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation, archive_of_the_titans(6), resounding_protection, titanic_overcharge
0:30.423 direct H envenom Fluffy_Pillow 105.1/170: 62% energy | 4.0/5: 80% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation, archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:31.428 direct I mutilate Fluffy_Pillow 94.5/170: 56% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), quick_navigation, archive_of_the_titans(7), resounding_protection
0:32.432 direct I mutilate Fluffy_Pillow 75.8/170: 45% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(2), quick_navigation(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:33.437 direct H envenom Fluffy_Pillow 50.3/170: 30% energy | 5.0/5: 100% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:34.442 Waiting     0.200 sec 46.8/170: 28% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), unstable_flames, archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:34.642 direct I mutilate Fluffy_Pillow 50.2/170: 30% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), unstable_flames, archive_of_the_titans(7), resounding_protection, titanic_overcharge
0:36.158 dot J garrote Fluffy_Pillow 47.6/170: 28% energy | 3.0/5: 60% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), unstable_flames, archive_of_the_titans(8), resounding_protection, titanic_overcharge
0:37.164 dot K rupture Fluffy_Pillow 27.0/170: 16% energy | 4.0/5: 80% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), unstable_flames(2), archive_of_the_titans(8), resounding_protection, titanic_overcharge
0:38.168 Waiting     0.600 sec 33.5/170: 20% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), unstable_flames(2), archive_of_the_titans(8), resounding_protection, titanic_overcharge
0:38.768 direct I mutilate Fluffy_Pillow 50.9/170: 30% energy | 0.0/5: 0% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), unstable_flames(2), archive_of_the_titans(8), resounding_protection, titanic_overcharge
0:39.774 Waiting     0.800 sec 25.4/170: 15% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), quick_navigation(2), unstable_flames(2), archive_of_the_titans(8), resounding_protection, titanic_overcharge(2)
0:40.574 direct I mutilate Fluffy_Pillow 53.4/170: 31% energy | 2.0/5: 40% combo_points bloodlust, envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation(2), unstable_flames(2), archive_of_the_titans(9), resounding_protection, titanic_overcharge(2)
0:41.579 Waiting     4.600 sec 25.6/170: 15% energy | 4.0/5: 80% combo_points frothing_rage(3), deadly_navigation, quick_navigation(2), archive_of_the_titans(9), resounding_protection, titanic_overcharge(2)
0:46.179 direct H envenom Fluffy_Pillow 129.6/170: 76% energy | 4.0/5: 80% combo_points deadly_navigation, quick_navigation(3), archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:47.183 direct I mutilate Fluffy_Pillow 115.2/170: 68% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation, quick_navigation(3), archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:48.185 direct I mutilate Fluffy_Pillow 85.8/170: 50% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, deadly_navigation, quick_navigation(3), archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:49.189 Waiting     3.000 sec 56.5/170: 33% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, deadly_navigation, quick_navigation(4), archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:52.189 direct H envenom Fluffy_Pillow 125.5/170: 74% energy | 5.0/5: 100% combo_points deadly_navigation(2), quick_navigation(4), unstable_flames, archive_of_the_titans(11), resounding_protection, titanic_overcharge(3)
0:53.193 dot J garrote Fluffy_Pillow 118.1/170: 69% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(2), quick_navigation(4), unstable_flames, archive_of_the_titans(11), resounding_protection
0:54.197 cds G toxic_blade Fluffy_Pillow 86.6/170: 51% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, deadly_navigation(2), quick_navigation(4), unstable_flames, archive_of_the_titans(11), resounding_protection
0:55.424 direct I mutilate Fluffy_Pillow 97.8/170: 58% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation_final, archive_of_the_titans(12), resounding_protection
0:56.426 dot K rupture Fluffy_Pillow 75.9/170: 45% energy | 5.0/5: 100% combo_points envenom, deadly_navigation(3), quick_navigation_final, archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:57.430 direct I mutilate Fluffy_Pillow 72.2/170: 42% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation_final, elemental_whirl_crit, archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:58.434 Waiting     0.500 sec 43.4/170: 26% energy | 2.0/5: 40% combo_points elaborate_planning, deadly_navigation(3), quick_navigation_final, elemental_whirl_crit, archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:58.934 direct I mutilate Fluffy_Pillow 50.5/170: 30% energy | 2.0/5: 40% combo_points elaborate_planning, deadly_navigation(3), quick_navigation_final, elemental_whirl_crit, archive_of_the_titans(12), resounding_protection, titanic_overcharge
0:59.938 Waiting     0.500 sec 28.7/170: 17% energy | 5.0/5: 100% combo_points elaborate_planning, deadly_navigation(3), quick_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(12), resounding_protection, titanic_overcharge
1:00.438 direct H envenom Fluffy_Pillow 35.8/170: 21% energy | 5.0/5: 100% combo_points deadly_navigation(3), quick_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:01.443 Waiting     1.000 sec 29.0/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:02.443 direct I mutilate Fluffy_Pillow 50.2/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:03.448 Waiting     1.053 sec 21.4/170: 13% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation_final, elemental_whirl_crit, unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:04.501 direct I mutilate Fluffy_Pillow 50.2/170: 30% energy | 3.0/5: 60% combo_points envenom, deadly_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:05.505 Waiting     4.848 sec 20.4/170: 12% energy | 5.0/5: 100% combo_points envenom, deadly_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(14), resounding_protection, titanic_overcharge
1:10.353 direct H envenom Fluffy_Pillow 126.6/170: 74% energy | 5.0/5: 100% combo_points deadly_navigation_final, archive_of_the_titans(15), resounding_protection, titanic_overcharge(2)
1:11.358 dot J garrote Fluffy_Pillow 112.0/170: 66% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation_final, archive_of_the_titans(15), resounding_protection, titanic_overcharge(2)
1:12.363 direct I mutilate Fluffy_Pillow 94.3/170: 55% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, deadly_navigation_final, archive_of_the_titans(15), resounding_protection, titanic_overcharge(2)
1:13.370 Waiting     3.100 sec 57.6/170: 34% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, deadly_navigation_final, archive_of_the_titans(15), resounding_protection, titanic_overcharge(2)
1:16.470 direct H envenom Fluffy_Pillow 126.7/170: 75% energy | 5.0/5: 100% combo_points deadly_navigation_final, unstable_flames, archive_of_the_titans(16), resounding_protection
1:17.473 direct I mutilate Fluffy_Pillow 118.9/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation_final, unstable_flames, archive_of_the_titans(16), resounding_protection
1:18.478 direct I mutilate Fluffy_Pillow 89.1/170: 52% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, deadly_navigation_final, unstable_flames(2), archive_of_the_titans(16), resounding_protection
1:19.485 cds G toxic_blade Fluffy_Pillow 59.4/170: 35% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, quick_navigation, unstable_flames(2), archive_of_the_titans(16), resounding_protection
1:20.489 dot K rupture Fluffy_Pillow 59.6/170: 35% energy | 5.0/5: 100% combo_points envenom, quick_navigation, unstable_flames(2), archive_of_the_titans(17), resounding_protection
1:21.492 direct I mutilate Fluffy_Pillow 54.9/170: 32% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation, unstable_flames(2), archive_of_the_titans(17), resounding_protection
1:22.497 Waiting     1.000 sec 32.2/170: 19% energy | 3.0/5: 60% combo_points elaborate_planning, quick_navigation, unstable_flames(3), archive_of_the_titans(17), resounding_protection
1:23.497 direct I mutilate Fluffy_Pillow 52.4/170: 31% energy | 3.0/5: 60% combo_points elaborate_planning, quick_navigation, unstable_flames(3), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:24.503 Waiting     0.667 sec 22.8/170: 13% energy | 5.0/5: 100% combo_points quick_navigation, unstable_flames(3), archive_of_the_titans(17), resounding_protection, titanic_overcharge
1:25.170 direct H envenom Fluffy_Pillow 38.6/170: 23% energy | 5.0/5: 100% combo_points quick_navigation, unstable_flames(3), archive_of_the_titans(18), resounding_protection, titanic_overcharge
1:27.197 dot J garrote Fluffy_Pillow 46.1/170: 27% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, unstable_flames, archive_of_the_titans(18), resounding_protection, overwhelming_power(23), titanic_overcharge
1:28.201 Waiting     0.983 sec 22.4/170: 13% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, unstable_flames, archive_of_the_titans(18), resounding_protection, overwhelming_power(22), titanic_overcharge
1:29.184 direct I mutilate Fluffy_Pillow 50.3/170: 30% energy | 1.0/5: 20% combo_points envenom, frothing_rage, deadly_navigation(2), quick_navigation, unstable_flames, archive_of_the_titans(18), resounding_protection, overwhelming_power(21), titanic_overcharge
1:30.188 Waiting     4.448 sec 21.5/170: 13% energy | 4.0/5: 80% combo_points envenom, frothing_rage, deadly_navigation(2), quick_navigation, unstable_flames(2), archive_of_the_titans(19), resounding_protection, overwhelming_power(20), titanic_overcharge
1:34.636 direct H envenom Fluffy_Pillow 126.0/170: 74% energy | 4.0/5: 80% combo_points frothing_rage, deadly_navigation(3), quick_navigation(2), unstable_flames(3), archive_of_the_titans(19), resounding_protection, overwhelming_power(16), titanic_overcharge(2)
1:35.640 direct I mutilate Fluffy_Pillow 112.1/170: 66% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(2)
1:36.644 Waiting     1.500 sec 90.2/170: 53% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(3)
1:38.144 direct H envenom Fluffy_Pillow 125.2/170: 74% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(3)
1:39.149 direct I mutilate Fluffy_Pillow 104.3/170: 61% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(3)
1:40.153 direct I mutilate Fluffy_Pillow 82.3/170: 48% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(3)
1:41.157 Waiting     1.700 sec 53.2/170: 31% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(3)
1:42.857 dot K rupture Fluffy_Pillow 90.7/170: 53% energy | 5.0/5: 100% combo_points envenom, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(3)
1:43.862 dot J garrote Fluffy_Pillow 86.6/170: 51% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(4)
1:44.868 cds G toxic_blade Fluffy_Pillow 69.5/170: 41% energy | 1.0/5: 20% combo_points elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(4)
1:45.875 direct I mutilate Fluffy_Pillow 70.4/170: 41% energy | 2.0/5: 40% combo_points elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(4)
1:46.878 direct H envenom Fluffy_Pillow 41.1/170: 24% energy | 4.0/5: 80% combo_points frothing_rage(2), deadly_navigation(4), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(4)
1:47.882 Waiting     1.000 sec 33.8/170: 20% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(4), quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(4)
1:48.882 direct I mutilate Fluffy_Pillow 54.5/170: 32% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(4)
1:49.888 Waiting     1.000 sec 25.2/170: 15% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(4)
1:50.888 direct I mutilate Fluffy_Pillow 52.7/170: 31% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), deadly_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:51.893 Waiting     0.638 sec 16.4/170: 10% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:52.531 direct H envenom Fluffy_Pillow 39.0/170: 23% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
1:53.535 Waiting     1.459 sec 17.6/170: 10% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection
1:54.994 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:56.000 Waiting     1.100 sec 28.5/170: 17% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation(3), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:57.100 direct I mutilate Fluffy_Pillow 50.3/170: 30% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), deadly_navigation_final, quick_navigation(3), elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:58.104 Waiting     4.611 sec 20.8/170: 12% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation_final, quick_navigation(3), elemental_whirl_crit, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:02.715 direct H envenom Fluffy_Pillow 125.6/170: 74% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(3), elemental_whirl_crit, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:03.719 cds E vendetta Fluffy_Pillow 111.6/170: 66% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(3), elemental_whirl_crit, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:04.723 dot J garrote Fluffy_Pillow 152.6/170: 90% energy | 0.0/5: 0% combo_points envenom, vendetta_energy, elaborate_planning, frothing_rage(3), quick_navigation(3), elemental_whirl_crit, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:05.726 direct I mutilate Fluffy_Pillow 155.5/170: 91% energy | 1.0/5: 20% combo_points envenom, vendetta_energy, elaborate_planning, frothing_rage(3), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection
2:06.729 direct I mutilate Fluffy_Pillow 146.2/170: 86% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), quick_navigation(3), elemental_whirl_crit, elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection
2:07.732 dot K rupture Fluffy_Pillow 117.0/170: 69% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), quick_navigation(3), elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection
2:08.736 direct I mutilate Fluffy_Pillow 119.9/170: 71% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(3), quick_navigation(3), elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:09.740 cds C potion Fluffy_Pillow 83.9/170: 49% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(3), quick_navigation(3), elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:09.740 cds G toxic_blade Fluffy_Pillow 83.9/170: 49% energy | 3.0/5: 60% combo_points elaborate_planning, frothing_rage(3), quick_navigation(3), elemental_whirl_mastery, elemental_whirl_haste, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge, battle_potion_of_agility
2:10.873 direct H envenom Fluffy_Pillow 93.6/170: 55% energy | 4.0/5: 80% combo_points elaborate_planning, frothing_rage(3), quick_navigation(3), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:11.879 direct I mutilate Fluffy_Pillow 86.2/170: 51% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:12.883 Waiting     0.100 sec 49.8/170: 29% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:12.983 direct I mutilate Fluffy_Pillow 51.2/170: 30% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:13.988 Waiting     0.500 sec 28.8/170: 17% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:14.488 direct H envenom Fluffy_Pillow 35.6/170: 21% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:15.492 Waiting     1.100 sec 28.3/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:16.592 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:17.595 Waiting     1.033 sec 21.7/170: 13% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:18.628 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 2.0/5: 40% combo_points envenom, frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
2:19.632 Waiting     0.528 sec 21.7/170: 13% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:20.160 direct H envenom Fluffy_Pillow 36.3/170: 21% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation, quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:21.163 cds F vanish Fluffy_Pillow 22.6/170: 13% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:22.439 stealthed N garrote Fluffy_Pillow 47.9/170: 28% energy | 0.0/5: 0% combo_points vanish, envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:23.442 Waiting     0.900 sec 31.2/170: 18% energy | 1.0/5: 20% combo_points envenom, subterfuge, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:24.342 direct I mutilate Fluffy_Pillow 51.1/170: 30% energy | 1.0/5: 20% combo_points envenom, subterfuge, frothing_rage(3), deadly_navigation, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:25.346 Waiting     0.979 sec 22.4/170: 13% energy | 3.0/5: 60% combo_points envenom, subterfuge, frothing_rage(3), deadly_navigation, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:26.325 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), deadly_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:27.332 Waiting     3.513 sec 20.8/170: 12% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
2:30.845 dot K rupture Fluffy_Pillow 102.3/170: 60% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge, battle_potion_of_agility
2:31.849 direct I mutilate Fluffy_Pillow 90.6/170: 53% energy | 0.0/5: 0% combo_points elaborate_planning, deadly_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge, battle_potion_of_agility
2:32.855 direct I mutilate Fluffy_Pillow 67.9/170: 40% energy | 2.0/5: 40% combo_points elaborate_planning, deadly_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge, battle_potion_of_agility
2:33.861 Waiting     0.800 sec 38.1/170: 22% energy | 4.0/5: 80% combo_points elaborate_planning, deadly_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge, battle_potion_of_agility
2:34.661 cds G toxic_blade Fluffy_Pillow 55.7/170: 33% energy | 4.0/5: 80% combo_points elaborate_planning, deadly_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge, battle_potion_of_agility
2:35.871 direct H envenom Fluffy_Pillow 65.8/170: 39% energy | 5.0/5: 100% combo_points deadly_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:36.877 Waiting     0.300 sec 44.2/170: 26% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:37.177 direct I mutilate Fluffy_Pillow 55.2/170: 32% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:38.183 Waiting     1.000 sec 25.6/170: 15% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, deadly_navigation(2), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:39.183 direct I mutilate Fluffy_Pillow 52.9/170: 31% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, deadly_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:40.188 Waiting     0.645 sec 16.3/170: 10% energy | 4.0/5: 80% combo_points envenom, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:41.343 dot J garrote Fluffy_Pillow 45.8/170: 27% energy | 4.0/5: 80% combo_points envenom, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:42.347 Waiting     0.576 sec 21.3/170: 13% energy | 5.0/5: 100% combo_points deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:42.923 direct H envenom Fluffy_Pillow 36.0/170: 21% energy | 5.0/5: 100% combo_points deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:43.927 Waiting     1.456 sec 21.5/170: 13% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:45.383 direct I mutilate Fluffy_Pillow 55.2/170: 32% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:46.387 Waiting     1.000 sec 25.8/170: 15% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:47.387 direct I mutilate Fluffy_Pillow 53.3/170: 31% energy | 3.0/5: 60% combo_points envenom, frothing_rage, deadly_navigation(2), quick_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:48.391 Waiting     4.894 sec 16.9/170: 10% energy | 5.0/5: 100% combo_points envenom, frothing_rage, deadly_navigation(3), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:53.285 direct H envenom Fluffy_Pillow 125.6/170: 74% energy | 5.0/5: 100% combo_points frothing_rage, deadly_navigation(3), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:54.287 direct I mutilate Fluffy_Pillow 118.2/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
2:55.291 dot J garrote Fluffy_Pillow 89.2/170: 52% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(25), titanic_overcharge(5)
2:56.297 dot K rupture Fluffy_Pillow 65.7/170: 39% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(24)
2:57.301 direct I mutilate Fluffy_Pillow 69.1/170: 41% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(23)
2:58.306 Waiting     0.200 sec 40.4/170: 24% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
2:58.506 direct I mutilate Fluffy_Pillow 50.3/170: 30% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
2:59.510 Waiting     0.722 sec 14.7/170: 9% energy | 5.0/5: 100% combo_points elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
3:00.232 cds G toxic_blade Fluffy_Pillow 39.0/170: 23% energy | 5.0/5: 100% combo_points elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
3:01.238 Waiting     0.100 sec 33.3/170: 20% energy | 5.0/5: 100% combo_points frothing_rage, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
3:01.338 direct H envenom Fluffy_Pillow 41.7/170: 25% energy | 5.0/5: 100% combo_points frothing_rage, deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
3:02.342 Waiting     0.700 sec 28.0/170: 16% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
3:03.042 direct I mutilate Fluffy_Pillow 51.9/170: 31% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
3:04.046 Waiting     1.433 sec 16.1/170: 9% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(2), deadly_navigation(3), quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
3:05.479 direct I mutilate Fluffy_Pillow 50.9/170: 30% energy | 2.0/5: 40% combo_points envenom, frothing_rage(3), deadly_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge
3:06.481 Waiting     0.400 sec 29.7/170: 17% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
3:06.881 direct H envenom Fluffy_Pillow 35.6/170: 21% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
3:07.884 Waiting     1.100 sec 29.3/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
3:08.984 direct I mutilate Fluffy_Pillow 52.4/170: 31% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(12)
3:09.989 Waiting     0.900 sec 24.0/170: 14% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(11)
3:10.889 direct I mutilate Fluffy_Pillow 51.1/170: 30% energy | 3.0/5: 60% combo_points envenom, frothing_rage(3), deadly_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(10)
3:11.893 Waiting     2.949 sec 15.6/170: 9% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), deadly_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(9)
3:14.842 dot K rupture Fluffy_Pillow 85.8/170: 50% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
3:15.848 dot J garrote Fluffy_Pillow 88.2/170: 52% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(3), deadly_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge
3:16.851 direct I mutilate Fluffy_Pillow 63.6/170: 37% energy | 1.0/5: 20% combo_points elaborate_planning, frothing_rage(3), deadly_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
3:17.855 Waiting     4.000 sec 33.9/170: 20% energy | 4.0/5: 80% combo_points elaborate_planning, frothing_rage(3), deadly_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge
3:21.855 direct H envenom Fluffy_Pillow 129.0/170: 76% energy | 4.0/5: 80% combo_points frothing_rage(3), deadly_navigation_final, quick_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:22.860 direct I mutilate Fluffy_Pillow 107.4/170: 63% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:23.865 direct I mutilate Fluffy_Pillow 84.7/170: 50% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:24.868 Waiting     0.200 sec 48.1/170: 28% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:25.068 cds G toxic_blade Fluffy_Pillow 57.8/170: 34% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation_final, quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:26.235 direct H envenom Fluffy_Pillow 60.4/170: 36% energy | 5.0/5: 100% combo_points envenom, frothing_rage(3), quick_navigation(3), unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:27.238 direct I mutilate Fluffy_Pillow 52.8/170: 31% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation(4), unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:28.242 Waiting     1.416 sec 23.4/170: 14% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage(3), quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:29.658 direct I mutilate Fluffy_Pillow 50.3/170: 30% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:30.663 Waiting     0.500 sec 28.5/170: 17% energy | 5.0/5: 100% combo_points envenom, quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:31.163 direct H envenom Fluffy_Pillow 35.6/170: 21% energy | 5.0/5: 100% combo_points envenom, quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection
3:32.932 dot J garrote Fluffy_Pillow 46.6/170: 27% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, quick_navigation_final, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:33.937 Waiting     0.951 sec 22.9/170: 13% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:34.888 direct I mutilate Fluffy_Pillow 50.3/170: 30% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:35.892 Waiting     1.537 sec 14.5/170: 9% energy | 3.0/5: 60% combo_points envenom, quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:37.429 direct I mutilate Fluffy_Pillow 50.4/170: 30% energy | 3.0/5: 60% combo_points envenom, deadly_navigation, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:38.433 Waiting     0.400 sec 28.4/170: 17% energy | 5.0/5: 100% combo_points envenom, deadly_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:38.833 dot K rupture Fluffy_Pillow 33.7/170: 20% energy | 5.0/5: 100% combo_points envenom, deadly_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:39.835 Waiting     1.000 sec 36.0/170: 21% energy | 0.0/5: 0% combo_points elaborate_planning, deadly_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:40.835 direct I mutilate Fluffy_Pillow 56.3/170: 33% energy | 0.0/5: 0% combo_points elaborate_planning, deadly_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(25), titanic_overcharge(2)
3:41.841 Waiting     0.700 sec 27.7/170: 16% energy | 3.0/5: 60% combo_points elaborate_planning, deadly_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge(3)
3:42.541 direct I mutilate Fluffy_Pillow 51.7/170: 30% energy | 3.0/5: 60% combo_points elaborate_planning, deadly_navigation, quick_navigation, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge(4)
3:43.545 Waiting     4.715 sec 16.2/170: 10% energy | 5.0/5: 100% combo_points deadly_navigation(2), quick_navigation, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge(4)
3:48.260 direct H envenom Fluffy_Pillow 125.4/170: 74% energy | 5.0/5: 100% combo_points deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge(4)
3:49.265 dot J garrote Fluffy_Pillow 118.6/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(4)
3:50.269 cds G toxic_blade Fluffy_Pillow 101.8/170: 60% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(5)
3:51.273 direct I mutilate Fluffy_Pillow 96.0/170: 56% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(5)
3:52.278 direct H envenom Fluffy_Pillow 74.2/170: 44% energy | 5.0/5: 100% combo_points envenom, frothing_rage, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(6)
3:53.282 direct I mutilate Fluffy_Pillow 60.4/170: 36% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(6)
3:54.288 Waiting     0.300 sec 31.6/170: 19% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(6)
3:54.588 direct H envenom Fluffy_Pillow 35.8/170: 21% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(6)
3:55.594 Waiting     0.900 sec 28.9/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation, elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(6)
3:56.494 direct I mutilate Fluffy_Pillow 55.5/170: 33% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(6)
3:57.499 Waiting     1.194 sec 19.5/170: 11% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(3), quick_navigation, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(6)
3:58.693 direct I mutilate Fluffy_Pillow 50.1/170: 29% energy | 2.0/5: 40% combo_points envenom, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(6)
3:59.697 Waiting     3.200 sec 28.1/170: 17% energy | 5.0/5: 100% combo_points envenom, frothing_rage, deadly_navigation(4), quick_navigation(2), elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(6)
4:02.897 dot K rupture Fluffy_Pillow 99.9/170: 59% energy | 5.0/5: 100% combo_points frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(2)
4:03.902 cds E vendetta Fluffy_Pillow 88.3/170: 52% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge
4:04.908 cds D berserking Fluffy_Pillow 135.9/170: 80% energy | 0.0/5: 0% combo_points vendetta_energy, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:04.908 direct I mutilate Fluffy_Pillow 135.9/170: 80% energy | 0.0/5: 0% combo_points berserking, vendetta_energy, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:05.912 direct I mutilate Fluffy_Pillow 121.4/170: 71% energy | 2.0/5: 40% combo_points berserking, vendetta_energy, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:06.916 direct H envenom Fluffy_Pillow 120.6/170: 71% energy | 5.0/5: 100% combo_points berserking, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:07.921 dot J garrote Fluffy_Pillow 115.2/170: 68% energy | 0.0/5: 0% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:08.925 direct I mutilate Fluffy_Pillow 99.7/170: 59% energy | 1.0/5: 20% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:09.929 direct H envenom Fluffy_Pillow 65.4/170: 38% energy | 4.0/5: 80% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:10.934 direct I mutilate Fluffy_Pillow 60.1/170: 35% energy | 0.0/5: 0% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:11.939 Waiting     0.700 sec 40.1/170: 24% energy | 3.0/5: 60% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:12.639 direct I mutilate Fluffy_Pillow 51.6/170: 30% energy | 3.0/5: 60% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:13.644 Waiting     0.200 sec 32.1/170: 19% energy | 5.0/5: 100% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:13.844 direct H envenom Fluffy_Pillow 35.4/170: 21% energy | 5.0/5: 100% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:14.849 Waiting     0.200 sec 30.9/170: 18% energy | 0.0/5: 0% combo_points berserking, envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:15.049 cds G toxic_blade Fluffy_Pillow 33.9/170: 20% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:16.274 Waiting     0.400 sec 45.4/170: 27% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:16.674 direct I mutilate Fluffy_Pillow 51.1/170: 30% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:17.677 Waiting     0.400 sec 29.5/170: 17% energy | 4.0/5: 80% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:18.077 direct H envenom Fluffy_Pillow 35.2/170: 21% energy | 4.0/5: 80% combo_points envenom, frothing_rage, deadly_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
4:19.081 Waiting     1.300 sec 28.3/170: 17% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection
4:20.381 direct I mutilate Fluffy_Pillow 60.6/170: 36% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection
4:21.388 Waiting     0.900 sec 24.8/170: 15% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation(4), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection
4:22.288 direct I mutilate Fluffy_Pillow 51.0/170: 30% energy | 3.0/5: 60% combo_points envenom, frothing_rage, deadly_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:23.293 Waiting     0.815 sec 14.2/170: 8% energy | 5.0/5: 100% combo_points envenom, frothing_rage, deadly_navigation(4), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:24.108 direct H envenom Fluffy_Pillow 39.0/170: 23% energy | 5.0/5: 100% combo_points envenom, frothing_rage, deadly_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:25.114 cds F vanish Fluffy_Pillow 17.3/170: 10% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage, deadly_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:26.137 stealthed N garrote Fluffy_Pillow 45.7/170: 27% energy | 0.0/5: 0% combo_points vanish, envenom, elaborate_planning, frothing_rage, deadly_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge
4:27.141 Waiting     1.300 sec 28.9/170: 17% energy | 1.0/5: 20% combo_points envenom, subterfuge, elaborate_planning, frothing_rage, deadly_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge
4:28.441 direct I mutilate Fluffy_Pillow 54.2/170: 32% energy | 1.0/5: 20% combo_points envenom, subterfuge, frothing_rage(2), deadly_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
4:29.447 Waiting     0.800 sec 25.4/170: 15% energy | 3.0/5: 60% combo_points envenom, frothing_rage(2), deadly_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
4:30.247 direct I mutilate Fluffy_Pillow 50.6/170: 30% energy | 3.0/5: 60% combo_points envenom, frothing_rage(2), deadly_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
4:31.252 Waiting     0.733 sec 14.7/170: 9% energy | 5.0/5: 100% combo_points frothing_rage(2), deadly_navigation_final, quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
4:31.985 dot K rupture Fluffy_Pillow 39.0/170: 23% energy | 5.0/5: 100% combo_points frothing_rage(2), deadly_navigation_final, quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(19)
4:32.988 Waiting     0.600 sec 28.0/170: 16% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), deadly_navigation_final, quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(18)
4:33.588 direct I mutilate Fluffy_Pillow 50.3/170: 30% energy | 0.0/5: 0% combo_points elaborate_planning, frothing_rage(2), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17)
4:34.593 Waiting     1.576 sec 14.2/170: 8% energy | 2.0/5: 40% combo_points elaborate_planning, frothing_rage(2), deadly_navigation, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(16)
4:36.169 direct I mutilate Fluffy_Pillow 50.0/170: 29% energy | 2.0/5: 40% combo_points frothing_rage(2), deadly_navigation, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
4:37.172 Waiting     2.900 sec 27.9/170: 16% energy | 4.0/5: 80% combo_points frothing_rage(2), deadly_navigation, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
4:40.072 cds G toxic_blade Fluffy_Pillow 95.8/170: 56% energy | 4.0/5: 80% combo_points frothing_rage(3), deadly_navigation, quick_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
4:41.274 direct H envenom Fluffy_Pillow 106.2/170: 62% energy | 5.0/5: 100% combo_points frothing_rage(3), deadly_navigation, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
4:42.277 direct I mutilate Fluffy_Pillow 84.9/170: 50% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation, quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
4:43.281 direct I mutilate Fluffy_Pillow 62.6/170: 37% energy | 2.0/5: 40% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation, unstable_flames(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge
4:44.286 Waiting     0.100 sec 33.2/170: 20% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge
4:44.386 direct H envenom Fluffy_Pillow 41.5/170: 24% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge
4:45.390 Waiting     1.164 sec 20.1/170: 12% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, frothing_rage(3), deadly_navigation(2), quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
4:46.554 dot J garrote Fluffy_Pillow 49.7/170: 29% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge
4:47.558 Waiting     1.400 sec 25.2/170: 15% energy | 1.0/5: 20% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
4:48.958 direct I mutilate Fluffy_Pillow 50.9/170: 30% energy | 1.0/5: 20% combo_points envenom, deadly_navigation(3), quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge
4:49.963 Waiting     1.000 sec 28.4/170: 17% energy | 3.0/5: 60% combo_points envenom, deadly_navigation(3), quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(2)
4:50.963 direct I mutilate Fluffy_Pillow 55.8/170: 33% energy | 3.0/5: 60% combo_points envenom, deadly_navigation(3), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:51.967 Waiting     4.829 sec 19.2/170: 11% energy | 5.0/5: 100% combo_points envenom, deadly_navigation(3), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:56.796 direct H envenom Fluffy_Pillow 126.1/170: 74% energy | 5.0/5: 100% combo_points deadly_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:57.800 direct I mutilate Fluffy_Pillow 118.5/170: 70% energy | 0.0/5: 0% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:58.804 direct I mutilate Fluffy_Pillow 89.0/170: 52% energy | 3.0/5: 60% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
4:59.809 Waiting     0.300 sec 59.4/170: 35% energy | 5.0/5: 100% combo_points envenom, elaborate_planning, deadly_navigation(3), quick_navigation(2), archive_of_the_titans(20), resounding_protection

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 6566 6148 4387 (3433)
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 1676 1464 0
Spirit 0 0 0 0 0
Health 180520 164120 0
Energy 170 170 0
Combo Points 5 5 0
Crit 22.58% 22.58% 906
Haste 19.37% 19.37% 1317
Damage / Heal Versatility 2.29% 2.29% 195
Attack Power 7223 6148 0
Mastery 27.39% 27.39% 584
Armor 1897 1897 1897
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Hood of Pestilent Ichor
ilevel: 390, stats: { 260 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Unstable Flames, Resounding Protection, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Usurper's Bloodcaked Spaulders
ilevel: 390, stats: { 240 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Vampiric Speed, Azerite Empowered }
Local Chest Jerkin of the Aberrant Chimera
ilevel: 390, stats: { 320 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Resounding Protection, Azerite Empowered }
Local Waist Replicated Chitin Cord
ilevel: 385, stats: { 174 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Legs Pathogenic Legwraps
ilevel: 385, stats: { 271 Armor, +329 AgiInt, +556 Sta, +154 Haste, +91 Mastery }
Local Feet Quarantine Protocol Treads
ilevel: 385, stats: { 213 Armor, +247 AgiInt, +417 Sta, +104 Haste, +80 Vers }
Local Wrists Wristwraps of Coursing Miasma
ilevel: 385, stats: { 135 Armor, +185 AgiInt, +312 Sta, +83 Crit, +54 Haste }
Local Hands Gloves of Descending Madness
ilevel: 385, stats: { 193 Armor, +247 AgiInt, +417 Sta, +115 Haste, +68 Crit }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: deadly_navigation
Local Off Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: quick_navigation

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Blindside (Assassination Rogue)
30 Nightstalker Subterfuge Master Assassin (Assassination Rogue)
45 Vigor Deeper Stratagem Marked for Death
60 Leeching Poison (Assassination Rogue) Cheat Death Elusiveness
75 Internal Bleeding (Assassination Rogue) Iron Wire (Assassination Rogue) Prey on the Weak
90 Venom Rush (Assassination Rogue) Toxic Blade (Assassination Rogue) Exsanguinate (Assassination Rogue)
100 Poison Bomb (Assassination Rogue) Hidden Blades (Assassination Rogue) Crimson Tempest (Assassination Rogue)

Profile

rogue="T22_Rogue_Assassination"
spec=assassination
level=120
race=troll
role=attack
position=back
talents=2210021

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion
actions.precombat+=/marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=variable,name=energy_regen_combined,value=energy.regen+poisoned_bleeds*7%(2*spell_haste)
actions+=/call_action_list,name=stealthed,if=stealthed.rogue
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=dot
actions+=/call_action_list,name=direct
actions+=/arcane_torrent,if=energy.deficit>=15+variable.energy_regen_combined
actions+=/arcane_pulse
actions+=/lights_judgment

actions.cds=potion,if=buff.bloodlust.react|target.time_to_die<=60|debuff.vendetta.up&cooldown.vanish.remains<5
actions.cds+=/blood_fury,if=debuff.vendetta.up
actions.cds+=/berserking,if=debuff.vendetta.up
actions.cds+=/fireblood,if=debuff.vendetta.up
actions.cds+=/ancestral_call,if=debuff.vendetta.up
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit*1.5|(raid_event.adds.in>40&combo_points.deficit>=cp_max_spend)
actions.cds+=/vendetta,if=dot.rupture.ticking
# Vanish with Exsg + (Nightstalker, or Subterfuge only on 1T): Maximum CP and Exsg ready for next GCD
actions.cds+=/vanish,if=talent.exsanguinate.enabled&(talent.nightstalker.enabled|talent.subterfuge.enabled&spell_targets.fan_of_knives<2)&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1
# Vanish with Nightstalker + No Exsg: Maximum CP and Vendetta up
actions.cds+=/vanish,if=talent.nightstalker.enabled&!talent.exsanguinate.enabled&combo_points>=cp_max_spend&debuff.vendetta.up
# Vanish with Subterfuge + (No Exsg or 2T+): No stealth/subterfuge, Garrote Refreshable, enough space for incoming Garrote CP
actions.cds+=/vanish,if=talent.subterfuge.enabled&(!talent.exsanguinate.enabled|spell_targets.fan_of_knives>=2)&!stealthed.rogue&cooldown.garrote.up&dot.garrote.refreshable&(spell_targets.fan_of_knives<=3&combo_points.deficit>=1+spell_targets.fan_of_knives|spell_targets.fan_of_knives>=4&combo_points.deficit>=4)
# Vanish with Master Assasin: No stealth and no active MA buff, Rupture not in refresh range
actions.cds+=/vanish,if=talent.master_assassin.enabled&!stealthed.all&master_assassin_remains<=0&!dot.rupture.refreshable
# Exsanguinate when both Rupture and Garrote are up for long enough
actions.cds+=/exsanguinate,if=dot.rupture.remains>4+4*cp_max_spend&!dot.garrote.refreshable
actions.cds+=/toxic_blade,if=dot.rupture.ticking

# Envenom at 4+ (5+ with DS) CP. Immediately on 2+ targets, with Vendetta, or with TB; otherwise wait for some energy. Also wait if Exsg combo is coming up.
actions.direct=envenom,if=combo_points>=4+talent.deeper_stratagem.enabled&(debuff.vendetta.up|debuff.toxic_blade.up|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2)&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains>2)
actions.direct+=/variable,name=use_filler,value=combo_points.deficit>1|energy.deficit<=25+variable.energy_regen_combined|spell_targets.fan_of_knives>=2
# Poisoned Knife at 29+ stacks of Sharpened Blades. Up to 4 targets with Rank 1, more otherwise.
actions.direct+=/poisoned_knife,if=variable.use_filler&buff.sharpened_blades.stack>=29&(azerite.sharpened_blades.rank>=2|spell_targets.fan_of_knives<=4)
actions.direct+=/fan_of_knives,if=variable.use_filler&(buff.hidden_blades.stack>=19|spell_targets.fan_of_knives>=2+stealthed.rogue|buff.the_dreadlords_deceit.stack>=29)
actions.direct+=/blindside,if=variable.use_filler&(buff.blindside.up|!talent.venom_rush.enabled)
actions.direct+=/mutilate,if=variable.use_filler

# Special Rupture setup for Exsg
actions.dot=rupture,if=talent.exsanguinate.enabled&((combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1)|(!ticking&(time>10|combo_points>=2)))
# Garrote upkeep, also tries to use it as a special generator for the last CP before a finisher
actions.dot+=/pool_resource,for_next=1
actions.dot+=/garrote,cycle_targets=1,if=(!talent.subterfuge.enabled|!(cooldown.vanish.up&cooldown.vendetta.remains<=4))&combo_points.deficit>=1&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&(target.time_to_die-remains>4&spell_targets.fan_of_knives<=1|target.time_to_die-remains>12)
# Crimson Tempest only on multiple targets at 4+ CP when running out in 2s (up to 4 targets) or 3s (5+ targets)
actions.dot+=/crimson_tempest,if=spell_targets>=2&remains<2+(spell_targets>=5)&combo_points>=4
# Keep up Rupture at 4+ on all targets (when living long enough and not snapshot)
actions.dot+=/rupture,cycle_targets=1,if=combo_points>=4&refreshable&(pmultiplier<=1|remains<=tick_time)&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>4

# Nighstalker, or Subt+Exsg on 1T: Snapshot Rupture; Also use Rupture over Envenom if it's not applied (Opener)
actions.stealthed=rupture,if=combo_points>=4&(talent.nightstalker.enabled|talent.subterfuge.enabled&talent.exsanguinate.enabled&spell_targets.fan_of_knives<2|!ticking)&target.time_to_die-remains>6
actions.stealthed+=/envenom,if=combo_points>=cp_max_spend
# Subterfuge: Apply or Refresh with buffed Garrotes
actions.stealthed+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&refreshable&(!exsanguinated|remains<=tick_time*2)&target.time_to_die-remains>2
# Subterfuge: Override normal Garrotes with snapshot versions
actions.stealthed+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&remains<=10&pmultiplier<=1&!exsanguinated&target.time_to_die-remains>2
# Subterfuge + Exsg: Even override a snapshot Garrote right after Rupture before Exsanguination
actions.stealthed+=/pool_resource,for_next=1
actions.stealthed+=/garrote,if=talent.subterfuge.enabled&talent.exsanguinate.enabled&cooldown.exsanguinate.remains<1&prev_gcd.1.rupture&dot.rupture.remains>5+4*cp_max_spend

head=hood_of_pestilent_ichor,id=160623,bonus_id=4824/1507/4775,azerite_powers=4/483/459/15/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=usurpers_bloodcaked_spaulders,id=160620,bonus_id=4824/1507/4775,azerite_powers=4/483/30/44/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=jerkin_of_the_aberrant_chimera,id=160619,bonus_id=4824/1507/4775,azerite_powers=4/483/21/15/13
wrists=wristwraps_of_coursing_miasma,id=160621,bonus_id=4800/1507
hands=gloves_of_descending_madness,id=160618,bonus_id=4800/1507
waist=replicated_chitin_cord,id=160717,bonus_id=4800/1507
legs=pathogenic_legwraps,id=160625,bonus_id=4800/1507
feet=quarantine_protocol_treads,id=160624,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=deadly_navigation
off_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=906
# gear_haste_rating=1317
# gear_mastery_rating=584
# gear_versatility_rating=195
# gear_armor=1897

T22_Rogue_Outlaw : 16437 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16437.1 16437.1 17.1 / 0.104% 2960.8 / 18.0% 498.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
33.0 32.6 Energy 10.49% 57.3 100.0% 100%
Talents
  • 15: Quick Draw (Outlaw Rogue)
  • 30: Hit and Run (Outlaw Rogue)
  • 45: Vigor
  • 90: Alacrity (Outlaw Rogue)
  • 100: Killing Spree (Outlaw Rogue)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Rogue_Outlaw 16437
Ambush 241 1.5% 6.6 57.21sec 10870 10822 Direct 6.6 8488 17283 10870 27.1% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.63 6.63 0.00 0.00 1.0045 0.0000 72085.33 103054.64 30.05 10822.00 10822.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.84 72.92% 8487.66 7519 11754 8478.50 0 10711 41043 58675 30.05
crit 1.80 27.08% 17283.20 15338 23979 14988.26 0 23593 31043 44379 26.07
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing {$s1=0} Physical damage. |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
auto_attack_mh 2467 15.0% 214.2 1.41sec 3454 2509 Direct 214.2 3110 6344 3454 29.0% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.21 214.21 0.00 0.00 1.3764 0.0000 739813.10 1057651.67 30.05 2509.24 2509.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.34 51.98% 3110.28 2817 3696 3110.48 3056 3181 346289 495062 30.05
crit 62.03 28.96% 6343.89 5747 7539 6344.13 6221 6499 393524 562590 30.05
miss 40.84 19.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
auto_attack_oh 1219 7.4% 211.4 1.42sec 1729 1236 Direct 211.4 1555 3172 1729 29.0% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 211.39 211.39 0.00 0.00 1.3986 0.0000 365463.33 522473.72 30.05 1236.20 1236.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.84 51.96% 1555.03 1409 1848 1555.12 1527 1588 170802 244182 30.05
crit 61.37 29.03% 3171.97 2873 3769 3172.15 3108 3253 194661 278292 30.05
miss 40.18 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Between the Eyes 737 4.5% 8.2 24.67sec 27076 28960 Direct 8.2 7600 31274 27075 82.3% 0.0%  

Stats details: between_the_eyes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.9350 0.0000 221106.06 316097.66 30.05 28959.54 28959.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.45 17.73% 7599.97 5702 9285 5614.90 0 9285 11004 15732 22.19
crit 6.72 82.27% 31273.51 20077 38255 30590.94 0 37210 210102 300366 29.35
 
 

Action details: between_the_eyes

Static Values
  • id:199804
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ruthless_precision.up|azerite.ace_up_your_sleeve.enabled|azerite.deadshot.enabled
Spelldata
  • id:199804
  • name:Between the Eyes
  • school:physical
  • tooltip:Stunned.
  • description:Finishing move that deals damage with your pistol and stuns the target.$?a235484[ Critical strikes with this ability deal four times normal damage.][] 1 point : ${$<damage>*1} damage, 1 sec 2 points: ${$<damage>*2} damage, 2 sec 3 points: ${$<damage>*3} damage, 3 sec 4 points: ${$<damage>*4} damage, 4 sec 5 points: ${$<damage>*5} damage, 5 sec{$?s193531=false}[ 6 points: ${$<damage>*6} damage, 6 sec][]
 
Dispatch 3683 22.4% 58.5 5.01sec 18888 20270 Direct 58.5 14529 29703 18887 28.7% 0.0%  

Stats details: dispatch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.47 58.47 0.00 0.00 0.9318 0.0000 1104273.68 1578691.84 30.05 20270.46 20270.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.67 71.28% 14529.18 8363 17955 14553.66 13320 15401 605486 865614 30.05
crit 16.79 28.72% 29703.06 17191 36628 29740.26 26072 32180 498788 713077 30.05
 
 

Action details: dispatch

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Dispatch
  • school:physical
  • tooltip:
  • description:Finishing move that dispatches the enemy, dealing damage per combo point: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Frenetic Blow (frentic_blow) 368 2.2% 4.0 66.70sec 27670 0 Direct 4.0 21095 43019 27668 30.0% 0.0%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 110600.78 158117.09 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.80 70.01% 21094.73 20587 22607 20666.55 0 22607 59034 84396 29.43
crit 1.20 29.99% 43019.21 41997 46119 31767.22 0 46119 51567 73721 22.19
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Killing Spree 0 (647) 0.0% (3.9%) 5.7 49.98sec 34364 15318

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.65 0.00 33.81 0.00 2.2434 0.3331 0.00 0.00 0.00 15317.93 15317.93
 
 

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_flurry_sync&(energy.time_to_max>5|energy<15)
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec.
  • description:Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Killing Spree (_mh) 324 2.0% 33.8 7.15sec 2873 0 Periodic 33.8 2191 4466 2873 30.0% 0.0% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.81 0.00 0.00 33.81 0.0000 0.0000 97142.48 138876.85 30.05 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.7 70.03% 2191.45 2035 2426 2191.62 2126 2275 51882 74172 30.05
crit 10.1 29.97% 4466.13 4151 4949 4464.77 0 4949 45260 64705 30.04
 
 

Action details: killing_spree_mh

Static Values
  • id:57841
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57841
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Killing Spree (_oh) 324 2.0% 33.8 7.15sec 2874 0 Periodic 33.8 2191 4467 2874 30.0% 0.0% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.81 0.00 0.00 33.81 0.0000 0.0000 97165.44 138909.67 30.05 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.7 70.00% 2191.28 2035 2426 2191.40 2125 2285 51860 74140 30.05
crit 10.1 30.00% 4466.96 4151 4949 4465.75 0 4909 45305 64769 30.04
 
 

Action details: killing_spree_oh

Static Values
  • id:57842
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57842
  • name:Killing Spree
  • school:physical
  • tooltip:
  • description:{$@spelldesc51690=Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Main Gauche 2109 12.8% 117.1 2.65sec 5400 0 Direct 117.1 4129 8423 5400 29.6% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.06 117.06 0.00 0.00 0.0000 0.0000 632143.25 903724.69 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.40 70.39% 4129.00 3668 5781 4129.36 3990 4413 340216 486379 30.05
crit 34.66 29.61% 8422.81 7482 11792 8423.15 8038 9231 291927 417345 30.05
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:{$@spelldesc76806=Your main-hand attacks have a {$h=30}% chance to trigger an attack with your off-hand that deals {$86392s1=0} Physical damage.}
 
Pistol Shot 1748 10.6% 51.2 5.77sec 10228 10999 Direct 51.2 7829 15910 10229 29.7% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.23 51.23 0.00 0.00 0.9300 0.0000 523957.24 749059.80 30.05 10998.96 10998.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.01 70.30% 7828.74 6884 10814 7831.90 7464 8837 281934 403058 30.05
crit 15.21 29.70% 15909.80 14044 22061 15921.88 14832 18118 242024 346002 30.05
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadside.up+talent.quick_draw.enabled&buff.opportunity.up
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing ${{$s1=0}*$<CAP>/$AP} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Sinister Strike 3217 19.6% 131.4 2.27sec 7339 7885 Direct 183.0 4025 8183 5271 30.0% 0.0%  

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.42 182.97 0.00 0.00 0.9307 0.0000 964488.96 1378852.80 30.05 7885.29 7885.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.13 70.03% 4025.34 3549 5575 4027.44 3879 4610 515784 737375 30.05
crit 54.83 29.97% 8183.25 7239 11372 8190.53 7866 9233 448705 641478 30.05
 
 

Action details: sinister_strike

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193315
  • name:Sinister Strike
  • school:physical
  • tooltip:
  • description:Viciously strike an enemy, causing ${{$s1=0}*$<mult>} Physical damage.{$?s279876=true}[ Has a {$s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Rogue_Outlaw
Adrenaline Rush 4.7 72.70sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 0.00 0.00 0.00 0.7887 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.8000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=60}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=60}% and your attack speed by {$s2=20}% for {$d=20 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Outlaw
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Outlaw
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Outlaw
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 14.6 20.23sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.61 0.00 0.00 0.00 0.9293 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Vanish 5.6 57.21sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.63 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!stealthed.all&variable.ambush_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 4.7 0.0 72.0sec 72.7sec 29.85% 27.27% 0.0(0.0) 4.4

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • adrenaline_rush_1:29.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=60}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=60}% and your attack speed by {$s2=20}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 77.1 206.7sec 3.8sec 99.05% 100.00% 73.1(73.1) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_alacrity
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • alacrity_1:0.94%
  • alacrity_2:0.96%
  • alacrity_3:0.96%
  • alacrity_4:0.96%
  • alacrity_5:95.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=2}% for {$d=20 seconds}.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:36.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=6}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Agility 2.0 0.0 72.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Broadside 3.0 0.0 62.1sec 62.1sec 15.70% 13.95% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_broadside
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • broadside_1:15.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193356
  • name:Broadside
  • tooltip:Your combo-point generating abilities generate {$s1=1} additional combo point and deal {$s4=20}% increased damage.
  • description:Your combo-point generating abilities generate {$s1=1} additional combo point and deal {$s4=20}% increased damage for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 3.0 0.0 63.4sec 63.4sec 16.57% 15.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • buried_treasure_1:16.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by ${{$s1=20}/5} per sec.
  • description:Your base Energy regeneration is increased by ${{$s1=20}/5} per sec for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.7 0.2 74.0sec 65.0sec 9.06% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:9.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.6 0.2 74.8sec 65.9sec 8.96% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:8.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.7 0.2 74.0sec 64.7sec 9.09% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:9.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 74.7sec 65.8sec 9.02% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 5.1 13.1 61.7sec 16.2sec 75.25% 0.00% 0.0(0.0) 0.4

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:26.94%
  • frothing_rage_2:25.17%
  • frothing_rage_3:23.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Grand Melee 3.0 0.0 76.2sec 76.2sec 38.64% 39.61% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.65
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grand_melee_1:38.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=55}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=55}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Killing Spree 2.2 0.0 149.9sec 149.9sec 1.44% 0.00% 10.8(10.8) 2.2

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:2.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.40

Stack Uptimes

  • killing_spree_1:1.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:51690
  • name:Killing Spree
  • tooltip:Attacking an enemy every $t1 sec.
  • description:Teleport to an enemy within 10 yards, attacking with both weapons for a total of $<dmg> Physical damage over {$d=2 seconds}. While Blade Flurry is active, also hits all nearby enemies for {$s2=100}% damage.
  • max_stacks:0
  • duration:2.00
  • cooldown:120.00
  • default_chance:0.00%
Opportunity 51.5 0.0 5.8sec 5.8sec 32.61% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • opportunity_1:32.61%

Trigger Attempt Success

  • trigger_pct:39.42%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot costs {$s1=50}% less Energy and deals {$s3=100}% increased damage.
  • description:{$@spelldesc193315=Viciously strike an enemy, causing ${{$s1=0}*$<mult>} Physical damage.{$?s279876=true}[ Has a {$s3=35}% chance to hit an additional time, making your next Pistol Shot half cost and double damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 5.1 0.0 56.8sec 34.6sec 39.47% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.55%
  • overwhelming_power_2:1.55%
  • overwhelming_power_3:1.56%
  • overwhelming_power_4:1.56%
  • overwhelming_power_5:1.57%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.58%
  • overwhelming_power_8:1.58%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.59%
  • overwhelming_power_11:1.60%
  • overwhelming_power_12:1.61%
  • overwhelming_power_13:1.61%
  • overwhelming_power_14:1.62%
  • overwhelming_power_15:1.62%
  • overwhelming_power_16:1.62%
  • overwhelming_power_17:1.63%
  • overwhelming_power_18:1.63%
  • overwhelming_power_19:1.64%
  • overwhelming_power_20:1.64%
  • overwhelming_power_21:1.65%
  • overwhelming_power_22:1.66%
  • overwhelming_power_23:1.66%
  • overwhelming_power_24:1.69%
  • overwhelming_power_25:0.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.2sec 10.4sec 68.98% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.03%
  • quick_navigation_2:17.47%
  • quick_navigation_3:17.04%
  • quick_navigation_4:16.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.2sec 52.2sec 18.07% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Roll the Bones 2.6 12.0 107.8sec 20.3sec 98.34% 0.00% 12.0(12.0) 1.6

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • roll_the_bones_1:98.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Ruthless Precision 3.0 0.0 75.8sec 75.8sec 38.63% 44.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_ruthless_precision
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • ruthless_precision_1:38.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193357
  • name:Ruthless Precision
  • tooltip:Critical strike chance of Between the Eyes increased by ${{$s1=20}+{$s2=40}}%. Critical strike chance of all other abilities increased by {$s1=20}%.
  • description:Increases the critical ctrike chance of Between the Eyes by ${{$s1=20}+{$s2=40}}% and the critical strike chance of all other abilities by {$s1=20}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Skull and Crossbones 3.0 0.0 63.2sec 63.2sec 16.40% 15.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_skull_and_crossbones
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • skull_and_crossbones_1:16.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:199603
  • name:Skull and Crossbones
  • tooltip:Sinister Strike has an additional {$s1=30}% chance of striking an additional time.
  • description:Causes Sinister Strike to have an additional {$s1=30}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=20}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Titanic Overcharge 12.3 33.3 25.0sec 6.6sec 85.04% 0.00% 3.7(3.7) 11.5

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:40.51

Stack Uptimes

  • titanic_overcharge_1:23.09%
  • titanic_overcharge_2:16.78%
  • titanic_overcharge_3:12.25%
  • titanic_overcharge_4:8.96%
  • titanic_overcharge_5:6.48%
  • titanic_overcharge_6:4.73%
  • titanic_overcharge_7:3.43%
  • titanic_overcharge_8:9.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=36} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
True Bearing 3.0 0.0 62.3sec 62.3sec 16.99% 18.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • true_bearing_1:16.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishing moves reduce the remaining cooldown of many of your abilities by an additional $<cdr> sec per combo point.
  • description:Finishing moves reduce the remaining cooldown of many of your abilities by an additional $<cdr> sec per combo point.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Unstable Flames 25.7 28.9 11.8sec 5.5sec 67.56% 0.00% 2.3(2.3) 25.1

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:31.89%
  • unstable_flames_2:16.77%
  • unstable_flames_3:8.87%
  • unstable_flames_4:4.71%
  • unstable_flames_5:5.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 5.6 0.0 57.3sec 57.3sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vanish_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Versatile Navigation 6.2 23.1 52.2sec 10.4sec 68.97% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_versatile_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:50.00

Stack Uptimes

  • versatile_navigation_1:18.01%
  • versatile_navigation_2:17.44%
  • versatile_navigation_3:17.00%
  • versatile_navigation_4:16.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268854
  • name:Versatile Navigation
  • tooltip:Increases Versatility by $w1.
  • description:{$@spelldesc268852=Permanently enchant a weapon to sometimes increase Versatility by $268854s for {$268854d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268856s Versatility for {$268856d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Versatile Navigation (_final) 5.5 0.0 52.2sec 52.2sec 18.04% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Outlaw
  • cooldown name:buff_versatile_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:600.00

Stack Uptimes

  • versatile_navigation_final_1:18.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268856
  • name:Versatile Navigation
  • tooltip:Increases Versatility by $w1.
  • description:{$@spelldesc268852=Permanently enchant a weapon to sometimes increase Versatility by $268854s for {$268854d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268856s Versatility for {$268856d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Sinister Strike Extra Attack 51.5 5.8sec
Roll the Bones: 1 buff 11.5 24.5sec
Roll the Bones: 2 buffs 3.0 76.6sec
Roll the Bones: 5 buffs 0.1 123.3sec

Resources

Resource Usage Type Count Total Average RPE APR
T22_Rogue_Outlaw
ambush Energy 6.6 331.6 50.0 50.0 217.4
between_the_eyes Energy 8.2 204.1 25.0 25.0 1083.1
between_the_eyes Combo Points 8.2 39.6 4.8 4.8 5587.1
dispatch Energy 58.5 2046.4 35.0 35.0 539.6
dispatch Combo Points 58.5 280.5 4.8 4.8 3936.6
pistol_shot Energy 51.2 1024.5 20.0 20.0 511.4
roll_the_bones Energy 14.6 365.3 25.0 25.0 0.0
roll_the_bones Combo Points 14.6 70.6 4.8 4.8 0.0
sinister_strike Energy 131.4 5914.0 45.0 45.0 163.1
Resource Gains Type Count Total Average Overflow
pistol_shot Combo Points 51.23 51.23 (13.02%) 1.00 0.00 0.00%
sinister_strike Combo Points 182.97 170.73 (43.38%) 0.93 12.24 6.69%
ambush Combo Points 6.63 13.26 (3.37%) 2.00 0.00 0.00%
energy_regen Energy 1175.05 6192.96 (63.33%) 5.27 129.69 2.05%
Adrenaline Rush Energy 317.92 1071.16 (10.95%) 3.37 71.41 6.25%
Buried Treasure Energy 168.32 188.08 (1.92%) 1.12 10.61 5.34%
Combat Potency Energy 241.67 2326.09 (23.79%) 9.62 90.64 3.75%
Quick Draw Combo Points 51.23 51.23 (13.02%) 1.00 0.00 0.00%
Broadside Combo Points 31.44 28.98 (7.36%) 0.92 2.46 7.81%
Ruthlessness Combo Points 78.14 78.14 (19.85%) 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 32.59 32.95
Combo Points 1.31 1.30
Combat End Resource Mean Min Max
Energy 43.36 0.02 150.00
Combo Points 2.90 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.3%

Statistics & Data Analysis

Fight Length
Sample Data T22_Rogue_Outlaw Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Rogue_Outlaw Damage Per Second
Count 7499
Mean 16437.07
Minimum 14116.95
Maximum 20305.80
Spread ( max - min ) 6188.85
Range [ ( max - min ) / 2 * 100% ] 18.83%
Standard Deviation 753.5704
5th Percentile 15270.27
95th Percentile 17742.26
( 95th Percentile - 5th Percentile ) 2471.98
Mean Distribution
Standard Deviation 8.7021
95.00% Confidence Intervall ( 16420.01 - 16454.12 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8075
0.1 Scale Factor Error with Delta=300 4848
0.05 Scale Factor Error with Delta=300 19391
0.01 Scale Factor Error with Delta=300 484766
Priority Target DPS
Sample Data T22_Rogue_Outlaw Priority Target Damage Per Second
Count 7499
Mean 16437.07
Minimum 14116.95
Maximum 20305.80
Spread ( max - min ) 6188.85
Range [ ( max - min ) / 2 * 100% ] 18.83%
Standard Deviation 753.5704
5th Percentile 15270.27
95th Percentile 17742.26
( 95th Percentile - 5th Percentile ) 2471.98
Mean Distribution
Standard Deviation 8.7021
95.00% Confidence Intervall ( 16420.01 - 16454.12 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 81
0.1% Error 8075
0.1 Scale Factor Error with Delta=300 4848
0.05 Scale Factor Error with Delta=300 19391
0.01 Scale Factor Error with Delta=300 484766
DPS(e)
Sample Data T22_Rogue_Outlaw Damage Per Second (Effective)
Count 7499
Mean 16437.07
Minimum 14116.95
Maximum 20305.80
Spread ( max - min ) 6188.85
Range [ ( max - min ) / 2 * 100% ] 18.83%
Damage
Sample Data T22_Rogue_Outlaw Damage
Count 7499
Mean 4928239.67
Minimum 3524791.68
Maximum 6586562.47
Spread ( max - min ) 3061770.79
Range [ ( max - min ) / 2 * 100% ] 31.06%
DTPS
Sample Data T22_Rogue_Outlaw Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Rogue_Outlaw Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Rogue_Outlaw Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Rogue_Outlaw Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Rogue_Outlaw Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Rogue_Outlaw Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Rogue_OutlawTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Rogue_Outlaw Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion
6 0.00 marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40
7 0.00 roll_the_bones,precombat_seconds=2
8 0.00 slice_and_dice,precombat_seconds=2
9 0.00 adrenaline_rush,precombat_seconds=1
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=rtb_buffs<2&(buff.loaded_dice.up|!buff.grand_melee.up&!buff.ruthless_precision.up)
Reroll for 2+ buffs with Loaded Dice up. Otherwise reroll for 2+ or Grand Melee or Ruthless Precision.
0.00 variable,name=ambush_condition,value=combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&cooldown.ghostly_strike.remains<1)+buff.broadside.up&energy>60&!buff.skull_and_crossbones.up
0.00 variable,name=blade_flurry_sync,value=spell_targets.blade_flurry<2&raid_event.adds.in>20|buff.blade_flurry.up
With multiple targets, this variable is checked to decide whether some CDs should be synced with Blade Flurry
A 0.00 call_action_list,name=stealth,if=stealthed.all
B 0.00 call_action_list,name=cds
C 0.00 call_action_list,name=finish,if=combo_points>=cp_max_spend-(buff.broadside.up+buff.opportunity.up)*(talent.quick_draw.enabled&(!talent.marked_for_death.enabled|cooldown.marked_for_death.remains>1))
Finish at maximum CP. Substract one for each Broadside and Opportunity when Quick Draw is selected and MfD is not ready after the next second.
D 0.00 call_action_list,name=build
0.00 arcane_torrent,if=energy.deficit>=15+energy.regen
0.00 arcane_pulse
0.00 lights_judgment
actions.build
# count action,conditions
E 51.23 pistol_shot,if=combo_points.deficit>=1+buff.broadside.up+talent.quick_draw.enabled&buff.opportunity.up
F 131.42 sinister_strike
actions.cds
# count action,conditions
G 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=60|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
0.00 fireblood
0.00 ancestral_call
H 3.65 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.time_to_max>1
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15-buff.adrenaline_rush.up*5)&!stealthed.rogue&combo_points.deficit>=cp_max_spend-1)
0.00 blade_flurry,if=spell_targets>=2&!buff.blade_flurry.up&(!raid_event.adds.exists|raid_event.adds.remains>8|cooldown.blade_flurry.charges=1&raid_event.adds.in>(2-cooldown.blade_flurry.charges_fractional)*25)
Blade Flurry on 2+ enemies. With adds: Use if they stay for 8+ seconds or if your next charge will be ready in time for the next wave.
0.00 ghostly_strike,if=variable.blade_flurry_sync&combo_points.deficit>=1+buff.broadside.up
I 5.65 killing_spree,if=variable.blade_flurry_sync&(energy.time_to_max>5|energy<15)
0.00 blade_rush,if=variable.blade_flurry_sync&energy.time_to_max>1
J 5.63 vanish,if=!stealthed.all&variable.ambush_condition
Using Vanish/Ambush is only a very tiny increase, so in reality, you're absolutely fine to use it as a utility spell.
0.00 shadowmeld,if=!stealthed.all&variable.ambush_condition
actions.finish
# count action,conditions
0.00 slice_and_dice,if=buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
K 14.61 roll_the_bones,if=(buff.roll_the_bones.remains<=3|variable.rtb_reroll)&(target.time_to_die>20|buff.roll_the_bones.remains<target.time_to_die)
L 8.17 between_the_eyes,if=buff.ruthless_precision.up|azerite.ace_up_your_sleeve.enabled|azerite.deadshot.enabled
BTE with the Ruthless Precision buff from RtB or with the Ace Up Your Sleeve or Deadshot traits.
M 58.47 dispatch
actions.stealth
# count action,conditions
N 6.63 ambush

Sample Sequence

012459NJNFKEMFFMEMFFMFFMFFMFMEMFMEMFFMFMEMFFMFFMFKEFKJNEKFFFFKFIFMEFMEFFFMHGEFMEFFMFFMEFFMEFMEJNMFFMIEFFMFEMFEKFEMFEMFFFFMFEMFFFFMEFHFMJNFMEFKEKIFFKEFFMFFMEFMEFFMFFMEFMEFFMFFFMEFMIJNEMFFMHEFFMEFKEKFFFMEFMEFFMEFMEFMIEFFMEFFMEFMEFMEFFKFFFFLFHJNMEFFMFFMEFLEFFMIFFFMEFFMFFFKEFFKFEKFFMEFFMFFFFMFEMFFFFMFEMFFMEFMI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Rogue_Outlaw 150.0/150: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation T22_Rogue_Outlaw 150.0/150: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food T22_Rogue_Outlaw 150.0/150: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 stealth Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 5 potion Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth, battle_potion_of_agility
Pre precombat 9 adrenaline_rush Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth, adrenaline_rush, battle_potion_of_agility
0:00.000 stealth N ambush Fluffy_Pillow 150.0/150: 100% energy | 0.0/5: 0% combo_points stealth, adrenaline_rush, archive_of_the_titans, resounding_protection, battle_potion_of_agility
0:01.005 cds J vanish Fluffy_Pillow 148.5/150: 99% energy | 2.0/5: 40% combo_points bloodlust, adrenaline_rush, versatile_navigation, quick_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:01.005 stealth N ambush Fluffy_Pillow 148.5/150: 99% energy | 2.0/5: 40% combo_points bloodlust, vanish, adrenaline_rush, versatile_navigation, quick_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.010 build F sinister_strike Fluffy_Pillow 145.4/150: 97% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, versatile_navigation, quick_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge, battle_potion_of_agility
0:02.814 finish K roll_the_bones Fluffy_Pillow 140.1/150: 93% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, opportunity, versatile_navigation, quick_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:03.618 build E pistol_shot Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, opportunity, broadside, buried_treasure, roll_the_bones, alacrity, versatile_navigation, quick_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:04.423 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity, versatile_navigation, quick_navigation, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:05.228 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(2), versatile_navigation, quick_navigation, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:06.032 build F sinister_strike Fluffy_Pillow 149.1/150: 99% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(2), versatile_navigation, quick_navigation, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:06.836 finish M dispatch Fluffy_Pillow 148.3/150: 99% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, opportunity, broadside, buried_treasure, roll_the_bones, alacrity(2), versatile_navigation, quick_navigation, unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(3), battle_potion_of_agility
0:07.641 build E pistol_shot Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, opportunity, broadside, buried_treasure, roll_the_bones, alacrity(3), versatile_navigation, quick_navigation, unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
0:08.446 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(3), versatile_navigation, quick_navigation, unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(5), battle_potion_of_agility
0:09.248 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(4), versatile_navigation, quick_navigation, elemental_whirl_crit, unstable_flames, archive_of_the_titans(2), resounding_protection, overwhelming_power(24), titanic_overcharge(5), battle_potion_of_agility
0:10.053 build F sinister_strike Fluffy_Pillow 143.2/150: 95% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(4), versatile_navigation, quick_navigation, elemental_whirl_crit, unstable_flames, archive_of_the_titans(3), resounding_protection, overwhelming_power(23), titanic_overcharge(5), battle_potion_of_agility
0:10.856 finish M dispatch Fluffy_Pillow 146.2/150: 97% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(4), versatile_navigation, quick_navigation, elemental_whirl_crit, unstable_flames, archive_of_the_titans(3), resounding_protection, overwhelming_power(23), titanic_overcharge(5), battle_potion_of_agility
0:11.661 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation, elemental_whirl_crit, archive_of_the_titans(3), resounding_protection, overwhelming_power(22), titanic_overcharge(5), battle_potion_of_agility
0:12.466 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation, elemental_whirl_crit, archive_of_the_titans(3), resounding_protection, overwhelming_power(21), titanic_overcharge(5), battle_potion_of_agility
0:13.270 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation, elemental_whirl_crit, archive_of_the_titans(3), resounding_protection, overwhelming_power(20), titanic_overcharge(6), battle_potion_of_agility
0:14.076 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation, elemental_whirl_crit, archive_of_the_titans(3), resounding_protection, overwhelming_power(19), titanic_overcharge(6), battle_potion_of_agility
0:14.880 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, archive_of_the_titans(3), resounding_protection, overwhelming_power(19), titanic_overcharge(6), battle_potion_of_agility
0:15.684 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(4), resounding_protection, overwhelming_power(18), titanic_overcharge(6), battle_potion_of_agility
0:16.489 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(4), resounding_protection, overwhelming_power(17), titanic_overcharge(6), battle_potion_of_agility
0:17.294 finish M dispatch Fluffy_Pillow 143.5/150: 96% energy | 5.0/5: 100% combo_points bloodlust, adrenaline_rush, opportunity, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(4), resounding_protection, overwhelming_power(16), titanic_overcharge(6), battle_potion_of_agility
0:18.099 build E pistol_shot Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, adrenaline_rush, opportunity, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(4), resounding_protection, overwhelming_power(15), titanic_overcharge(6), battle_potion_of_agility
0:18.905 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 4.0/5: 80% combo_points bloodlust, adrenaline_rush, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(2), unstable_flames, archive_of_the_titans(4), resounding_protection, overwhelming_power(15), titanic_overcharge(7), battle_potion_of_agility
0:19.710 build F sinister_strike Fluffy_Pillow 141.8/150: 95% energy | 1.0/5: 20% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(2), unstable_flames, archive_of_the_titans(4), resounding_protection, overwhelming_power(14), titanic_overcharge(7), battle_potion_of_agility
0:20.714 finish M dispatch Fluffy_Pillow 138.1/150: 92% energy | 5.0/5: 100% combo_points bloodlust, opportunity, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), archive_of_the_titans(5), resounding_protection, overwhelming_power(13), titanic_overcharge(7), battle_potion_of_agility
0:21.719 build E pistol_shot Fluffy_Pillow 134.4/150: 90% energy | 1.0/5: 20% combo_points bloodlust, opportunity, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), archive_of_the_titans(5), resounding_protection, overwhelming_power(12), titanic_overcharge(7), battle_potion_of_agility
0:22.723 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 4.0/5: 80% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(11), titanic_overcharge(7), battle_potion_of_agility
0:23.728 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(10), titanic_overcharge(8)
0:24.733 build F sinister_strike Fluffy_Pillow 146.2/150: 97% energy | 3.0/5: 60% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(9), titanic_overcharge(8)
0:25.737 finish M dispatch Fluffy_Pillow 132.5/150: 88% energy | 5.0/5: 100% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), unstable_flames, archive_of_the_titans(6), resounding_protection, overwhelming_power(8), titanic_overcharge(8)
0:26.743 build F sinister_strike Fluffy_Pillow 138.7/150: 92% energy | 1.0/5: 20% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(6), resounding_protection, overwhelming_power(7), titanic_overcharge(8)
0:27.747 finish M dispatch Fluffy_Pillow 134.8/150: 90% energy | 5.0/5: 100% combo_points bloodlust, opportunity, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(6), resounding_protection, overwhelming_power(6), titanic_overcharge(8)
0:28.753 build E pistol_shot Fluffy_Pillow 140.8/150: 94% energy | 1.0/5: 20% combo_points bloodlust, opportunity, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(6), resounding_protection, overwhelming_power(4), titanic_overcharge(8)
0:29.759 finish M dispatch Fluffy_Pillow 150.0/150: 100% energy | 4.0/5: 80% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(6), resounding_protection, overwhelming_power(3), titanic_overcharge(8)
0:30.764 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(7), resounding_protection, overwhelming_power(2), titanic_overcharge(8)
0:31.770 build F sinister_strike Fluffy_Pillow 135.9/150: 91% energy | 3.0/5: 60% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(7), resounding_protection, overwhelming_power, titanic_overcharge(8)
0:32.773 finish M dispatch Fluffy_Pillow 141.7/150: 94% energy | 5.0/5: 100% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(7), resounding_protection, titanic_overcharge(8)
0:33.777 build F sinister_strike Fluffy_Pillow 147.4/150: 98% energy | 1.0/5: 20% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(7), resounding_protection, titanic_overcharge(8)
0:34.779 build F sinister_strike Fluffy_Pillow 143.1/150: 95% energy | 3.0/5: 60% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(7), resounding_protection, titanic_overcharge(8)
0:35.786 finish M dispatch Fluffy_Pillow 149.0/150: 99% energy | 5.0/5: 100% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), unstable_flames, archive_of_the_titans(8), resounding_protection, titanic_overcharge(8)
0:36.790 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), unstable_flames(2), archive_of_the_titans(8), resounding_protection, titanic_overcharge(8)
0:37.795 finish K roll_the_bones Fluffy_Pillow 150.0/150: 100% energy | 5.0/5: 100% combo_points bloodlust, opportunity, broadside, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), unstable_flames(3), archive_of_the_titans(8), resounding_protection, titanic_overcharge(8)
0:38.799 build E pistol_shot Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points bloodlust, opportunity, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), unstable_flames(3), archive_of_the_titans(8), resounding_protection, titanic_overcharge(8)
0:39.804 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points bloodlust, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), unstable_flames(4), archive_of_the_titans(8), resounding_protection, overwhelming_power(24), titanic_overcharge(8)
0:40.809 finish K roll_the_bones Fluffy_Pillow 147.6/150: 98% energy | 5.0/5: 100% combo_points bloodlust, opportunity, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), unstable_flames(5), archive_of_the_titans(9), resounding_protection, overwhelming_power(23), titanic_overcharge(8)
0:41.814 cds J vanish Fluffy_Pillow 145.8/150: 97% energy | 1.0/5: 20% combo_points opportunity, true_bearing, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), unstable_flames(5), archive_of_the_titans(9), resounding_protection, overwhelming_power(22), titanic_overcharge(8)
0:41.814 stealth N ambush Fluffy_Pillow 145.8/150: 97% energy | 1.0/5: 20% combo_points vanish, opportunity, true_bearing, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation(4), unstable_flames(5), archive_of_the_titans(9), resounding_protection, overwhelming_power(22), titanic_overcharge(8)
0:42.820 build E pistol_shot Fluffy_Pillow 128.7/150: 86% energy | 3.0/5: 60% combo_points opportunity, true_bearing, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(5), archive_of_the_titans(9), resounding_protection, overwhelming_power(21), titanic_overcharge(8)
0:43.822 finish K roll_the_bones Fluffy_Pillow 131.4/150: 88% energy | 5.0/5: 100% combo_points true_bearing, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(5), archive_of_the_titans(9), resounding_protection, overwhelming_power(20), titanic_overcharge(8)
0:44.828 build F sinister_strike Fluffy_Pillow 143.1/150: 95% energy | 1.0/5: 20% combo_points buried_treasure, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, unstable_flames(5), archive_of_the_titans(9), resounding_protection, overwhelming_power(19), titanic_overcharge(8)
0:45.833 build F sinister_strike Fluffy_Pillow 124.8/150: 83% energy | 2.0/5: 40% combo_points buried_treasure, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, unstable_flames(5), archive_of_the_titans(10), resounding_protection, overwhelming_power(18), titanic_overcharge(8)
0:46.836 build F sinister_strike Fluffy_Pillow 116.4/150: 78% energy | 3.0/5: 60% combo_points buried_treasure, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, unstable_flames(5), archive_of_the_titans(10), resounding_protection, overwhelming_power(17), titanic_overcharge(8)
0:47.841 build F sinister_strike Fluffy_Pillow 97.8/150: 65% energy | 4.0/5: 80% combo_points buried_treasure, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, unstable_flames(5), archive_of_the_titans(10), resounding_protection, overwhelming_power(16)
0:48.844 finish K roll_the_bones Fluffy_Pillow 78.4/150: 52% energy | 5.0/5: 100% combo_points buried_treasure, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, unstable_flames(5), archive_of_the_titans(10), resounding_protection, overwhelming_power(15)
0:49.850 build F sinister_strike Fluffy_Pillow 85.1/150: 57% energy | 1.0/5: 20% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, archive_of_the_titans(10), resounding_protection, overwhelming_power(14)
0:50.854 cds I killing_spree Fluffy_Pillow 61.6/150: 41% energy | 2.0/5: 40% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(11), resounding_protection, overwhelming_power(13)
0:53.111 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 2.0/5: 40% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), unstable_flames, archive_of_the_titans(11), resounding_protection, overwhelming_power(10), titanic_overcharge
0:54.116 finish M dispatch Fluffy_Pillow 135.0/150: 90% energy | 4.0/5: 80% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), unstable_flames, archive_of_the_titans(11), resounding_protection, overwhelming_power(9), titanic_overcharge(2)
0:55.121 build E pistol_shot Fluffy_Pillow 120.1/150: 80% energy | 0.0/5: 0% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), elemental_whirl_versatility, archive_of_the_titans(12), resounding_protection, overwhelming_power(8), titanic_overcharge(2)
0:56.125 build F sinister_strike Fluffy_Pillow 130.1/150: 87% energy | 2.0/5: 40% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), elemental_whirl_versatility, archive_of_the_titans(12), resounding_protection, overwhelming_power(7), titanic_overcharge(3)
0:57.129 finish M dispatch Fluffy_Pillow 105.1/150: 70% energy | 4.0/5: 80% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), elemental_whirl_versatility, archive_of_the_titans(12), resounding_protection, overwhelming_power(6), titanic_overcharge(3)
0:58.135 build E pistol_shot Fluffy_Pillow 100.1/150: 67% energy | 0.0/5: 0% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_versatility, archive_of_the_titans(12), resounding_protection, overwhelming_power(5), titanic_overcharge(3)
0:59.139 build F sinister_strike Fluffy_Pillow 100.0/150: 67% energy | 2.0/5: 40% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_versatility, archive_of_the_titans(12), resounding_protection, overwhelming_power(4), titanic_overcharge(3)
1:00.143 build F sinister_strike Fluffy_Pillow 74.8/150: 50% energy | 3.0/5: 60% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_versatility, archive_of_the_titans(13), resounding_protection, overwhelming_power(3), titanic_overcharge(3)
1:01.148 build F sinister_strike Fluffy_Pillow 59.7/150: 40% energy | 4.0/5: 80% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(13), resounding_protection, overwhelming_power(2), titanic_overcharge(4)
1:02.153 finish M dispatch Fluffy_Pillow 44.6/150: 30% energy | 5.0/5: 100% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(13), resounding_protection, overwhelming_power, titanic_overcharge(4)
1:03.158 cds H adrenaline_rush Fluffy_Pillow 39.3/150: 26% energy | 1.0/5: 20% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_versatility, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge(4)
1:04.162 cds G potion Fluffy_Pillow 80.9/150: 54% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge(4)
1:04.162 build E pistol_shot Fluffy_Pillow 80.9/150: 54% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
1:04.968 build F sinister_strike Fluffy_Pillow 86.2/150: 57% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
1:05.773 finish M dispatch Fluffy_Pillow 66.4/150: 44% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(14), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
1:06.578 build E pistol_shot Fluffy_Pillow 56.7/150: 38% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(14), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
1:07.384 build F sinister_strike Fluffy_Pillow 82.2/150: 55% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(14), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
1:08.188 build F sinister_strike Fluffy_Pillow 62.6/150: 42% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(14), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
1:08.991 finish M dispatch Fluffy_Pillow 42.9/150: 29% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(14), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
1:09.796 build F sinister_strike Fluffy_Pillow 53.4/150: 36% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(14), resounding_protection, titanic_overcharge(4), battle_potion_of_agility
1:10.603 Waiting     0.100 sec 43.6/150: 29% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, unstable_flames(3), archive_of_the_titans(15), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:10.703 build F sinister_strike Fluffy_Pillow 46.7/150: 31% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, unstable_flames(3), archive_of_the_titans(15), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:11.508 Waiting     0.300 sec 26.8/150: 18% energy | 4.0/5: 80% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, unstable_flames(3), archive_of_the_titans(15), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:11.808 finish M dispatch Fluffy_Pillow 36.1/150: 24% energy | 4.0/5: 80% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, unstable_flames(3), archive_of_the_titans(15), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:12.613 build E pistol_shot Fluffy_Pillow 46.2/150: 31% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, unstable_flames(3), archive_of_the_titans(15), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:13.417 build F sinister_strike Fluffy_Pillow 61.2/150: 41% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation, unstable_flames(4), archive_of_the_titans(15), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:14.223 build F sinister_strike Fluffy_Pillow 61.3/150: 41% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(2), unstable_flames(4), archive_of_the_titans(15), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:15.027 finish M dispatch Fluffy_Pillow 51.5/150: 34% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(2), unstable_flames(5), archive_of_the_titans(16), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:15.831 build E pistol_shot Fluffy_Pillow 51.7/150: 34% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), unstable_flames(5), archive_of_the_titans(16), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:16.634 build F sinister_strike Fluffy_Pillow 56.8/150: 38% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), unstable_flames(5), archive_of_the_titans(16), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:17.439 finish M dispatch Fluffy_Pillow 47.1/150: 31% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), unstable_flames(5), archive_of_the_titans(16), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:18.244 build E pistol_shot Fluffy_Pillow 37.3/150: 25% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), unstable_flames(5), archive_of_the_titans(16), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:19.047 cds J vanish Fluffy_Pillow 62.4/150: 42% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), unstable_flames(5), archive_of_the_titans(16), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:19.047 stealth N ambush Fluffy_Pillow 62.4/150: 42% energy | 3.0/5: 60% combo_points vanish, adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), unstable_flames(5), archive_of_the_titans(16), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:20.052 finish M dispatch Fluffy_Pillow 53.9/150: 36% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:20.857 build F sinister_strike Fluffy_Pillow 54.0/150: 36% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), archive_of_the_titans(17), resounding_protection, battle_potion_of_agility
1:21.661 Waiting     0.100 sec 44.1/150: 29% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), archive_of_the_titans(17), resounding_protection, battle_potion_of_agility
1:21.761 build F sinister_strike Fluffy_Pillow 57.2/150: 38% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), archive_of_the_titans(17), resounding_protection, battle_potion_of_agility
1:22.565 finish M dispatch Fluffy_Pillow 57.3/150: 38% energy | 4.0/5: 80% combo_points adrenaline_rush, opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:23.369 cds I killing_spree Fluffy_Pillow 55.0/150: 37% energy | 1.0/5: 20% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation_final, quick_navigation(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge, battle_potion_of_agility
1:25.643 build E pistol_shot Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(2), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:26.648 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:27.652 build F sinister_strike Fluffy_Pillow 135.0/150: 90% energy | 4.0/5: 80% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:28.658 finish M dispatch Fluffy_Pillow 110.0/150: 73% energy | 5.0/5: 100% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
1:29.662 build F sinister_strike Fluffy_Pillow 105.0/150: 70% energy | 1.0/5: 20% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), unstable_flames, archive_of_the_titans(18), resounding_protection, titanic_overcharge(2)
1:30.666 build E pistol_shot Fluffy_Pillow 100.0/150: 67% energy | 3.0/5: 60% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2)
1:31.671 finish M dispatch Fluffy_Pillow 110.0/150: 73% energy | 5.0/5: 100% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2)
1:32.676 build F sinister_strike Fluffy_Pillow 95.0/150: 63% energy | 1.0/5: 20% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2)
1:33.682 build E pistol_shot Fluffy_Pillow 90.0/150: 60% energy | 3.0/5: 60% combo_points opportunity, grand_melee, true_bearing, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation(4), unstable_flames(2), archive_of_the_titans(19), resounding_protection, titanic_overcharge(2)
1:34.687 finish K roll_the_bones Fluffy_Pillow 100.0/150: 67% energy | 5.0/5: 100% combo_points grand_melee, true_bearing, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation(4), archive_of_the_titans(19), resounding_protection
1:35.693 build F sinister_strike Fluffy_Pillow 104.9/150: 70% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation(4), archive_of_the_titans(20), resounding_protection
1:36.696 build E pistol_shot Fluffy_Pillow 79.6/150: 53% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation(4), archive_of_the_titans(20), resounding_protection
1:37.699 finish M dispatch Fluffy_Pillow 79.4/150: 53% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(20), resounding_protection
1:38.702 build F sinister_strike Fluffy_Pillow 74.3/150: 50% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:39.708 build E pistol_shot Fluffy_Pillow 49.4/150: 33% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:40.712 finish M dispatch Fluffy_Pillow 59.4/150: 40% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:41.717 Waiting     0.100 sec 44.8/150: 30% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:41.817 build F sinister_strike Fluffy_Pillow 46.9/150: 31% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:42.820 Waiting     0.200 sec 42.9/150: 29% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:43.020 build F sinister_strike Fluffy_Pillow 47.1/150: 31% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:44.024 Waiting     0.500 sec 33.1/150: 22% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:44.524 build F sinister_strike Fluffy_Pillow 53.6/150: 36% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:45.530 Waiting     0.300 sec 39.7/150: 26% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:45.830 build F sinister_strike Fluffy_Pillow 46.0/150: 31% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:46.833 Waiting     0.641 sec 22.0/150: 15% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:47.474 finish M dispatch Fluffy_Pillow 45.5/150: 30% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:48.481 Waiting     0.700 sec 31.6/150: 21% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:49.181 build F sinister_strike Fluffy_Pillow 46.3/150: 31% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(4), quick_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:50.185 build E pistol_shot Fluffy_Pillow 32.2/150: 21% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection
1:51.189 Waiting     0.200 sec 32.9/150: 22% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection
1:51.389 finish M dispatch Fluffy_Pillow 37.1/150: 25% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection
1:52.394 Waiting     1.179 sec 21.5/150: 14% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection
1:53.573 build F sinister_strike Fluffy_Pillow 54.2/150: 36% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:54.577 Waiting     0.300 sec 38.6/150: 26% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:54.877 build F sinister_strike Fluffy_Pillow 54.4/150: 36% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:55.882 Waiting     0.400 sec 28.9/150: 19% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:56.282 build F sinister_strike Fluffy_Pillow 46.6/150: 31% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:57.287 Waiting     0.300 sec 31.1/150: 21% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:57.587 build F sinister_strike Fluffy_Pillow 46.9/150: 31% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:58.593 Waiting     0.200 sec 31.6/150: 21% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(2), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:58.793 finish M dispatch Fluffy_Pillow 45.5/150: 30% energy | 5.0/5: 100% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(2), unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:59.797 build E pistol_shot Fluffy_Pillow 40.1/150: 27% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(2), elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:00.802 build F sinister_strike Fluffy_Pillow 49.8/150: 33% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(2), elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:01.808 Waiting     0.100 sec 34.5/150: 23% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:01.908 cds H adrenaline_rush Fluffy_Pillow 46.4/150: 31% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:03.162 build F sinister_strike Fluffy_Pillow 82.8/150: 55% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:03.968 finish M dispatch Fluffy_Pillow 73.0/150: 49% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:04.773 cds J vanish Fluffy_Pillow 63.0/150: 42% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:04.773 stealth N ambush Fluffy_Pillow 63.0/150: 42% energy | 1.0/5: 20% combo_points vanish, adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:05.776 Waiting     0.100 sec 44.3/150: 30% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:05.876 build F sinister_strike Fluffy_Pillow 47.4/150: 32% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:06.682 finish M dispatch Fluffy_Pillow 47.5/150: 32% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:07.486 build E pistol_shot Fluffy_Pillow 47.6/150: 32% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:08.292 build F sinister_strike Fluffy_Pillow 54.7/150: 36% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_crit, elemental_whirl_mastery, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge
2:09.098 finish K roll_the_bones Fluffy_Pillow 36.7/150: 24% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation(2), elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge
2:09.900 build E pistol_shot Fluffy_Pillow 48.7/150: 32% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, broadside, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge
2:10.706 finish K roll_the_bones Fluffy_Pillow 55.8/150: 37% energy | 4.0/5: 80% combo_points adrenaline_rush, broadside, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
2:11.510 cds I killing_spree Fluffy_Pillow 67.8/150: 45% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, roll_the_bones, alacrity(5), frothing_rage(3), quick_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames(5), archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
2:13.634 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points adrenaline_rush, broadside, roll_the_bones, alacrity(5), quick_navigation(4), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
2:14.439 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points adrenaline_rush, broadside, roll_the_bones, alacrity(5), quick_navigation(4), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
2:15.244 finish K roll_the_bones Fluffy_Pillow 131.9/150: 88% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, broadside, roll_the_bones, alacrity(5), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
2:16.049 build E pistol_shot Fluffy_Pillow 136.9/150: 91% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
2:16.852 build F sinister_strike Fluffy_Pillow 146.8/150: 98% energy | 3.0/5: 60% combo_points adrenaline_rush, buried_treasure, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
2:17.657 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 4.0/5: 80% combo_points adrenaline_rush, buried_treasure, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge
2:18.461 finish M dispatch Fluffy_Pillow 134.7/150: 90% energy | 5.0/5: 100% combo_points adrenaline_rush, buried_treasure, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(14)
2:19.264 build F sinister_strike Fluffy_Pillow 139.3/150: 93% energy | 1.0/5: 20% combo_points adrenaline_rush, buried_treasure, true_bearing, roll_the_bones, alacrity(5), quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(13)
2:20.068 build F sinister_strike Fluffy_Pillow 123.9/150: 83% energy | 2.0/5: 40% combo_points adrenaline_rush, buried_treasure, true_bearing, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(12)
2:20.872 finish M dispatch Fluffy_Pillow 128.4/150: 86% energy | 4.0/5: 80% combo_points adrenaline_rush, opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(12)
2:21.677 build E pistol_shot Fluffy_Pillow 122.9/150: 82% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), versatile_navigation, quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(11)
2:22.482 build F sinister_strike Fluffy_Pillow 138.4/150: 92% energy | 3.0/5: 60% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10)
2:23.485 finish M dispatch Fluffy_Pillow 127.7/150: 85% energy | 5.0/5: 100% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9)
2:24.491 build E pistol_shot Fluffy_Pillow 127.2/150: 85% energy | 1.0/5: 20% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
2:25.496 build F sinister_strike Fluffy_Pillow 132.5/150: 88% energy | 3.0/5: 60% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge
2:26.501 build F sinister_strike Fluffy_Pillow 122.8/150: 82% energy | 4.0/5: 80% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge
2:27.505 finish M dispatch Fluffy_Pillow 113.0/150: 75% energy | 5.0/5: 100% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
2:28.510 build F sinister_strike Fluffy_Pillow 113.1/150: 75% energy | 1.0/5: 20% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
2:29.514 build F sinister_strike Fluffy_Pillow 93.2/150: 62% energy | 2.0/5: 40% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge
2:30.518 finish M dispatch Fluffy_Pillow 73.1/150: 49% energy | 4.0/5: 80% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation, quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge
2:31.523 build E pistol_shot Fluffy_Pillow 73.1/150: 49% energy | 1.0/5: 20% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:32.527 build F sinister_strike Fluffy_Pillow 77.9/150: 52% energy | 3.0/5: 60% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:33.530 finish M dispatch Fluffy_Pillow 67.8/150: 45% energy | 5.0/5: 100% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
2:34.534 build E pistol_shot Fluffy_Pillow 69.0/150: 46% energy | 1.0/5: 20% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(24)
2:35.540 build F sinister_strike Fluffy_Pillow 73.8/150: 49% energy | 3.0/5: 60% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(23)
2:36.545 build F sinister_strike Fluffy_Pillow 53.5/150: 36% energy | 4.0/5: 80% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(22)
2:37.549 finish M dispatch Fluffy_Pillow 53.1/150: 35% energy | 5.0/5: 100% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21)
2:38.553 Waiting     0.100 sec 42.6/150: 28% energy | 1.0/5: 20% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20)
2:38.653 build F sinister_strike Fluffy_Pillow 55.1/150: 37% energy | 1.0/5: 20% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20)
2:39.657 Waiting     0.100 sec 44.6/150: 30% energy | 2.0/5: 40% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(19)
2:39.757 build F sinister_strike Fluffy_Pillow 47.0/150: 31% energy | 2.0/5: 40% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(19)
2:40.762 Waiting     0.700 sec 26.5/150: 18% energy | 3.0/5: 60% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
2:41.462 build F sinister_strike Fluffy_Pillow 53.6/150: 36% energy | 3.0/5: 60% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
2:42.465 finish M dispatch Fluffy_Pillow 43.0/150: 29% energy | 5.0/5: 100% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(2)
2:43.471 build E pistol_shot Fluffy_Pillow 32.5/150: 22% energy | 1.0/5: 20% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(2)
2:44.475 build F sinister_strike Fluffy_Pillow 46.9/150: 31% energy | 3.0/5: 60% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(2)
2:45.480 finish M dispatch Fluffy_Pillow 36.4/150: 24% energy | 5.0/5: 100% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(2)
2:46.486 cds I killing_spree Fluffy_Pillow 25.8/150: 17% energy | 1.0/5: 20% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(2)
2:48.826 cds J vanish Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(2)
2:48.826 stealth N ambush Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points vanish, opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(2)
2:49.831 build E pistol_shot Fluffy_Pillow 134.2/150: 89% energy | 3.0/5: 60% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(2)
2:50.836 finish M dispatch Fluffy_Pillow 148.4/150: 99% energy | 5.0/5: 100% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(2)
2:51.841 build F sinister_strike Fluffy_Pillow 137.5/150: 92% energy | 1.0/5: 20% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(3), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(2)
2:52.844 build F sinister_strike Fluffy_Pillow 116.4/150: 78% energy | 2.0/5: 40% combo_points buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(3), quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge
2:53.848 finish M dispatch Fluffy_Pillow 105.2/150: 70% energy | 4.0/5: 80% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(3), quick_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge
2:54.853 cds H adrenaline_rush Fluffy_Pillow 94.2/150: 63% energy | 1.0/5: 20% combo_points opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(3), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge
2:55.858 build E pistol_shot Fluffy_Pillow 130.0/150: 87% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(3), quick_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge
2:56.663 build F sinister_strike Fluffy_Pillow 138.6/150: 92% energy | 3.0/5: 60% combo_points adrenaline_rush, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge
2:57.467 build F sinister_strike Fluffy_Pillow 132.1/150: 88% energy | 4.0/5: 80% combo_points adrenaline_rush, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge
2:58.272 finish M dispatch Fluffy_Pillow 125.6/150: 84% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:59.075 build E pistol_shot Fluffy_Pillow 119.1/150: 79% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:59.880 build F sinister_strike Fluffy_Pillow 127.7/150: 85% energy | 3.0/5: 60% combo_points adrenaline_rush, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:00.686 finish K roll_the_bones Fluffy_Pillow 111.3/150: 74% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, buried_treasure, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:01.491 build E pistol_shot Fluffy_Pillow 111.7/150: 74% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, broadside, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:02.296 finish K roll_the_bones Fluffy_Pillow 127.1/150: 85% energy | 4.0/5: 80% combo_points adrenaline_rush, broadside, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:03.100 build F sinister_strike Fluffy_Pillow 127.5/150: 85% energy | 1.0/5: 20% combo_points adrenaline_rush, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
3:03.905 build F sinister_strike Fluffy_Pillow 117.9/150: 79% energy | 2.0/5: 40% combo_points adrenaline_rush, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
3:04.710 build F sinister_strike Fluffy_Pillow 98.7/150: 66% energy | 3.0/5: 60% combo_points adrenaline_rush, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection
3:05.516 finish M dispatch Fluffy_Pillow 90.3/150: 60% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection
3:06.320 build E pistol_shot Fluffy_Pillow 81.9/150: 55% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection
3:07.123 build F sinister_strike Fluffy_Pillow 98.5/150: 66% energy | 3.0/5: 60% combo_points adrenaline_rush, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection
3:07.927 finish M dispatch Fluffy_Pillow 80.1/150: 53% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection
3:08.731 build E pistol_shot Fluffy_Pillow 71.8/150: 48% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:09.536 build F sinister_strike Fluffy_Pillow 78.7/150: 52% energy | 3.0/5: 60% combo_points adrenaline_rush, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:10.340 build F sinister_strike Fluffy_Pillow 70.8/150: 47% energy | 4.0/5: 80% combo_points adrenaline_rush, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:11.145 finish M dispatch Fluffy_Pillow 62.9/150: 42% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:11.949 build E pistol_shot Fluffy_Pillow 55.0/150: 37% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:12.751 build F sinister_strike Fluffy_Pillow 62.0/150: 41% energy | 3.0/5: 60% combo_points adrenaline_rush, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:13.556 finish M dispatch Fluffy_Pillow 54.2/150: 36% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:14.360 build E pistol_shot Fluffy_Pillow 56.3/150: 38% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:15.163 build F sinister_strike Fluffy_Pillow 68.1/150: 45% energy | 3.0/5: 60% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:16.166 finish M dispatch Fluffy_Pillow 52.9/150: 35% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:17.171 cds I killing_spree Fluffy_Pillow 37.7/150: 25% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
3:19.351 build E pistol_shot Fluffy_Pillow 140.7/150: 94% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:20.357 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 3.0/5: 60% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:21.363 build F sinister_strike Fluffy_Pillow 124.9/150: 83% energy | 4.0/5: 80% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:22.368 finish M dispatch Fluffy_Pillow 119.9/150: 80% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6)
3:23.372 build E pistol_shot Fluffy_Pillow 104.8/150: 70% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:24.375 build F sinister_strike Fluffy_Pillow 104.8/150: 70% energy | 3.0/5: 60% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation, quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:25.379 build F sinister_strike Fluffy_Pillow 79.9/150: 53% energy | 4.0/5: 80% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:26.384 finish M dispatch Fluffy_Pillow 75.1/150: 50% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:27.390 build E pistol_shot Fluffy_Pillow 60.4/150: 40% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(2), quick_navigation(2), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:28.396 build F sinister_strike Fluffy_Pillow 60.6/150: 40% energy | 3.0/5: 60% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:29.400 finish M dispatch Fluffy_Pillow 45.9/150: 31% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:30.404 build E pistol_shot Fluffy_Pillow 31.1/150: 21% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:31.408 Waiting     0.400 sec 31.3/150: 21% energy | 3.0/5: 60% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:31.808 build F sinister_strike Fluffy_Pillow 49.4/150: 33% energy | 3.0/5: 60% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames(5), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:32.812 Waiting     0.600 sec 24.6/150: 16% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7)
3:33.412 finish M dispatch Fluffy_Pillow 36.6/150: 24% energy | 5.0/5: 100% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, archive_of_the_titans(20), resounding_protection
3:34.417 build E pistol_shot Fluffy_Pillow 31.1/150: 21% energy | 1.0/5: 20% combo_points opportunity, skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection
3:35.422 Waiting     0.300 sec 30.8/150: 21% energy | 3.0/5: 60% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:35.722 build F sinister_strike Fluffy_Pillow 46.7/150: 31% energy | 3.0/5: 60% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(2), elemental_whirl_crit, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:36.726 Waiting     0.700 sec 31.3/150: 21% energy | 4.0/5: 80% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:37.426 build F sinister_strike Fluffy_Pillow 45.1/150: 30% energy | 4.0/5: 80% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:38.432 finish K roll_the_bones Fluffy_Pillow 39.9/150: 27% energy | 5.0/5: 100% combo_points skull_and_crossbones, true_bearing, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), elemental_whirl_crit, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:39.437 build F sinister_strike Fluffy_Pillow 54.7/150: 36% energy | 1.0/5: 20% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:40.441 Waiting     0.300 sec 39.5/150: 26% energy | 2.0/5: 40% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:40.741 build F sinister_strike Fluffy_Pillow 45.4/150: 30% energy | 2.0/5: 40% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:41.745 Waiting     0.300 sec 40.1/150: 27% energy | 3.0/5: 60% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:42.045 build F sinister_strike Fluffy_Pillow 46.1/150: 31% energy | 3.0/5: 60% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:43.049 Waiting     0.200 sec 42.5/150: 28% energy | 4.0/5: 80% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge
3:43.249 build F sinister_strike Fluffy_Pillow 46.7/150: 31% energy | 4.0/5: 80% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge
3:44.253 finish L between_the_eyes Fluffy_Pillow 53.0/150: 35% energy | 5.0/5: 100% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge
3:45.256 build F sinister_strike Fluffy_Pillow 59.8/150: 40% energy | 1.0/5: 20% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(2), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(22)
3:46.260 cds H adrenaline_rush Fluffy_Pillow 46.8/150: 31% energy | 3.0/5: 60% combo_points opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(21)
3:47.264 cds J vanish Fluffy_Pillow 82.1/150: 55% energy | 3.0/5: 60% combo_points adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(20)
3:47.264 stealth N ambush Fluffy_Pillow 82.1/150: 55% energy | 3.0/5: 60% combo_points vanish, adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), frothing_rage(3), versatile_navigation(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(20)
3:48.268 finish M dispatch Fluffy_Pillow 87.2/150: 58% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19)
3:49.072 build E pistol_shot Fluffy_Pillow 90.2/150: 60% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18)
3:49.876 build F sinister_strike Fluffy_Pillow 108.2/150: 72% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(18)
3:50.681 build F sinister_strike Fluffy_Pillow 101.2/150: 67% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(17)
3:51.488 finish M dispatch Fluffy_Pillow 84.1/150: 56% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(16)
3:52.293 build F sinister_strike Fluffy_Pillow 77.0/150: 51% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(15)
3:53.098 build F sinister_strike Fluffy_Pillow 69.9/150: 47% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
3:53.900 finish M dispatch Fluffy_Pillow 52.6/150: 35% energy | 4.0/5: 80% combo_points adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), quick_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
3:54.705 build E pistol_shot Fluffy_Pillow 45.3/150: 30% energy | 0.0/5: 0% combo_points adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
3:55.510 build F sinister_strike Fluffy_Pillow 51.2/150: 34% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge
3:56.315 finish L between_the_eyes Fluffy_Pillow 32.0/150: 21% energy | 4.0/5: 80% combo_points adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
3:57.119 build E pistol_shot Fluffy_Pillow 32.7/150: 22% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
3:57.924 Waiting     0.300 sec 38.4/150: 26% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
3:58.224 build F sinister_strike Fluffy_Pillow 47.9/150: 32% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
3:59.029 build F sinister_strike Fluffy_Pillow 48.5/150: 32% energy | 4.0/5: 80% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
3:59.834 finish M dispatch Fluffy_Pillow 39.0/150: 26% energy | 5.0/5: 100% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge
4:00.638 cds I killing_spree Fluffy_Pillow 29.5/150: 20% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(2)
4:02.884 build F sinister_strike Fluffy_Pillow 150.0/150: 100% energy | 1.0/5: 20% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(3)
4:03.688 build F sinister_strike Fluffy_Pillow 130.4/150: 87% energy | 2.0/5: 40% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(3)
4:04.494 build F sinister_strike Fluffy_Pillow 120.9/150: 81% energy | 3.0/5: 60% combo_points adrenaline_rush, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(3)
4:05.299 finish M dispatch Fluffy_Pillow 111.2/150: 74% energy | 5.0/5: 100% combo_points adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(3)
4:06.103 build E pistol_shot Fluffy_Pillow 111.5/150: 74% energy | 1.0/5: 20% combo_points adrenaline_rush, opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(4)
4:06.906 build F sinister_strike Fluffy_Pillow 109.2/150: 73% energy | 3.0/5: 60% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(4)
4:07.910 build F sinister_strike Fluffy_Pillow 83.9/150: 56% energy | 4.0/5: 80% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:08.914 finish M dispatch Fluffy_Pillow 58.6/150: 39% energy | 5.0/5: 100% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:09.919 Waiting     0.100 sec 43.3/150: 29% energy | 1.0/5: 20% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:10.019 build F sinister_strike Fluffy_Pillow 45.3/150: 30% energy | 1.0/5: 20% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:11.024 Waiting     1.147 sec 20.1/150: 13% energy | 2.0/5: 40% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:12.171 build F sinister_strike Fluffy_Pillow 52.8/150: 35% energy | 2.0/5: 40% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), quick_navigation, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:13.177 Waiting     0.900 sec 27.6/150: 18% energy | 3.0/5: 60% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:14.077 build F sinister_strike Fluffy_Pillow 55.5/150: 37% energy | 3.0/5: 60% combo_points grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:15.080 finish K roll_the_bones Fluffy_Pillow 60.4/150: 40% energy | 5.0/5: 100% combo_points opportunity, grand_melee, ruthless_precision, roll_the_bones, alacrity(5), versatile_navigation(4), quick_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:16.085 build E pistol_shot Fluffy_Pillow 69.3/150: 46% energy | 1.0/5: 20% combo_points opportunity, buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(4), quick_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:17.090 build F sinister_strike Fluffy_Pillow 73.3/150: 49% energy | 3.0/5: 60% combo_points buried_treasure, roll_the_bones, alacrity(5), versatile_navigation(4), quick_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:18.094 build F sinister_strike Fluffy_Pillow 62.3/150: 42% energy | 4.0/5: 80% combo_points buried_treasure, roll_the_bones, alacrity(5), versatile_navigation_final, quick_navigation(2), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:19.099 finish K roll_the_bones Fluffy_Pillow 61.5/150: 41% energy | 5.0/5: 100% combo_points buried_treasure, roll_the_bones, alacrity(5), versatile_navigation_final, quick_navigation(3), elemental_whirl_versatility, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:20.105 build F sinister_strike Fluffy_Pillow 56.7/150: 38% energy | 1.0/5: 20% combo_points skull_and_crossbones, roll_the_bones, alacrity(5), versatile_navigation_final, quick_navigation(3), elemental_whirl_versatility, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:21.108 build E pistol_shot Fluffy_Pillow 41.9/150: 28% energy | 3.0/5: 60% combo_points opportunity, skull_and_crossbones, roll_the_bones, alacrity(5), versatile_navigation_final, quick_navigation(3), elemental_whirl_versatility, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:22.113 finish K roll_the_bones Fluffy_Pillow 42.2/150: 28% energy | 5.0/5: 100% combo_points skull_and_crossbones, roll_the_bones, alacrity(5), versatile_navigation_final, quick_navigation(4), elemental_whirl_versatility, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:23.119 Waiting     0.400 sec 37.5/150: 25% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation_final, quick_navigation(4), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:23.519 build F sinister_strike Fluffy_Pillow 45.5/150: 30% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation_final, quick_navigation(4), elemental_whirl_versatility, elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection
4:24.524 Waiting     0.700 sec 30.3/150: 20% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), versatile_navigation_final, quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection
4:25.224 build F sinister_strike Fluffy_Pillow 54.1/150: 36% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection
4:26.230 finish M dispatch Fluffy_Pillow 59.0/150: 39% energy | 4.0/5: 80% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation_final, quick_navigation(4), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection
4:27.233 build E pistol_shot Fluffy_Pillow 53.8/150: 36% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), archive_of_the_titans(20), resounding_protection
4:28.236 build F sinister_strike Fluffy_Pillow 53.5/150: 36% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), archive_of_the_titans(20), resounding_protection
4:29.241 Waiting     0.400 sec 38.3/150: 26% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), archive_of_the_titans(20), resounding_protection
4:29.641 build F sinister_strike Fluffy_Pillow 46.2/150: 31% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), archive_of_the_titans(20), resounding_protection
4:30.645 finish M dispatch Fluffy_Pillow 52.5/150: 35% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(24)
4:31.649 build F sinister_strike Fluffy_Pillow 48.7/150: 32% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(23)
4:32.653 Waiting     0.500 sec 34.8/150: 23% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
4:33.153 build F sinister_strike Fluffy_Pillow 45.4/150: 30% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
4:34.156 Waiting     0.700 sec 31.5/150: 21% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
4:34.856 build F sinister_strike Fluffy_Pillow 46.2/150: 31% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
4:35.859 Waiting     0.200 sec 42.3/150: 28% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
4:36.059 build F sinister_strike Fluffy_Pillow 46.4/150: 31% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
4:37.064 finish M dispatch Fluffy_Pillow 42.4/150: 28% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
4:38.068 Waiting     0.900 sec 28.4/150: 19% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
4:38.968 build F sinister_strike Fluffy_Pillow 47.1/150: 31% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
4:39.974 build E pistol_shot Fluffy_Pillow 22.9/150: 15% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge
4:40.978 finish M dispatch Fluffy_Pillow 43.6/150: 29% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage, versatile_navigation(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge
4:41.982 Waiting     0.300 sec 39.3/150: 26% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge
4:42.282 build F sinister_strike Fluffy_Pillow 45.5/150: 30% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge
4:43.286 Waiting     0.700 sec 31.2/150: 21% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(2)
4:43.986 build F sinister_strike Fluffy_Pillow 55.6/150: 37% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(2)
4:44.991 Waiting     0.200 sec 41.2/150: 27% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(2)
4:45.191 build F sinister_strike Fluffy_Pillow 55.3/150: 37% energy | 3.0/5: 60% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(2)
4:46.196 Waiting     0.300 sec 30.8/150: 21% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(2)
4:46.496 build F sinister_strike Fluffy_Pillow 47.0/150: 31% energy | 4.0/5: 80% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(2)
4:47.501 Waiting     0.100 sec 23.5/150: 16% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(3)
4:47.601 finish M dispatch Fluffy_Pillow 35.7/150: 24% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(3)
4:48.605 Waiting     0.635 sec 22.1/150: 15% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(3)
4:49.240 build F sinister_strike Fluffy_Pillow 45.6/150: 30% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(3)
4:50.246 build E pistol_shot Fluffy_Pillow 32.1/150: 21% energy | 3.0/5: 60% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(5)
4:51.250 finish M dispatch Fluffy_Pillow 43.6/150: 29% energy | 5.0/5: 100% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(5)
4:52.257 build F sinister_strike Fluffy_Pillow 50.1/150: 33% energy | 1.0/5: 20% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(5)
4:53.262 Waiting     0.500 sec 36.5/150: 24% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(5)
4:53.762 build F sinister_strike Fluffy_Pillow 47.1/150: 31% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(5)
4:54.768 Waiting     0.600 sec 23.4/150: 16% energy | 4.0/5: 80% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:55.368 finish M dispatch Fluffy_Pillow 36.1/150: 24% energy | 4.0/5: 80% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:56.373 build E pistol_shot Fluffy_Pillow 32.4/150: 22% energy | 0.0/5: 0% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:57.378 Waiting     0.200 sec 42.2/150: 28% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:57.578 build F sinister_strike Fluffy_Pillow 46.1/150: 31% energy | 2.0/5: 40% combo_points grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:58.582 Waiting     0.300 sec 30.9/150: 21% energy | 4.0/5: 80% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:58.882 finish M dispatch Fluffy_Pillow 46.8/150: 31% energy | 4.0/5: 80% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(5)
4:59.887 cds I killing_spree Fluffy_Pillow 41.7/150: 28% energy | 1.0/5: 20% combo_points opportunity, grand_melee, roll_the_bones, alacrity(5), frothing_rage(2), versatile_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection

Stats

Level Bonus (120) Race Bonus (dwarf) Raid-Buffed Unbuffed Gear Amount
Strength 1467 2 1529 1469 0
Agility 1467 -2 6562 6144 4387 (3433)
Stamina 1001 1 9027 8207 7205
Intellect 1467 -1 1678 1466 0
Spirit 0 0 0 0 0
Health 180540 164140 0
Energy 150 150 0
Combo Points 5 5 0
Crit 20.72% 20.72% 772
Haste 17.75% 17.75% 1207
Damage / Heal Versatility 3.56% 3.56% 303
Attack Power 7218 6144 0
Mastery 23.40% 23.40% 720
Armor 1897 1897 1897
Run Speed 9 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Hood of Pestilent Ichor
ilevel: 390, stats: { 260 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Unstable Flames, Resounding Protection, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Usurper's Bloodcaked Spaulders
ilevel: 390, stats: { 240 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Vampiric Speed, Azerite Empowered }
Local Chest Jerkin of the Aberrant Chimera
ilevel: 390, stats: { 320 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Resounding Protection, Azerite Empowered }
Local Waist Replicated Chitin Cord
ilevel: 385, stats: { 174 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Legs Pathogenic Legwraps
ilevel: 385, stats: { 271 Armor, +329 AgiInt, +556 Sta, +154 Haste, +91 Mastery }
Local Feet Quarantine Protocol Treads
ilevel: 385, stats: { 213 Armor, +247 AgiInt, +417 Sta, +104 Haste, +80 Vers }
Local Wrists Wristwraps of Coursing Miasma
ilevel: 385, stats: { 135 Armor, +185 AgiInt, +312 Sta, +83 Crit, +54 Haste }
Local Hands Gloves of Descending Madness
ilevel: 385, stats: { 193 Armor, +247 AgiInt, +417 Sta, +115 Haste, +68 Crit }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Lancet of the Deft Hand
ilevel: 385, weapon: { 400 - 571, 2.6 }, stats: { +164 Agi, +277 Sta, +68 Mastery, +54 Vers }, enchant: versatile_navigation
Local Off Hand Lancet of the Deft Hand
ilevel: 385, weapon: { 400 - 571, 2.6 }, stats: { +164 Agi, +277 Sta, +68 Mastery, +54 Vers }, enchant: quick_navigation

Talents

Level
15 Weaponmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue) Ghostly Strike (Outlaw Rogue)
30 Acrobatic Strikes (Outlaw Rogue) Retractable Hook (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Vigor Deeper Stratagem Marked for Death
60 Iron Stomach (Outlaw Rogue) Cheat Death Elusiveness
75 Dirty Tricks (Outlaw Rogue) Blinding Powder (Outlaw Rogue) Prey on the Weak
90 Loaded Dice (Outlaw Rogue) Alacrity (Outlaw Rogue) Slice and Dice (Outlaw Rogue)
100 Dancing Steel (Outlaw Rogue) Blade Rush (Outlaw Rogue) Killing Spree (Outlaw Rogue)

Profile

rogue="T22_Rogue_Outlaw"
spec=outlaw
level=120
race=dwarf
role=attack
position=back
talents=2310023

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion
actions.precombat+=/marked_for_death,precombat_seconds=5,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,precombat_seconds=2
actions.precombat+=/slice_and_dice,precombat_seconds=2
actions.precombat+=/adrenaline_rush,precombat_seconds=1

# Executed every time the actor is available.
# Reroll for 2+ buffs with Loaded Dice up. Otherwise reroll for 2+ or Grand Melee or Ruthless Precision.
actions=variable,name=rtb_reroll,value=rtb_buffs<2&(buff.loaded_dice.up|!buff.grand_melee.up&!buff.ruthless_precision.up)
actions+=/variable,name=ambush_condition,value=combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&cooldown.ghostly_strike.remains<1)+buff.broadside.up&energy>60&!buff.skull_and_crossbones.up
# With multiple targets, this variable is checked to decide whether some CDs should be synced with Blade Flurry
actions+=/variable,name=blade_flurry_sync,value=spell_targets.blade_flurry<2&raid_event.adds.in>20|buff.blade_flurry.up
actions+=/call_action_list,name=stealth,if=stealthed.all
actions+=/call_action_list,name=cds
# Finish at maximum CP. Substract one for each Broadside and Opportunity when Quick Draw is selected and MfD is not ready after the next second.
actions+=/call_action_list,name=finish,if=combo_points>=cp_max_spend-(buff.broadside.up+buff.opportunity.up)*(talent.quick_draw.enabled&(!talent.marked_for_death.enabled|cooldown.marked_for_death.remains>1))
actions+=/call_action_list,name=build
actions+=/arcane_torrent,if=energy.deficit>=15+energy.regen
actions+=/arcane_pulse
actions+=/lights_judgment

actions.build=pistol_shot,if=combo_points.deficit>=1+buff.broadside.up+talent.quick_draw.enabled&buff.opportunity.up
actions.build+=/sinister_strike

actions.cds=potion,if=buff.bloodlust.react|target.time_to_die<=60|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/fireblood
actions.cds+=/ancestral_call
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.time_to_max>1
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15-buff.adrenaline_rush.up*5)&!stealthed.rogue&combo_points.deficit>=cp_max_spend-1)
# Blade Flurry on 2+ enemies. With adds: Use if they stay for 8+ seconds or if your next charge will be ready in time for the next wave.
actions.cds+=/blade_flurry,if=spell_targets>=2&!buff.blade_flurry.up&(!raid_event.adds.exists|raid_event.adds.remains>8|cooldown.blade_flurry.charges=1&raid_event.adds.in>(2-cooldown.blade_flurry.charges_fractional)*25)
actions.cds+=/ghostly_strike,if=variable.blade_flurry_sync&combo_points.deficit>=1+buff.broadside.up
actions.cds+=/killing_spree,if=variable.blade_flurry_sync&(energy.time_to_max>5|energy<15)
actions.cds+=/blade_rush,if=variable.blade_flurry_sync&energy.time_to_max>1
# Using Vanish/Ambush is only a very tiny increase, so in reality, you're absolutely fine to use it as a utility spell.
actions.cds+=/vanish,if=!stealthed.all&variable.ambush_condition
actions.cds+=/shadowmeld,if=!stealthed.all&variable.ambush_condition

actions.finish=slice_and_dice,if=buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions.finish+=/roll_the_bones,if=(buff.roll_the_bones.remains<=3|variable.rtb_reroll)&(target.time_to_die>20|buff.roll_the_bones.remains<target.time_to_die)
# BTE with the Ruthless Precision buff from RtB or with the Ace Up Your Sleeve or Deadshot traits.
actions.finish+=/between_the_eyes,if=buff.ruthless_precision.up|azerite.ace_up_your_sleeve.enabled|azerite.deadshot.enabled
actions.finish+=/dispatch

actions.stealth=ambush

head=hood_of_pestilent_ichor,id=160623,bonus_id=4824/1507/4775,azerite_powers=4/483/459/15/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=usurpers_bloodcaked_spaulders,id=160620,bonus_id=4824/1507/4775,azerite_powers=4/483/30/44/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=jerkin_of_the_aberrant_chimera,id=160619,bonus_id=4824/1507/4775,azerite_powers=4/483/21/15/13
wrists=wristwraps_of_coursing_miasma,id=160621,bonus_id=4800/1507
hands=gloves_of_descending_madness,id=160618,bonus_id=4800/1507
waist=replicated_chitin_cord,id=160717,bonus_id=4800/1507
legs=pathogenic_legwraps,id=160625,bonus_id=4800/1507
feet=quarantine_protocol_treads,id=160624,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=lancet_of_the_deft_hand,id=160693,bonus_id=4800/1507,enchant=versatile_navigation
off_hand=lancet_of_the_deft_hand,id=160693,bonus_id=4800/1507,enchant=quick_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=772
# gear_haste_rating=1207
# gear_mastery_rating=720
# gear_versatility_rating=303
# gear_armor=1897

T22_Rogue_Subtlety : 16607 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16606.8 16606.8 10.2 / 0.062% 1779.1 / 10.7% 652.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
25.4 25.2 Energy 19.29% 57.2 100.0% 100%
Talents
  • 15: Find Weakness (Subtlety Rogue)
  • 30: Shadow Focus (Subtlety Rogue)
  • 45: Marked for Death
  • 90: Enveloping Shadows (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Rogue_Subtlety 16607
auto_attack_mh 1767 10.6% 210.1 1.43sec 2521 1780 Direct 210.1 2391 4783 2521 24.5% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 210.14 210.14 0.00 0.00 1.4161 0.0000 529695.95 682728.88 22.41 1780.07 1780.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 118.75 56.51% 2390.53 1908 3057 2390.80 2323 2460 283876 365881 22.41
crit 51.40 24.46% 4782.60 3817 6113 4783.03 4553 5039 245820 316848 22.41
miss 39.99 19.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
auto_attack_oh 877 5.3% 208.5 1.44sec 1261 883 Direct 208.5 1196 2392 1261 24.5% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 208.48 208.48 0.00 0.00 1.4281 0.0000 262928.51 338933.85 22.42 883.09 883.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 117.92 56.56% 1195.54 954 1528 1195.71 1162 1232 140979 181746 22.43
crit 50.98 24.45% 2392.01 1908 3057 2392.32 2288 2526 121950 157188 22.41
miss 39.58 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Backstab 1548 9.3% 67.4 4.19sec 6891 6860 Direct 67.4 5538 11075 6891 24.4% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.42 67.42 0.00 0.00 1.0045 0.0000 464562.37 608240.54 23.62 6860.05 6860.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.95 75.57% 5538.24 4146 7478 5539.06 5330 5884 282153 369364 23.60
crit 16.47 24.43% 11074.94 8292 14957 11076.81 10076 12344 182409 238876 23.63
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${{$s2=0}*$<mult>} Physical damage. Damage increased by {$s4=20}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Eviscerate 6397 38.5% 60.8 4.92sec 31493 31352 Direct 60.8 25329 50683 31493 24.3% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.84 60.84 0.00 0.00 1.0045 0.0000 1915943.28 2452097.25 21.87 31351.86 31351.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.05 75.69% 25328.67 12612 37746 25329.96 23796 27159 1166290 1492635 21.86
crit 14.79 24.31% 50682.72 22427 75493 50695.56 42816 59717 749653 959462 21.87
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Frenetic Blow (frentic_blow) 270 1.6% 3.2 77.46sec 25006 0 Direct 3.2 20091 40186 25008 24.5% 0.0%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.24 3.24 0.00 0.00 0.0000 0.0000 80997.15 115795.15 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.45 75.54% 20091.21 20037 20655 19467.40 0 20655 49160 70281 29.12
crit 0.79 24.46% 40185.76 40074 41309 23293.76 0 41309 31837 45514 17.42
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Nightblade 2115 12.7% 19.8 15.06sec 32011 31867 Periodic 184.2 2768 5534 3443 24.4% 0.0% 96.7%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.81 0.00 184.18 184.18 1.0045 1.5748 634128.33 634128.33 0.00 2045.98 31867.35
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.2 75.60% 2768.26 1 3945 2768.42 2658 2873 385464 385464 0.00
crit 44.9 24.40% 5533.70 6 7889 5533.94 4967 5867 248664 248664 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>6&remains<gcd.max&combo_points>=4-(time<10)*2
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec. Healing effects reduced by {$s7=15}%. Taking {$s6=15}% increased damage from the Rogue.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and reduces the effectiveness of healing on the target by {$s7=15}%. Lasts longer per combo point. 1 point : ${$<damage>*8/6} over 8 sec 2 points: ${$<damage>*10/6} over 10 sec 3 points: ${$<damage>*12/6} over 12 sec 4 points: ${$<damage>*14/6} over 14 sec 5 points: ${$<damage>*16/6} over 16 sec{$?s193531=false}[ 6 points: ${$<damage>*18/6} over 18 sec][] You deal {$s6=15}% increased damage to enemies afflicted by your Nightblade.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.126126
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Shadow Blades 0 (401) 0.0% (2.4%) 2.0 180.08sec 59285 118067

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.5026 0.0000 0.00 0.00 0.00 118066.60 118066.60
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Combo point generating abilities generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow.
  • description:Draws upon surrounding shadows to empower your weapons, causing your combo point generating abilities to generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow for {$d=20 seconds}.
 
    Shadow Blades (_attack) 401 2.4% 22.5 9.60sec 5280 0 Direct 22.5 5280 0 5280 0.0% 0.0%  

Stats details: shadow_blades_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.47 22.47 0.00 0.00 0.0000 0.0000 118656.93 118656.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.47 100.00% 5280.11 2170 11651 5279.03 4052 7174 118657 118657 0.00
 
 

Action details: shadow_blades_attack

Static Values
  • id:279043
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279043
  • name:Shadow Blades
  • school:shadow
  • tooltip:
  • description:{$@spelldesc121471=Draws upon surrounding shadows to empower your weapons, causing your combo point generating abilities to generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow for {$d=20 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3154.29
  • base_dd_max:3154.29
 
Shadowstrike 3232 19.5% 88.4 3.42sec 10958 10909 Direct 88.4 8818 17636 10958 24.3% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.37 88.37 0.00 0.00 1.0045 0.0000 968327.05 1234108.20 21.54 10908.88 10908.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.92 75.73% 8818.12 6149 12847 8818.01 8490 9059 590145 752138 21.54
crit 21.44 24.27% 17635.67 12298 23819 17635.07 16277 19030 378183 481970 21.53
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stealth.up
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike the target, dealing {$s1=0} Physical damage.$?a231718[ While Stealthed, you strike through the shadows and appear behind your target up to ${5+{$245623s1=20}} yds away, dealing {$245623s2=25}% additional damage.][] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
T22_Rogue_Subtlety
Arcane Torrent 3.4 91.05sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.35 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:25046
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy.deficit>=15+energy.regen
Spelldata
  • id:25046
  • name:Arcane Torrent
  • school:arcane
  • tooltip:
  • description:Remove {$s1=1} beneficial effect from all enemies within $A1 yards and restore $m2 Energy.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Subtlety
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Subtlety
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Rogue_Subtlety
  • harmful:false
  • if_expr:
 
Marked for Death 9.8 34.32sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=5} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 22.7 13.48sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadow_dance.up&target.time_to_die<=5+talent.subterfuge.enabled
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=5 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=20}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
 
Symbols of Death 10.3 30.27sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.28 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.nightblade.ticking
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:Damage done increased by {$s1=15}%.
  • description:Invoke ancient symbols of power, generating {$s5=40} Energy and increasing your damage done by {$s1=15}% for {$d=10 seconds}.
 
Vanish 2.3 129.75sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!variable.shd_threshold&debuff.find_weakness.remains<1
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:36.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=6}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Agility 2.0 0.0 199.2sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_crit) 2.6 0.2 74.7sec 65.5sec 9.05% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_crit
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_crit_1:9.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268953
  • name:Elemental Whirl
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_haste) 2.7 0.2 73.8sec 65.2sec 9.05% 0.00% 0.2(0.2) 2.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_haste_1:9.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268954
  • name:Elemental Whirl
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_mastery) 2.6 0.2 74.8sec 65.3sec 9.00% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_mastery_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268955
  • name:Elemental Whirl
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Whirl (_versatility) 2.6 0.2 74.4sec 65.5sec 8.98% 0.00% 0.2(0.2) 2.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_elemental_whirl_versatility
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:264.00

Stack Uptimes

  • elemental_whirl_versatility_1:8.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268956
  • name:Elemental Whirl
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc263984=Your damaging abilities have a chance to grant you Elemental Whirl, increasing your Critical Strike, Haste, Mastery, or Versatility by {$s1=0} for {$268956d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 4.8 11.2 65.7sec 18.4sec 75.51% 0.00% 0.0(0.0) 0.8

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:28.32%
  • frothing_rage_2:24.91%
  • frothing_rage_3:22.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Master of Shadows 24.9 0.1 12.3sec 12.2sec 24.88% 0.00% 149.1(149.1) 24.6

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_master_of_shadows
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Stack Uptimes

  • master_of_shadows_1:24.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196980
  • name:Master of Shadows
  • tooltip:Regenerating ${{$s1=4}*{$d=3 seconds}/$t1+{$s2=1}} Energy over {$d=3 seconds}.
  • description:{$@spelldesc196976=Gain ${{$196980s1=4}*{$196980d=3 seconds}/$196980t1+{$196980s2=1}} Energy over {$196980d=3 seconds} when you enter Stealth or activate Shadow Dance.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Masterful Navigation 6.2 23.1 52.2sec 10.4sec 68.96% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_masterful_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:50.00

Stack Uptimes

  • masterful_navigation_1:17.98%
  • masterful_navigation_2:17.46%
  • masterful_navigation_3:17.04%
  • masterful_navigation_4:16.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268899
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Masterful Navigation (_final) 5.5 0.0 52.3sec 52.3sec 18.04% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_masterful_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:mastery_rating
  • amount:600.00

Stack Uptimes

  • masterful_navigation_final_1:18.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268898
  • name:Masterful Navigation
  • tooltip:Increases Mastery by $w1.
  • description:{$@spelldesc268901=Permanently enchant a weapon to sometimes increase Mastery by $268899s for {$268899d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268898s Mastery for {$268898d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.7 0.0 61.1sec 38.9sec 36.58% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.43%
  • overwhelming_power_2:1.43%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.44%
  • overwhelming_power_5:1.45%
  • overwhelming_power_6:1.45%
  • overwhelming_power_7:1.46%
  • overwhelming_power_8:1.46%
  • overwhelming_power_9:1.47%
  • overwhelming_power_10:1.47%
  • overwhelming_power_11:1.48%
  • overwhelming_power_12:1.48%
  • overwhelming_power_13:1.49%
  • overwhelming_power_14:1.49%
  • overwhelming_power_15:1.50%
  • overwhelming_power_16:1.50%
  • overwhelming_power_17:1.51%
  • overwhelming_power_18:1.51%
  • overwhelming_power_19:1.52%
  • overwhelming_power_20:1.52%
  • overwhelming_power_21:1.53%
  • overwhelming_power_22:1.53%
  • overwhelming_power_23:1.54%
  • overwhelming_power_24:1.56%
  • overwhelming_power_25:0.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.1sec 10.4sec 68.96% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.04%
  • quick_navigation_2:17.52%
  • quick_navigation_3:16.94%
  • quick_navigation_4:16.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.05% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Resounding Protection 10.5 0.0 30.0sec 30.0sec 100.00% 0.00% 0.0(0.0) 9.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_resounding_protection
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:26880.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • resounding_protection_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:269279
  • name:Resounding Protection
  • tooltip:Absorbs $w1 damage.
  • description:{$@spelldesc263962=Every $270568t1 sec, gain an absorb shield for {$s1=6411} for {$269279d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Shadow Blades 2.0 0.0 179.7sec 180.1sec 13.18% 14.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shadow_blades_1:13.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Combo point generating abilities generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow.
  • description:Draws upon surrounding shadows to empower your weapons, causing your combo point generating abilities to generate {$s2=1} additional combo point and deal {$s1=50}% additional damage as Shadow for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:101.00%
Shadow Dance 22.7 0.0 13.5sec 13.5sec 37.57% 41.46% 0.0(0.0) 22.1

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • shadow_dance_1:37.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=5 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=20}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for {$31223s1=5} sec after deal {$31665s1=10}% more damage. ][]
  • max_stacks:0
  • duration:5.00
  • cooldown:1.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 1.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=20}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for {$31223s1=5} sec after deal {$31665s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Symbols of Death 10.3 0.0 30.3sec 30.3sec 33.88% 36.70% 0.0(0.0) 10.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • symbols_of_death_1:33.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:Damage done increased by {$s1=15}%.
  • description:Invoke ancient symbols of power, generating {$s5=40} Energy and increasing your damage done by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Titanic Overcharge 12.3 33.4 25.0sec 6.6sec 85.09% 0.00% 3.7(3.7) 11.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:40.51

Stack Uptimes

  • titanic_overcharge_1:22.96%
  • titanic_overcharge_2:16.69%
  • titanic_overcharge_3:12.28%
  • titanic_overcharge_4:8.97%
  • titanic_overcharge_5:6.59%
  • titanic_overcharge_6:4.75%
  • titanic_overcharge_7:3.48%
  • titanic_overcharge_8:9.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=36} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Unstable Flames 26.0 27.7 11.7sec 5.6sec 66.79% 0.00% 1.9(1.9) 25.3

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_unstable_flames
  • max_stacks:5
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:70.00

Stack Uptimes

  • unstable_flames_1:32.27%
  • unstable_flames_2:16.76%
  • unstable_flames_3:8.61%
  • unstable_flames_4:4.41%
  • unstable_flames_5:4.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279902
  • name:Unstable Flames
  • tooltip:Critical strike increased by $w1.
  • description:{$@spelldesc279899=Your damaging abilities have a chance to grant {$s1=0} critical strike rating for {$279902d=5 seconds}. This effect stacks up to {$279902u=5} times.}
  • max_stacks:5
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 2.3 0.0 129.8sec 129.8sec 0.01% 2.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vanish_1:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:{$@spelldesc1856=Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
T22_Rogue_Subtlety
backstab Energy 67.4 2359.6 35.0 35.0 196.9
eviscerate Energy 60.8 1959.6 32.2 32.2 977.7
eviscerate Combo Points 60.8 284.1 4.7 4.7 6743.1
nightblade Energy 19.8 480.3 24.2 24.2 1320.2
nightblade Combo Points 19.8 90.9 4.6 4.6 6974.7
shadowstrike Energy 88.4 2827.8 32.0 32.0 342.4
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 9.79 48.80 (12.93%) 4.98 0.16 0.33%
arcane_torrent Energy 3.35 50.29 (0.67%) 15.00 0.00 0.00%
backstab Combo Points 67.42 67.42 (17.86%) 1.00 0.00 0.00%
symbols_of_death Energy 10.28 363.77 (4.81%) 35.40 47.32 11.51%
shadowstrike Combo Points 88.37 174.74 (46.30%) 1.98 2.00 1.13%
energy_regen Energy 1130.72 3696.12 (48.90%) 3.27 49.94 1.33%
Shadow Techniques Energy 74.95 598.60 (7.92%) 7.99 1.04 0.17%
Shadow Techniques Combo Points 74.95 69.96 (18.54%) 0.93 5.00 6.67%
Master of Shadows Energy 173.94 600.24 (7.94%) 3.45 20.51 3.30%
Shadow Blades Combo Points 22.47 16.46 (4.36%) 0.73 6.01 26.74%
Relentless Strikes Energy 80.65 2250.19 (29.77%) 27.90 0.11 0.00%
Resource RPS-Gain RPS-Loss
Energy 25.20 25.42
Combo Points 1.26 1.25
Combat End Resource Mean Min Max
Energy 32.22 0.00 100.00
Combo Points 2.31 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.6%

Statistics & Data Analysis

Fight Length
Sample Data T22_Rogue_Subtlety Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Rogue_Subtlety Damage Per Second
Count 7499
Mean 16606.75
Minimum 15160.48
Maximum 18562.62
Spread ( max - min ) 3402.13
Range [ ( max - min ) / 2 * 100% ] 10.24%
Standard Deviation 452.0497
5th Percentile 15886.91
95th Percentile 17373.03
( 95th Percentile - 5th Percentile ) 1486.12
Mean Distribution
Standard Deviation 5.2202
95.00% Confidence Intervall ( 16596.52 - 16616.98 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2847
0.1 Scale Factor Error with Delta=300 1745
0.05 Scale Factor Error with Delta=300 6978
0.01 Scale Factor Error with Delta=300 174445
Priority Target DPS
Sample Data T22_Rogue_Subtlety Priority Target Damage Per Second
Count 7499
Mean 16606.75
Minimum 15160.48
Maximum 18562.62
Spread ( max - min ) 3402.13
Range [ ( max - min ) / 2 * 100% ] 10.24%
Standard Deviation 452.0497
5th Percentile 15886.91
95th Percentile 17373.03
( 95th Percentile - 5th Percentile ) 1486.12
Mean Distribution
Standard Deviation 5.2202
95.00% Confidence Intervall ( 16596.52 - 16616.98 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2847
0.1 Scale Factor Error with Delta=300 1745
0.05 Scale Factor Error with Delta=300 6978
0.01 Scale Factor Error with Delta=300 174445
DPS(e)
Sample Data T22_Rogue_Subtlety Damage Per Second (Effective)
Count 7499
Mean 16606.75
Minimum 15160.48
Maximum 18562.62
Spread ( max - min ) 3402.13
Range [ ( max - min ) / 2 * 100% ] 10.24%
Damage
Sample Data T22_Rogue_Subtlety Damage
Count 7499
Mean 4975239.57
Minimum 3800440.61
Maximum 6201724.50
Spread ( max - min ) 2401283.89
Range [ ( max - min ) / 2 * 100% ] 24.13%
DTPS
Sample Data T22_Rogue_Subtlety Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Rogue_Subtlety Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Rogue_Subtlety Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Rogue_Subtlety Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Rogue_Subtlety Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Rogue_Subtlety Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Rogue_SubtletyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Rogue_Subtlety Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 augmentation
2 0.00 food
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=stealth_threshold,value=60+talent.vigor.enabled*35+talent.master_of_shadows.enabled*10
Used to define when to use stealth CDs or builders
5 0.00 stealth
6 0.00 marked_for_death,precombat_seconds=15
7 0.00 shadow_blades,precombat_seconds=1
8 0.00 potion
Default action list Executed every time the actor is available.
# count action,conditions
9 0.00 call_action_list,name=cds
Check CDs at first
A 0.00 run_action_list,name=stealthed,if=stealthed.all
Run fully switches to the Stealthed Rotation (by doing so, it forces pooling if nothing is available).
B 6.63 nightblade,if=target.time_to_die>6&remains<gcd.max&combo_points>=4-(time<10)*2
Apply Nightblade at 2+ CP during the first 10 seconds, after that 4+ CP if it expires within the next GCD or is not up
C 0.00 call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&combo_points.deficit>=4
Consider using a Stealth CD when reaching the energy threshold and having space for at least 4 CP
D 0.00 call_action_list,name=finish,if=combo_points>=4+talent.deeper_stratagem.enabled|target.time_to_die<=1&combo_points>=3
Finish at 4+ without DS, 5+ with DS (outside stealth)
E 0.00 call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold-40*!(talent.alacrity.enabled|talent.shadow_focus.enabled|talent.master_of_shadows.enabled)
Use a builder when reaching the energy threshold (minus 40 if none of Alacrity, Shadow Focus, and Master of Shadows is selected)
F 3.35 arcane_torrent,if=energy.deficit>=15+energy.regen
Lowest priority in all of the APL because it causes a GCD
0.00 arcane_pulse
0.00 lights_judgment
actions.build
# count action,conditions
0.00 shuriken_toss,if=buff.sharpened_blades.stack>=29&spell_targets.shuriken_storm<=1+3*azerite.sharpened_blades.rank=2+4*azerite.sharpened_blades.rank=3
Shuriken Toss at 29+ Sharpened Blades stacks. 1T at Rank 1, up to 4 at Rank 2, up to 5 at Rank 3
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2|buff.the_dreadlords_deceit.stack>=29
0.00 gloomblade
G 67.42 backstab
actions.cds
# count action,conditions
H 1.00 potion,if=buff.bloodlust.react|target.time_to_die<=60|(buff.vanish.up&(buff.shadow_blades.up|cooldown.shadow_blades.remains<=30))
0.00 blood_fury,if=stealthed.rogue
0.00 berserking,if=stealthed.rogue
0.00 fireblood,if=stealthed.rogue
0.00 ancestral_call,if=stealthed.rogue
I 10.28 symbols_of_death,if=dot.nightblade.ticking
J 0.26 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit
K 8.54 marked_for_death,if=raid_event.adds.in>30&!stealthed.all&combo_points.deficit>=cp_max_spend
L 1.00 shadow_blades,if=combo_points.deficit>=2+stealthed.all
0.00 shuriken_tornado,if=spell_targets>=3&dot.nightblade.ticking&buff.symbols_of_death.up&buff.shadow_dance.up
M 0.62 shadow_dance,if=!buff.shadow_dance.up&target.time_to_die<=5+talent.subterfuge.enabled
actions.finish
# count action,conditions
N 8.03 nightblade,if=(!talent.dark_shadow.enabled|!buff.shadow_dance.up)&target.time_to_die-remains>6&remains<tick_time*2&(spell_targets.shuriken_storm<4|!buff.symbols_of_death.up)
Keep up Nightblade if it is about to run out. Do not use NB during Dance, if talented into Dark Shadow.
0.00 nightblade,cycle_targets=1,if=spell_targets.shuriken_storm>=2&(spell_targets.shuriken_storm<=5|talent.secret_technique.enabled)&!buff.shadow_dance.up&target.time_to_die>=(5+(2*combo_points))&refreshable
Multidotting outside Dance on targets that will live for the duration of Nightblade with refresh during pandemic if you have less than 6 targets or play with Secret Technique.
O 5.15 nightblade,if=remains<cooldown.symbols_of_death.remains+10&cooldown.symbols_of_death.remains<=5&target.time_to_die-remains>cooldown.symbols_of_death.remains+5
Refresh Nightblade early if it will expire during Symbols. Do that refresh if SoD gets ready in the next 5s.
0.00 secret_technique,if=buff.symbols_of_death.up&(!talent.dark_shadow.enabled|spell_targets.shuriken_storm<2|buff.shadow_dance.up)
Secret Technique during Symbols. With Dark Shadow and multiple targets also only during Shadow Dance (until threshold in next line).
0.00 secret_technique,if=spell_targets.shuriken_storm>=2+talent.dark_shadow.enabled+talent.nightstalker.enabled
With enough targets always use SecTec on CD.
P 60.84 eviscerate
actions.stealth_cds
# count action,conditions
0.00 variable,name=shd_threshold,value=cooldown.shadow_dance.charges_fractional>=1.75
Helper Variable
Q 2.29 vanish,if=!variable.shd_threshold&debuff.find_weakness.remains<1
Vanish unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
0.00 pool_resource,for_next=1,extra_amount=40
Pool for Shadowmeld + Shadowstrike unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
0.00 shadowmeld,if=energy>=40&energy.deficit>=10&!variable.shd_threshold&debuff.find_weakness.remains<1
R 21.75 shadow_dance,if=(!talent.dark_shadow.enabled|dot.nightblade.remains>=5+talent.subterfuge.enabled)&(variable.shd_threshold|buff.symbols_of_death.remains>=1.2|spell_targets>=4&cooldown.symbols_of_death.remains>10)
With Dark Shadow only Dance when Nightblade will stay up. Use during Symbols or above threshold.
S 0.34 shadow_dance,if=target.time_to_die<cooldown.symbols_of_death.remains
actions.stealthed
# count action,conditions
T 1.00 shadowstrike,if=buff.stealth.up
If stealth is up, we really want to use Shadowstrike to benefits from the passive bonus, even if we are at max cp (from the precombat MfD).
U 0.00 call_action_list,name=finish,if=combo_points.deficit<=1-(talent.deeper_stratagem.enabled&buff.vanish.up)
Finish at 4+ CP without DS, 5+ with DS, and 6 with DS after Vanish
0.00 shadowstrike,cycle_targets=1,if=talent.secret_technique.enabled&talent.find_weakness.enabled&debuff.find_weakness.remains<1&spell_targets.shuriken_storm=2&target.time_to_die-remains>6
At 2 targets with Secret Technique keep up Find Weakness by cycling Shadowstrike.
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=3
V 87.37 shadowstrike

Sample Sequence

01245678TBIRVPVVPRVVPVVPGGNKPRVPVVPGGGPRVVOVVPIRVVPVVPRVVPVVPGGFGBKPGGPQVGOGGIGPRVVPVVPGGGBGGGPKPRVVOVVIPRVVPVVPRVVPVVNGGGPGGOKPGGIGPRVVPVVPGGFBGGGPGGNKPRVVIPVVPRVVPVVNGGGPGGPRVVNLVPKPIRVVPVPRVVPVNGGPGGPQVGGNGGGIPKPRVVPVVPRVVNVVPGFGPGGGNHGGIGPKPRVVPVVNGGGPGGGNRVVPVVIPRVVPVVPKPRVVNVVPGGGPMVVP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Rogue_Subtlety 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 1 augmentation T22_Rogue_Subtlety 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 2 food T22_Rogue_Subtlety 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 4 stealth_threshold Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points
Pre precombat 5 stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points stealth
Pre precombat 6 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth
Pre precombat 7 shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth, shadow_blades
Pre precombat 8 potion Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth, shadow_blades, battle_potion_of_agility
0:00.000 stealthed T shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 5.0/5: 100% combo_points stealth, shadow_blades, archive_of_the_titans, resounding_protection, battle_potion_of_agility
0:01.004 default B nightblade Fluffy_Pillow 79.6/100: 80% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:02.009 cds I symbols_of_death Fluffy_Pillow 99.6/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:02.009 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:02.009 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:03.014 finish P eviscerate Fluffy_Pillow 99.1/100: 99% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:04.019 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans, resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:05.023 stealthed V shadowstrike Fluffy_Pillow 91.1/100: 91% energy | 3.0/5: 60% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:06.027 finish P eviscerate Fluffy_Pillow 82.1/100: 82% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(2), resounding_protection, titanic_overcharge(2), battle_potion_of_agility
0:07.032 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(2), resounding_protection, overwhelming_power(24), titanic_overcharge(2), battle_potion_of_agility
0:07.032 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation, elemental_whirl_mastery, unstable_flames, archive_of_the_titans(2), resounding_protection, overwhelming_power(24), titanic_overcharge(2), battle_potion_of_agility
0:08.037 stealthed V shadowstrike Fluffy_Pillow 92.2/100: 92% energy | 3.0/5: 60% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(2), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(2), resounding_protection, overwhelming_power(23), titanic_overcharge(2), battle_potion_of_agility
0:09.042 finish P eviscerate Fluffy_Pillow 92.4/100: 92% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation(2), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(2), resounding_protection, overwhelming_power(22), titanic_overcharge(2), battle_potion_of_agility
0:10.045 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(3), resounding_protection, overwhelming_power(21), titanic_overcharge(2), battle_potion_of_agility
0:11.049 stealthed V shadowstrike Fluffy_Pillow 84.0/100: 84% energy | 3.0/5: 60% combo_points bloodlust, shadow_blades, shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(3), resounding_protection, overwhelming_power(20), battle_potion_of_agility
0:12.054 finish P eviscerate Fluffy_Pillow 75.9/100: 76% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, frothing_rage, quick_navigation, masterful_navigation(3), archive_of_the_titans(3), resounding_protection, overwhelming_power(19), battle_potion_of_agility
0:13.059 build G backstab Fluffy_Pillow 86.7/100: 87% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(3), resounding_protection, overwhelming_power(18), battle_potion_of_agility
0:14.065 build G backstab Fluffy_Pillow 67.5/100: 68% energy | 2.0/5: 40% combo_points bloodlust, shadow_blades, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(3), resounding_protection, overwhelming_power(17), battle_potion_of_agility
0:15.068 finish N nightblade Fluffy_Pillow 56.3/100: 56% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(4), resounding_protection, overwhelming_power(16), battle_potion_of_agility
0:16.073 cds K marked_for_death Fluffy_Pillow 76.9/100: 77% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(4), resounding_protection, overwhelming_power(15), battle_potion_of_agility
0:16.073 finish P eviscerate Fluffy_Pillow 76.9/100: 77% energy | 5.0/5: 100% combo_points bloodlust, shadow_blades, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(4), resounding_protection, overwhelming_power(15), battle_potion_of_agility
0:17.079 stealth_cds R shadow_dance Fluffy_Pillow 87.6/100: 88% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, frothing_rage(3), quick_navigation, masterful_navigation(3), archive_of_the_titans(4), resounding_protection, overwhelming_power(14), titanic_overcharge, battle_potion_of_agility
0:17.079 stealthed V shadowstrike Fluffy_Pillow 88.6/100: 89% energy | 0.0/5: 0% combo_points bloodlust, shadow_blades, shadow_dance, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(3), archive_of_the_titans(4), resounding_protection, overwhelming_power(14), titanic_overcharge, battle_potion_of_agility
0:18.084 finish P eviscerate Fluffy_Pillow 88.3/100: 88% energy | 4.0/5: 80% combo_points bloodlust, shadow_blades, shadow_dance, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(3), archive_of_the_titans(4), resounding_protection, overwhelming_power(13), titanic_overcharge, battle_potion_of_agility
0:19.089 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage(3), quick_navigation, masterful_navigation(3), archive_of_the_titans(4), resounding_protection, overwhelming_power(12), titanic_overcharge, battle_potion_of_agility
0:20.094 stealthed V shadowstrike Fluffy_Pillow 91.6/100: 92% energy | 2.0/5: 40% combo_points bloodlust, shadow_dance, frothing_rage(3), quick_navigation, masterful_navigation(3), archive_of_the_titans(5), resounding_protection, overwhelming_power(11), titanic_overcharge, battle_potion_of_agility
0:21.099 finish P eviscerate Fluffy_Pillow 83.2/100: 83% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, frothing_rage(3), quick_navigation(2), masterful_navigation(3), archive_of_the_titans(5), resounding_protection, overwhelming_power(10), titanic_overcharge, battle_potion_of_agility
0:22.102 build G backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, frothing_rage(3), quick_navigation(2), masterful_navigation(3), unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(9), titanic_overcharge, battle_potion_of_agility
0:23.108 build G backstab Fluffy_Pillow 88.5/100: 89% energy | 2.0/5: 40% combo_points bloodlust, frothing_rage(3), quick_navigation(2), masterful_navigation(3), unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(8), titanic_overcharge
0:24.112 build G backstab Fluffy_Pillow 69.1/100: 69% energy | 3.0/5: 60% combo_points bloodlust, frothing_rage(3), quick_navigation(3), masterful_navigation(3), unstable_flames, archive_of_the_titans(5), resounding_protection, overwhelming_power(7), titanic_overcharge
0:25.116 finish P eviscerate Fluffy_Pillow 57.7/100: 58% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage(3), quick_navigation(3), masterful_navigation(3), unstable_flames, archive_of_the_titans(6), resounding_protection, overwhelming_power(6), titanic_overcharge(2)
0:26.123 stealth_cds R shadow_dance Fluffy_Pillow 68.3/100: 68% energy | 0.0/5: 0% combo_points bloodlust, frothing_rage(3), quick_navigation(3), masterful_navigation(3), archive_of_the_titans(6), resounding_protection, overwhelming_power(5), titanic_overcharge(2)
0:26.123 stealthed V shadowstrike Fluffy_Pillow 69.3/100: 69% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage(3), quick_navigation(3), masterful_navigation(3), archive_of_the_titans(6), resounding_protection, overwhelming_power(5), titanic_overcharge(2)
0:27.128 stealthed V shadowstrike Fluffy_Pillow 60.8/100: 61% energy | 2.0/5: 40% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage(3), quick_navigation(3), masterful_navigation(3), archive_of_the_titans(6), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
0:28.133 finish O nightblade Fluffy_Pillow 60.2/100: 60% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, master_of_shadows, frothing_rage(3), quick_navigation(3), masterful_navigation(3), unstable_flames, archive_of_the_titans(6), resounding_protection, overwhelming_power(3), titanic_overcharge(2)
0:29.139 stealthed V shadowstrike Fluffy_Pillow 93.6/100: 94% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, quick_navigation(3), masterful_navigation(4), unstable_flames, archive_of_the_titans(6), resounding_protection, overwhelming_power(2), titanic_overcharge(2)
0:30.143 stealthed V shadowstrike Fluffy_Pillow 77.0/100: 77% energy | 2.0/5: 40% combo_points bloodlust, shadow_dance, frothing_rage, quick_navigation(3), masterful_navigation(4), unstable_flames(2), archive_of_the_titans(7), resounding_protection, overwhelming_power, titanic_overcharge(2)
0:31.146 finish P eviscerate Fluffy_Pillow 68.3/100: 68% energy | 5.0/5: 100% combo_points bloodlust, frothing_rage, quick_navigation(3), masterful_navigation(4), unstable_flames(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge(2)
0:32.150 cds I symbols_of_death Fluffy_Pillow 78.5/100: 79% energy | 0.0/5: 0% combo_points bloodlust, frothing_rage, quick_navigation(3), masterful_navigation(4), unstable_flames(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge(2)
0:32.150 stealth_cds R shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation(4), unstable_flames(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge(2)
0:32.150 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(4), unstable_flames(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge(2)
0:33.154 stealthed V shadowstrike Fluffy_Pillow 91.3/100: 91% energy | 2.0/5: 40% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(4), unstable_flames(2), archive_of_the_titans(7), resounding_protection, titanic_overcharge(2)
0:34.159 finish P eviscerate Fluffy_Pillow 90.5/100: 91% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(4), unstable_flames(2), archive_of_the_titans(7), resounding_protection
0:35.163 stealthed V shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/5: 0% combo_points bloodlust, shadow_dance, symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(8), resounding_protection
0:36.166 stealthed V shadowstrike Fluffy_Pillow 83.1/100: 83% energy | 2.0/5: 40% combo_points bloodlust, shadow_dance, symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(8), resounding_protection
0:37.169 finish P eviscerate Fluffy_Pillow 66.3/100: 66% energy | 4.0/5: 80% combo_points bloodlust, symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(8), resounding_protection, titanic_overcharge
0:38.173 stealth_cds R shadow_dance Fluffy_Pillow 78.4/100: 78% energy | 1.0/5: 20% combo_points bloodlust, symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(8), resounding_protection, titanic_overcharge
0:38.173 stealthed V shadowstrike Fluffy_Pillow 79.4/100: 79% energy | 1.0/5: 20% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(8), resounding_protection, titanic_overcharge
0:39.177 stealthed V shadowstrike Fluffy_Pillow 70.6/100: 71% energy | 3.0/5: 60% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(4), archive_of_the_titans(8), resounding_protection, titanic_overcharge
0:40.182 finish P eviscerate Fluffy_Pillow 61.9/100: 62% energy | 5.0/5: 100% combo_points bloodlust, shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(4), masterful_navigation(4), archive_of_the_titans(9), resounding_protection, titanic_overcharge
0:41.187 stealthed V shadowstrike Fluffy_Pillow 86.5/100: 87% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation(4), masterful_navigation(4), archive_of_the_titans(9), resounding_protection, titanic_overcharge(2)
0:42.191 stealthed V shadowstrike Fluffy_Pillow 74.4/100: 74% energy | 3.0/5: 60% combo_points shadow_dance, frothing_rage, quick_navigation(4), masterful_navigation(4), archive_of_the_titans(9), resounding_protection, titanic_overcharge(2)
0:43.195 finish P eviscerate Fluffy_Pillow 54.2/100: 54% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation(4), masterful_navigation(4), unstable_flames, archive_of_the_titans(9), resounding_protection, titanic_overcharge(2)
0:44.200 build G backstab Fluffy_Pillow 61.0/100: 61% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation(4), masterful_navigation(4), unstable_flames, archive_of_the_titans(9), resounding_protection, titanic_overcharge(2)
0:45.206 build G backstab Fluffy_Pillow 37.8/100: 38% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation(4), masterful_navigation(4), unstable_flames, archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:46.209 default F arcane_torrent Fluffy_Pillow 14.7/100: 15% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(4), masterful_navigation(4), unstable_flames, archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:47.213 build G backstab Fluffy_Pillow 49.6/100: 50% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:48.219 default B nightblade Fluffy_Pillow 27.1/100: 27% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:49.225 cds K marked_for_death Fluffy_Pillow 38.6/100: 39% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:49.225 finish P eviscerate Fluffy_Pillow 38.6/100: 39% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, archive_of_the_titans(10), resounding_protection, titanic_overcharge(3)
0:50.230 build G backstab Fluffy_Pillow 54.1/100: 54% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, archive_of_the_titans(11), resounding_protection, titanic_overcharge(3)
0:51.234 Waiting     0.300 sec 31.5/100: 32% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, archive_of_the_titans(11), resounding_protection, titanic_overcharge(3)
0:51.534 build G backstab Fluffy_Pillow 35.2/100: 35% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(11), resounding_protection, titanic_overcharge(3)
0:52.538 Waiting     1.190 sec 12.7/100: 13% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(11), resounding_protection, titanic_overcharge(3)
0:53.728 finish P eviscerate Fluffy_Pillow 35.5/100: 35% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(11), resounding_protection, titanic_overcharge(3)
0:54.734 stealth_cds Q vanish Fluffy_Pillow 37.0/100: 37% energy | 0.0/5: 0% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(11), resounding_protection, titanic_overcharge(3)
0:54.734 stealthed V shadowstrike Fluffy_Pillow 38.0/100: 38% energy | 0.0/5: 0% combo_points vanish, master_of_shadows, frothing_rage(2), quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(11), resounding_protection, titanic_overcharge(3)
0:55.739 Waiting     0.500 sec 26.3/100: 26% energy | 2.0/5: 40% combo_points master_of_shadows, frothing_rage(2), quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(12), resounding_protection
0:56.239 build G backstab Fluffy_Pillow 36.4/100: 36% energy | 2.0/5: 40% combo_points master_of_shadows, frothing_rage(2), quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(12), resounding_protection
0:57.243 Waiting     0.499 sec 21.6/100: 22% energy | 3.0/5: 60% combo_points master_of_shadows, frothing_rage(2), masterful_navigation_final, archive_of_the_titans(12), resounding_protection
0:57.742 finish O nightblade Fluffy_Pillow 39.3/100: 39% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation, masterful_navigation_final, archive_of_the_titans(12), resounding_protection
0:58.746 build G backstab Fluffy_Pillow 49.7/100: 50% energy | 0.0/5: 0% combo_points frothing_rage(2), quick_navigation(2), archive_of_the_titans(12), resounding_protection
0:59.750 Waiting     0.800 sec 26.3/100: 26% energy | 1.0/5: 20% combo_points frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(12), resounding_protection
1:00.550 build G backstab Fluffy_Pillow 35.5/100: 36% energy | 1.0/5: 20% combo_points frothing_rage(2), quick_navigation(2), unstable_flames, archive_of_the_titans(13), resounding_protection, titanic_overcharge
1:01.554 Waiting     1.103 sec 12.2/100: 12% energy | 2.0/5: 40% combo_points frothing_rage(2), quick_navigation(2), unstable_flames(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge(2)
1:02.657 cds I symbols_of_death Fluffy_Pillow 33.0/100: 33% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation(2), unstable_flames(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge(2)
1:02.657 build G backstab Fluffy_Pillow 73.0/100: 73% energy | 3.0/5: 60% combo_points symbols_of_death, frothing_rage(2), quick_navigation(2), unstable_flames(2), archive_of_the_titans(13), resounding_protection, titanic_overcharge(2)
1:03.660 finish P eviscerate Fluffy_Pillow 49.7/100: 50% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage(2), quick_navigation(2), unstable_flames(3), archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:04.665 stealth_cds R shadow_dance Fluffy_Pillow 50.4/100: 50% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(2), quick_navigation(2), unstable_flames(3), archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:04.665 stealthed V shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(2), unstable_flames(3), archive_of_the_titans(13), resounding_protection, titanic_overcharge(3)
1:05.669 stealthed V shadowstrike Fluffy_Pillow 47.2/100: 47% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(2), unstable_flames(3), archive_of_the_titans(14), resounding_protection, titanic_overcharge(3)
1:06.674 finish P eviscerate Fluffy_Pillow 34.9/100: 35% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(2), unstable_flames(4), archive_of_the_titans(14), resounding_protection, titanic_overcharge(4)
1:07.677 stealthed V shadowstrike Fluffy_Pillow 56.7/100: 57% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation(3), unstable_flames(4), archive_of_the_titans(14), resounding_protection, titanic_overcharge(4)
1:08.682 stealthed V shadowstrike Fluffy_Pillow 36.6/100: 37% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation(3), unstable_flames(4), archive_of_the_titans(14), resounding_protection, titanic_overcharge(4)
1:09.686 Waiting     0.911 sec 16.5/100: 17% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage(2), quick_navigation(4), unstable_flames(4), archive_of_the_titans(14), resounding_protection, titanic_overcharge(4)
1:10.597 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), quick_navigation(4), masterful_navigation, unstable_flames(4), archive_of_the_titans(15), resounding_protection, titanic_overcharge(4)
1:11.601 build G backstab Fluffy_Pillow 42.9/100: 43% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(2), quick_navigation_final, masterful_navigation, archive_of_the_titans(15), resounding_protection, titanic_overcharge(4)
1:12.606 Waiting     0.567 sec 20.4/100: 20% energy | 1.0/5: 20% combo_points symbols_of_death, frothing_rage(2), quick_navigation_final, masterful_navigation, archive_of_the_titans(15), resounding_protection, titanic_overcharge(4)
1:13.173 build G backstab Fluffy_Pillow 35.5/100: 35% energy | 2.0/5: 40% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation, archive_of_the_titans(15), resounding_protection, titanic_overcharge(4)
1:14.178 Waiting     1.860 sec 13.0/100: 13% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(15), resounding_protection, titanic_overcharge(4)
1:16.038 build G backstab Fluffy_Pillow 36.2/100: 36% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(16), resounding_protection, titanic_overcharge(4)
1:17.041 Waiting     0.894 sec 13.8/100: 14% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(16), resounding_protection, titanic_overcharge(5)
1:17.935 default B nightblade Fluffy_Pillow 33.0/100: 33% energy | 5.0/5: 100% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation(2), archive_of_the_titans(16), resounding_protection, titanic_overcharge(5)
1:18.941 build G backstab Fluffy_Pillow 50.6/100: 51% energy | 0.0/5: 0% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation(2), unstable_flames, archive_of_the_titans(16), resounding_protection, titanic_overcharge(5)
1:19.945 Waiting     0.300 sec 28.2/100: 28% energy | 1.0/5: 20% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(16), resounding_protection, titanic_overcharge(5)
1:20.245 build G backstab Fluffy_Pillow 39.9/100: 40% energy | 2.0/5: 40% combo_points frothing_rage(2), quick_navigation_final, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(17), resounding_protection, titanic_overcharge(5)
1:21.249 Waiting     1.591 sec 16.9/100: 17% energy | 3.0/5: 60% combo_points frothing_rage(2), masterful_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(17), resounding_protection, titanic_overcharge(5)
1:22.840 build G backstab Fluffy_Pillow 35.5/100: 35% energy | 3.0/5: 60% combo_points frothing_rage(2), masterful_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(17), resounding_protection, titanic_overcharge(5)
1:23.844 Waiting     1.701 sec 12.2/100: 12% energy | 4.0/5: 80% combo_points frothing_rage(2), masterful_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(17), resounding_protection, titanic_overcharge(5)
1:25.545 finish P eviscerate Fluffy_Pillow 40.0/100: 40% energy | 5.0/5: 100% combo_points frothing_rage(2), quick_navigation, masterful_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(18), resounding_protection, titanic_overcharge(5)
1:26.549 cds K marked_for_death Fluffy_Pillow 46.6/100: 47% energy | 0.0/5: 0% combo_points frothing_rage(2), quick_navigation, masterful_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(18), resounding_protection
1:26.549 finish P eviscerate Fluffy_Pillow 46.6/100: 47% energy | 5.0/5: 100% combo_points frothing_rage(2), quick_navigation, masterful_navigation(2), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(18), resounding_protection
1:27.553 stealth_cds R shadow_dance Fluffy_Pillow 53.1/100: 53% energy | 0.0/5: 0% combo_points frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(18), resounding_protection
1:27.553 stealthed V shadowstrike Fluffy_Pillow 54.1/100: 54% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(18), resounding_protection
1:28.557 stealthed V shadowstrike Fluffy_Pillow 41.5/100: 42% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(18), resounding_protection
1:29.561 finish O nightblade Fluffy_Pillow 29.0/100: 29% energy | 4.0/5: 80% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_crit, elemental_whirl_versatility, archive_of_the_titans(18), resounding_protection
1:30.565 stealthed V shadowstrike Fluffy_Pillow 60.5/100: 60% energy | 1.0/5: 20% combo_points shadow_dance, frothing_rage(2), quick_navigation, masterful_navigation(3), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(19), resounding_protection
1:31.569 stealthed V shadowstrike Fluffy_Pillow 39.9/100: 40% energy | 3.0/5: 60% combo_points shadow_dance, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(19), resounding_protection
1:32.572 cds I symbols_of_death Fluffy_Pillow 19.4/100: 19% energy | 5.0/5: 100% combo_points frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(19), resounding_protection
1:32.657 finish P eviscerate Fluffy_Pillow 60.4/100: 60% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), quick_navigation, masterful_navigation(3), unstable_flames, archive_of_the_titans(19), resounding_protection
1:33.661 stealth_cds R shadow_dance Fluffy_Pillow 66.9/100: 67% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(2), quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge
1:33.661 stealthed V shadowstrike Fluffy_Pillow 67.9/100: 68% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation(4), unstable_flames, archive_of_the_titans(19), resounding_protection, titanic_overcharge
1:34.666 stealthed V shadowstrike Fluffy_Pillow 63.5/100: 63% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(2), masterful_navigation(4), archive_of_the_titans(19), resounding_protection, titanic_overcharge
1:35.671 finish P eviscerate Fluffy_Pillow 51.1/100: 51% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(2), quick_navigation(2), masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge
1:36.677 stealthed V shadowstrike Fluffy_Pillow 72.9/100: 73% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage(3), quick_navigation(3), masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:37.682 stealthed V shadowstrike Fluffy_Pillow 60.6/100: 61% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage(3), quick_navigation(3), masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
1:38.686 finish P eviscerate Fluffy_Pillow 40.4/100: 40% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(3), quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:39.692 stealth_cds R shadow_dance Fluffy_Pillow 47.2/100: 47% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(3), quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:39.692 stealthed V shadowstrike Fluffy_Pillow 48.2/100: 48% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:40.698 stealthed V shadowstrike Fluffy_Pillow 36.0/100: 36% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:41.703 finish P eviscerate Fluffy_Pillow 31.8/100: 32% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:42.708 stealthed V shadowstrike Fluffy_Pillow 53.7/100: 54% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage(3), quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:43.713 stealthed V shadowstrike Fluffy_Pillow 33.5/100: 33% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage(3), quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:44.718 Waiting     0.997 sec 13.3/100: 13% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:45.715 finish N nightblade Fluffy_Pillow 33.0/100: 33% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:46.720 build G backstab Fluffy_Pillow 49.8/100: 50% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
1:47.724 Waiting     0.800 sec 26.6/100: 27% energy | 1.0/5: 20% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
1:48.524 build G backstab Fluffy_Pillow 35.8/100: 36% energy | 1.0/5: 20% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
1:49.529 Waiting     1.291 sec 20.5/100: 20% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
1:50.820 build G backstab Fluffy_Pillow 35.4/100: 35% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection
1:51.825 Waiting     1.869 sec 12.9/100: 13% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(24)
1:53.694 finish P eviscerate Fluffy_Pillow 36.1/100: 36% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(22)
1:54.697 build G backstab Fluffy_Pillow 45.5/100: 46% energy | 1.0/5: 20% combo_points frothing_rage(3), quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(21)
1:55.701 Waiting     1.072 sec 22.9/100: 23% energy | 2.0/5: 40% combo_points frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20)
1:56.773 build G backstab Fluffy_Pillow 36.0/100: 36% energy | 2.0/5: 40% combo_points frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19)
1:57.777 Waiting     0.948 sec 13.3/100: 13% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
1:58.725 finish O nightblade Fluffy_Pillow 33.0/100: 33% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
1:59.727 cds K marked_for_death Fluffy_Pillow 44.3/100: 44% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(2)
1:59.727 finish P eviscerate Fluffy_Pillow 44.3/100: 44% energy | 5.0/5: 100% combo_points frothing_rage(3), quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge(2)
2:00.732 build G backstab Fluffy_Pillow 51.6/100: 52% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge(3)
2:01.735 Waiting     0.300 sec 28.9/100: 29% energy | 1.0/5: 20% combo_points frothing_rage(3), quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(3)
2:02.035 build G backstab Fluffy_Pillow 40.6/100: 41% energy | 2.0/5: 40% combo_points frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(3)
2:03.039 cds I symbols_of_death Fluffy_Pillow 18.0/100: 18% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(3)
2:03.039 build G backstab Fluffy_Pillow 58.0/100: 58% energy | 3.0/5: 60% combo_points symbols_of_death, frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(3)
2:04.043 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage(3), quick_navigation(4), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(3)
2:05.047 stealth_cds R shadow_dance Fluffy_Pillow 36.5/100: 37% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(3)
2:05.047 stealthed V shadowstrike Fluffy_Pillow 37.5/100: 38% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge(3)
2:06.051 Waiting     0.400 sec 25.8/100: 26% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(3)
2:06.451 stealthed V shadowstrike Fluffy_Pillow 38.6/100: 39% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(4)
2:07.454 Waiting     0.100 sec 26.9/100: 27% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(4)
2:07.554 finish P eviscerate Fluffy_Pillow 32.1/100: 32% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage(3), quick_navigation(4), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(4)
2:08.558 stealthed V shadowstrike Fluffy_Pillow 50.4/100: 50% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage(3), quick_navigation_final, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(4)
2:09.561 Waiting     0.100 sec 31.1/100: 31% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, quick_navigation_final, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(4)
2:09.661 stealthed V shadowstrike Fluffy_Pillow 32.4/100: 32% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, quick_navigation_final, masterful_navigation, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(4)
2:10.667 Waiting     1.105 sec 21.1/100: 21% energy | 5.0/5: 100% combo_points symbols_of_death, quick_navigation_final, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(4)
2:11.772 finish P eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/5: 100% combo_points symbols_of_death, quick_navigation_final, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(4)
2:12.776 build G backstab Fluffy_Pillow 42.7/100: 43% energy | 0.0/5: 0% combo_points symbols_of_death, quick_navigation_final, masterful_navigation(2), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(4)
2:13.780 Waiting     0.600 sec 28.3/100: 28% energy | 2.0/5: 40% combo_points quick_navigation_final, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(4)
2:14.380 build G backstab Fluffy_Pillow 35.8/100: 36% energy | 2.0/5: 40% combo_points quick_navigation_final, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(4)
2:15.384 Waiting     0.930 sec 13.4/100: 13% energy | 3.0/5: 60% combo_points quick_navigation_final, masterful_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:16.314 default F arcane_torrent Fluffy_Pillow 25.0/100: 25% energy | 3.0/5: 60% combo_points quick_navigation_final, masterful_navigation(2), unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:17.319 default B nightblade Fluffy_Pillow 60.3/100: 60% energy | 4.0/5: 80% combo_points quick_navigation_final, masterful_navigation(2), unstable_flames(4), archive_of_the_titans(20), resounding_protection
2:18.325 build G backstab Fluffy_Pillow 71.6/100: 72% energy | 0.0/5: 0% combo_points quick_navigation_final, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:19.328 build G backstab Fluffy_Pillow 48.1/100: 48% energy | 1.0/5: 20% combo_points frothing_rage, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:20.332 Waiting     0.300 sec 32.5/100: 32% energy | 3.0/5: 60% combo_points frothing_rage, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:20.632 build G backstab Fluffy_Pillow 35.9/100: 36% energy | 3.0/5: 60% combo_points frothing_rage, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:21.636 Waiting     2.021 sec 12.3/100: 12% energy | 4.0/5: 80% combo_points frothing_rage, masterful_navigation(2), unstable_flames(5), archive_of_the_titans(20), resounding_protection
2:23.657 finish P eviscerate Fluffy_Pillow 35.3/100: 35% energy | 4.0/5: 80% combo_points frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:24.663 build G backstab Fluffy_Pillow 35.8/100: 36% energy | 0.0/5: 0% combo_points frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:25.667 Waiting     1.306 sec 20.3/100: 20% energy | 2.0/5: 40% combo_points frothing_rage, masterful_navigation(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:26.973 build G backstab Fluffy_Pillow 35.4/100: 35% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:27.976 Waiting     1.714 sec 12.1/100: 12% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation(2), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:29.690 finish N nightblade Fluffy_Pillow 40.0/100: 40% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(2), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:30.695 cds K marked_for_death Fluffy_Pillow 50.6/100: 51% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation(2), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:30.695 finish P eviscerate Fluffy_Pillow 50.6/100: 51% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation(2), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:31.699 stealth_cds R shadow_dance Fluffy_Pillow 57.4/100: 57% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:31.699 stealthed V shadowstrike Fluffy_Pillow 58.4/100: 58% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:32.704 stealthed V shadowstrike Fluffy_Pillow 46.2/100: 46% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:33.710 cds I symbols_of_death Fluffy_Pillow 34.0/100: 34% energy | 4.0/5: 80% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:33.710 finish P eviscerate Fluffy_Pillow 74.0/100: 74% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:34.714 stealthed V shadowstrike Fluffy_Pillow 89.8/100: 90% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:35.719 stealthed V shadowstrike Fluffy_Pillow 69.6/100: 70% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
2:36.725 finish P eviscerate Fluffy_Pillow 57.4/100: 57% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:37.730 stealth_cds R shadow_dance Fluffy_Pillow 64.3/100: 64% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:37.730 stealthed V shadowstrike Fluffy_Pillow 65.3/100: 65% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:38.734 stealthed V shadowstrike Fluffy_Pillow 53.2/100: 53% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:39.737 finish P eviscerate Fluffy_Pillow 41.0/100: 41% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:40.742 stealthed V shadowstrike Fluffy_Pillow 64.9/100: 65% energy | 1.0/5: 20% combo_points shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:41.746 stealthed V shadowstrike Fluffy_Pillow 44.7/100: 45% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage(2), quick_navigation(3), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:42.751 Waiting     0.100 sec 24.6/100: 25% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), quick_navigation(3), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:42.851 finish N nightblade Fluffy_Pillow 25.8/100: 26% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage(2), quick_navigation(3), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:43.857 build G backstab Fluffy_Pillow 42.7/100: 43% energy | 0.0/5: 0% combo_points frothing_rage(2), quick_navigation(3), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:44.863 Waiting     0.662 sec 19.5/100: 20% energy | 1.0/5: 20% combo_points frothing_rage(2), quick_navigation(3), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:45.525 build G backstab Fluffy_Pillow 35.4/100: 35% energy | 2.0/5: 40% combo_points frothing_rage(2), quick_navigation(3), masterful_navigation_final, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:46.530 Waiting     1.969 sec 12.3/100: 12% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation(4), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
2:48.499 build G backstab Fluffy_Pillow 35.2/100: 35% energy | 3.0/5: 60% combo_points frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
2:49.502 Waiting     1.323 sec 11.9/100: 12% energy | 4.0/5: 80% combo_points frothing_rage(2), quick_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection
2:50.825 finish P eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/5: 100% combo_points frothing_rage(2), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
2:51.831 build G backstab Fluffy_Pillow 42.9/100: 43% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
2:52.835 Waiting     0.593 sec 20.2/100: 20% energy | 1.0/5: 20% combo_points frothing_rage(3), quick_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
2:53.428 build G backstab Fluffy_Pillow 35.5/100: 35% energy | 2.0/5: 40% combo_points frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:54.433 Waiting     1.791 sec 12.8/100: 13% energy | 3.0/5: 60% combo_points frothing_rage(3), quick_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge
2:56.224 finish P eviscerate Fluffy_Pillow 42.8/100: 43% energy | 4.0/5: 80% combo_points frothing_rage(3), quick_navigation_final, masterful_navigation, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:57.231 stealth_cds R shadow_dance Fluffy_Pillow 44.3/100: 44% energy | 0.0/5: 0% combo_points frothing_rage(3), quick_navigation_final, masterful_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:57.231 stealthed V shadowstrike Fluffy_Pillow 45.3/100: 45% energy | 0.0/5: 0% combo_points shadow_dance, master_of_shadows, frothing_rage(3), quick_navigation_final, masterful_navigation, elemental_whirl_versatility, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:58.235 stealthed V shadowstrike Fluffy_Pillow 33.7/100: 34% energy | 2.0/5: 40% combo_points shadow_dance, master_of_shadows, frothing_rage(3), quick_navigation_final, masterful_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
2:59.239 finish N nightblade Fluffy_Pillow 22.1/100: 22% energy | 4.0/5: 80% combo_points shadow_dance, master_of_shadows, frothing_rage(3), quick_navigation_final, masterful_navigation, elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:00.243 cds L shadow_blades Fluffy_Pillow 46.5/100: 46% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage(3), quick_navigation_final, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:01.247 stealthed V shadowstrike Fluffy_Pillow 58.1/100: 58% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, frothing_rage(3), masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:02.250 finish P eviscerate Fluffy_Pillow 45.6/100: 46% energy | 4.0/5: 80% combo_points shadow_blades, frothing_rage(3), masterful_navigation(3), elemental_whirl_versatility, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:03.254 cds K marked_for_death Fluffy_Pillow 46.1/100: 46% energy | 0.0/5: 0% combo_points shadow_blades, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:03.254 finish P eviscerate Fluffy_Pillow 46.1/100: 46% energy | 5.0/5: 100% combo_points shadow_blades, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:04.259 cds I symbols_of_death Fluffy_Pillow 52.6/100: 53% energy | 0.0/5: 0% combo_points shadow_blades, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:04.259 stealth_cds R shadow_dance Fluffy_Pillow 92.6/100: 93% energy | 0.0/5: 0% combo_points shadow_blades, symbols_of_death, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:04.259 stealthed V shadowstrike Fluffy_Pillow 93.6/100: 94% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(3), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:05.265 stealthed V shadowstrike Fluffy_Pillow 81.2/100: 81% energy | 3.0/5: 60% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(4), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:06.268 finish P eviscerate Fluffy_Pillow 68.6/100: 69% energy | 5.0/5: 100% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, masterful_navigation(4), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection
3:07.270 stealthed V shadowstrike Fluffy_Pillow 90.0/100: 90% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, masterful_navigation(4), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection
3:08.275 finish P eviscerate Fluffy_Pillow 77.4/100: 77% energy | 4.0/5: 80% combo_points shadow_blades, shadow_dance, symbols_of_death, masterful_navigation(4), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection
3:09.280 stealth_cds R shadow_dance Fluffy_Pillow 84.9/100: 85% energy | 0.0/5: 0% combo_points shadow_blades, symbols_of_death, quick_navigation, masterful_navigation(4), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection
3:09.280 stealthed V shadowstrike Fluffy_Pillow 85.9/100: 86% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, quick_navigation, masterful_navigation(4), elemental_whirl_versatility, unstable_flames(4), archive_of_the_titans(20), resounding_protection
3:10.287 stealthed V shadowstrike Fluffy_Pillow 73.5/100: 74% energy | 3.0/5: 60% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, quick_navigation, masterful_navigation_final, elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:11.294 finish P eviscerate Fluffy_Pillow 61.5/100: 61% energy | 5.0/5: 100% combo_points shadow_blades, shadow_dance, symbols_of_death, master_of_shadows, quick_navigation, masterful_navigation_final, elemental_whirl_versatility, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:12.300 stealthed V shadowstrike Fluffy_Pillow 83.4/100: 83% energy | 0.0/5: 0% combo_points shadow_blades, shadow_dance, symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:13.304 finish N nightblade Fluffy_Pillow 71.4/100: 71% energy | 4.0/5: 80% combo_points shadow_blades, shadow_dance, symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:14.308 build G backstab Fluffy_Pillow 87.4/100: 87% energy | 0.0/5: 0% combo_points shadow_blades, frothing_rage, quick_navigation(2), masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:15.312 build G backstab Fluffy_Pillow 64.4/100: 64% energy | 2.0/5: 40% combo_points shadow_blades, frothing_rage, quick_navigation(2), masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:16.318 finish P eviscerate Fluffy_Pillow 41.4/100: 41% energy | 4.0/5: 80% combo_points shadow_blades, frothing_rage, quick_navigation(2), masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:17.323 build G backstab Fluffy_Pillow 42.5/100: 42% energy | 0.0/5: 0% combo_points shadow_blades, frothing_rage, quick_navigation(3), masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge
3:18.329 Waiting     0.700 sec 27.5/100: 28% energy | 3.0/5: 60% combo_points shadow_blades, frothing_rage, quick_navigation(3), masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:19.029 build G backstab Fluffy_Pillow 36.0/100: 36% energy | 3.0/5: 60% combo_points shadow_blades, frothing_rage, quick_navigation(3), masterful_navigation_final, elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:20.034 Waiting     1.269 sec 13.2/100: 13% energy | 5.0/5: 100% combo_points shadow_blades, frothing_rage, quick_navigation(4), elemental_whirl_haste, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:21.303 finish P eviscerate Fluffy_Pillow 36.6/100: 37% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation(4), masterful_navigation, elemental_whirl_haste, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(2)
3:22.308 stealth_cds Q vanish Fluffy_Pillow 43.9/100: 44% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation(4), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:22.308 stealthed V shadowstrike Fluffy_Pillow 44.9/100: 45% energy | 0.0/5: 0% combo_points vanish, master_of_shadows, frothing_rage, quick_navigation(4), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:23.310 Waiting     0.200 sec 32.7/100: 33% energy | 2.0/5: 40% combo_points master_of_shadows, frothing_rage, quick_navigation(4), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:23.510 build G backstab Fluffy_Pillow 35.1/100: 35% energy | 2.0/5: 40% combo_points master_of_shadows, frothing_rage, quick_navigation(4), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:24.515 Waiting     0.826 sec 20.0/100: 20% energy | 3.0/5: 60% combo_points master_of_shadows, frothing_rage, quick_navigation(4), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:25.341 build G backstab Fluffy_Pillow 37.7/100: 38% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation(4), masterful_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:26.347 Waiting     0.280 sec 22.8/100: 23% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation_final, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:26.627 finish N nightblade Fluffy_Pillow 26.2/100: 26% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation_final, masterful_navigation(2), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
3:27.633 build G backstab Fluffy_Pillow 43.8/100: 44% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation_final, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:28.635 Waiting     1.199 sec 21.3/100: 21% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation_final, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:29.834 build G backstab Fluffy_Pillow 36.2/100: 36% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation_final, masterful_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:30.838 Waiting     1.162 sec 21.7/100: 22% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation_final, masterful_navigation(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:32.000 build G backstab Fluffy_Pillow 36.2/100: 36% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:33.006 Waiting     1.100 sec 13.8/100: 14% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:34.106 cds I symbols_of_death Fluffy_Pillow 35.5/100: 35% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:34.259 finish P eviscerate Fluffy_Pillow 77.4/100: 77% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:35.264 cds K marked_for_death Fluffy_Pillow 84.9/100: 85% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:35.264 finish P eviscerate Fluffy_Pillow 84.9/100: 85% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:36.268 stealth_cds R shadow_dance Fluffy_Pillow 92.3/100: 92% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:36.268 stealthed V shadowstrike Fluffy_Pillow 93.3/100: 93% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
3:37.273 stealthed V shadowstrike Fluffy_Pillow 80.9/100: 81% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection
3:38.277 finish P eviscerate Fluffy_Pillow 68.2/100: 68% energy | 4.0/5: 80% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, masterful_navigation_final, archive_of_the_titans(20), resounding_protection
3:39.282 stealthed V shadowstrike Fluffy_Pillow 83.7/100: 84% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection
3:40.286 stealthed V shadowstrike Fluffy_Pillow 72.1/100: 72% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), titanic_overcharge
3:41.290 finish P eviscerate Fluffy_Pillow 52.5/100: 53% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), titanic_overcharge
3:42.296 stealth_cds R shadow_dance Fluffy_Pillow 59.9/100: 60% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
3:42.296 stealthed V shadowstrike Fluffy_Pillow 60.9/100: 61% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), titanic_overcharge
3:43.300 stealthed V shadowstrike Fluffy_Pillow 57.2/100: 57% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(21), titanic_overcharge
3:44.306 finish N nightblade Fluffy_Pillow 45.5/100: 46% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), titanic_overcharge
3:45.310 stealthed V shadowstrike Fluffy_Pillow 75.8/100: 76% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage, quick_navigation(2), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), titanic_overcharge
3:46.315 stealthed V shadowstrike Fluffy_Pillow 56.1/100: 56% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage, quick_navigation(2), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge
3:47.320 finish P eviscerate Fluffy_Pillow 36.4/100: 36% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(2), masterful_navigation, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge
3:48.323 build G backstab Fluffy_Pillow 45.6/100: 46% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge
3:49.327 default F arcane_torrent Fluffy_Pillow 22.8/100: 23% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge
3:50.332 build G backstab Fluffy_Pillow 50.0/100: 50% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge(2)
3:51.336 finish P eviscerate Fluffy_Pillow 35.2/100: 35% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(13), titanic_overcharge(2)
3:52.339 build G backstab Fluffy_Pillow 36.3/100: 36% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge(2)
3:53.343 Waiting     1.866 sec 13.4/100: 13% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge(2)
3:55.209 build G backstab Fluffy_Pillow 35.9/100: 36% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge(4)
3:56.214 Waiting     1.196 sec 13.0/100: 13% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_mastery, archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(4)
3:57.410 build G backstab Fluffy_Pillow 35.4/100: 35% energy | 3.0/5: 60% combo_points quick_navigation(2), masterful_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(4)
3:58.415 Waiting     1.152 sec 12.4/100: 12% energy | 4.0/5: 80% combo_points quick_navigation(2), masterful_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(4)
3:59.567 finish N nightblade Fluffy_Pillow 26.2/100: 26% energy | 4.0/5: 80% combo_points quick_navigation(2), masterful_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(4)
4:00.572 cds H potion Fluffy_Pillow 37.2/100: 37% energy | 0.0/5: 0% combo_points quick_navigation(2), masterful_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(5)
4:00.572 build G backstab Fluffy_Pillow 37.2/100: 37% energy | 0.0/5: 0% combo_points quick_navigation(2), masterful_navigation(2), elemental_whirl_mastery, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(5), battle_potion_of_agility
4:01.577 Waiting     1.809 sec 14.2/100: 14% energy | 1.0/5: 20% combo_points quick_navigation(2), masterful_navigation(2), elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(5), battle_potion_of_agility
4:03.386 build G backstab Fluffy_Pillow 35.7/100: 36% energy | 1.0/5: 20% combo_points quick_navigation(2), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(6), battle_potion_of_agility
4:04.390 cds I symbols_of_death Fluffy_Pillow 12.6/100: 13% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
4:04.390 build G backstab Fluffy_Pillow 52.6/100: 53% energy | 2.0/5: 40% combo_points symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_versatility, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection, titanic_overcharge(6), battle_potion_of_agility
4:05.394 finish P eviscerate Fluffy_Pillow 37.6/100: 38% energy | 4.0/5: 80% combo_points symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:06.397 cds K marked_for_death Fluffy_Pillow 38.5/100: 39% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:06.397 finish P eviscerate Fluffy_Pillow 38.5/100: 39% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(2), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:07.401 stealth_cds R shadow_dance Fluffy_Pillow 45.5/100: 46% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(3), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:07.401 stealthed V shadowstrike Fluffy_Pillow 46.5/100: 47% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(2), masterful_navigation(3), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:08.405 stealthed V shadowstrike Fluffy_Pillow 42.5/100: 42% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(2), masterful_navigation(3), elemental_whirl_versatility, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:09.411 finish P eviscerate Fluffy_Pillow 30.5/100: 30% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(2), masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:10.416 stealthed V shadowstrike Fluffy_Pillow 52.4/100: 52% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(3), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:11.421 stealthed V shadowstrike Fluffy_Pillow 32.4/100: 32% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:12.425 Waiting     0.489 sec 20.4/100: 20% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation(2), masterful_navigation(4), elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:12.914 finish N nightblade Fluffy_Pillow 26.2/100: 26% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation_final, elemental_whirl_versatility, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:13.918 build G backstab Fluffy_Pillow 43.2/100: 43% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, titanic_overcharge(7), battle_potion_of_agility
4:14.923 Waiting     0.925 sec 20.9/100: 21% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(24), battle_potion_of_agility
4:15.848 build G backstab Fluffy_Pillow 40.4/100: 40% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(23), battle_potion_of_agility
4:16.851 Waiting     1.477 sec 17.9/100: 18% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(22), battle_potion_of_agility
4:18.328 build G backstab Fluffy_Pillow 36.1/100: 36% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(20), battle_potion_of_agility
4:19.333 Waiting     1.142 sec 13.4/100: 13% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(19), battle_potion_of_agility
4:20.475 finish P eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation(3), masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(18), titanic_overcharge, battle_potion_of_agility
4:21.478 build G backstab Fluffy_Pillow 42.8/100: 43% energy | 0.0/5: 0% combo_points frothing_rage, quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(17), titanic_overcharge, battle_potion_of_agility
4:22.482 Waiting     0.705 sec 20.0/100: 20% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation(3), masterful_navigation_final, archive_of_the_titans(20), resounding_protection, overwhelming_power(16), titanic_overcharge, battle_potion_of_agility
4:23.187 build G backstab Fluffy_Pillow 36.6/100: 37% energy | 2.0/5: 40% combo_points frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(15), titanic_overcharge, battle_potion_of_agility
4:24.191 Waiting     1.816 sec 13.9/100: 14% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(14), titanic_overcharge, battle_potion_of_agility
4:26.007 build G backstab Fluffy_Pillow 35.9/100: 36% energy | 3.0/5: 60% combo_points frothing_rage, quick_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(12), titanic_overcharge
4:27.012 Waiting     1.095 sec 13.0/100: 13% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(3), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(11), titanic_overcharge
4:28.107 finish N nightblade Fluffy_Pillow 26.2/100: 26% energy | 4.0/5: 80% combo_points frothing_rage, quick_navigation(3), unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(10), titanic_overcharge
4:29.111 stealth_cds R shadow_dance Fluffy_Pillow 45.2/100: 45% energy | 1.0/5: 20% combo_points frothing_rage, quick_navigation(3), masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
4:29.111 stealthed V shadowstrike Fluffy_Pillow 46.2/100: 46% energy | 1.0/5: 20% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(9), titanic_overcharge
4:30.116 stealthed V shadowstrike Fluffy_Pillow 34.3/100: 34% energy | 3.0/5: 60% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(8), titanic_overcharge(2)
4:31.120 Waiting     0.525 sec 22.3/100: 22% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(2)
4:31.645 finish P eviscerate Fluffy_Pillow 32.6/100: 33% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(7), titanic_overcharge(2)
4:32.649 stealthed V shadowstrike Fluffy_Pillow 50.5/100: 51% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage, quick_navigation(3), masterful_navigation, unstable_flames(2), archive_of_the_titans(20), resounding_protection, overwhelming_power(6), titanic_overcharge(2)
4:33.655 stealthed V shadowstrike Fluffy_Pillow 38.5/100: 39% energy | 3.0/5: 60% combo_points shadow_dance, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(5), titanic_overcharge(2)
4:34.660 cds I symbols_of_death Fluffy_Pillow 18.4/100: 18% energy | 5.0/5: 100% combo_points frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
4:34.660 finish P eviscerate Fluffy_Pillow 58.4/100: 58% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(4), titanic_overcharge(2)
4:35.665 stealth_cds R shadow_dance Fluffy_Pillow 65.3/100: 65% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(3)
4:35.665 stealthed V shadowstrike Fluffy_Pillow 66.3/100: 66% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(3), masterful_navigation(3), archive_of_the_titans(20), resounding_protection, overwhelming_power(3), titanic_overcharge(3)
4:36.669 stealthed V shadowstrike Fluffy_Pillow 62.2/100: 62% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation(4), masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power(2), titanic_overcharge(3)
4:37.674 finish P eviscerate Fluffy_Pillow 50.3/100: 50% energy | 5.0/5: 100% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, overwhelming_power, titanic_overcharge(3)
4:38.677 stealthed V shadowstrike Fluffy_Pillow 72.8/100: 73% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:39.682 stealthed V shadowstrike Fluffy_Pillow 53.2/100: 53% energy | 2.0/5: 40% combo_points shadow_dance, symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:40.686 finish P eviscerate Fluffy_Pillow 41.7/100: 42% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:41.691 cds K marked_for_death Fluffy_Pillow 49.2/100: 49% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:41.691 finish P eviscerate Fluffy_Pillow 49.2/100: 49% energy | 5.0/5: 100% combo_points symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:42.697 stealth_cds R shadow_dance Fluffy_Pillow 56.7/100: 57% energy | 0.0/5: 0% combo_points symbols_of_death, frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:42.697 stealthed V shadowstrike Fluffy_Pillow 57.7/100: 58% energy | 0.0/5: 0% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:43.702 stealthed V shadowstrike Fluffy_Pillow 54.1/100: 54% energy | 3.0/5: 60% combo_points shadow_dance, symbols_of_death, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:44.707 finish N nightblade Fluffy_Pillow 42.6/100: 43% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(3)
4:45.712 stealthed V shadowstrike Fluffy_Pillow 73.1/100: 73% energy | 0.0/5: 0% combo_points shadow_dance, frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:46.718 stealthed V shadowstrike Fluffy_Pillow 53.7/100: 54% energy | 2.0/5: 40% combo_points shadow_dance, frothing_rage, quick_navigation_final, masterful_navigation(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:47.722 finish P eviscerate Fluffy_Pillow 41.9/100: 42% energy | 5.0/5: 100% combo_points frothing_rage, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:48.726 build G backstab Fluffy_Pillow 48.5/100: 49% energy | 0.0/5: 0% combo_points masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:49.730 Waiting     0.900 sec 25.2/100: 25% energy | 1.0/5: 20% combo_points frothing_rage, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:50.630 build G backstab Fluffy_Pillow 35.6/100: 36% energy | 1.0/5: 20% combo_points frothing_rage, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:51.636 Waiting     1.299 sec 12.3/100: 12% energy | 2.0/5: 40% combo_points frothing_rage, masterful_navigation(4), unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:52.935 build G backstab Fluffy_Pillow 35.3/100: 35% energy | 3.0/5: 60% combo_points frothing_rage, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:53.942 Waiting     2.022 sec 12.0/100: 12% energy | 4.0/5: 80% combo_points frothing_rage, masterful_navigation_final, unstable_flames, archive_of_the_titans(20), resounding_protection, titanic_overcharge(4)
4:55.964 finish P eviscerate Fluffy_Pillow 35.1/100: 35% energy | 4.0/5: 80% combo_points frothing_rage, masterful_navigation_final, elemental_whirl_mastery, unstable_flames(2), archive_of_the_titans(20), resounding_protection
4:56.970 cds M shadow_dance Fluffy_Pillow 43.6/100: 44% energy | 1.0/5: 20% combo_points frothing_rage, masterful_navigation_final, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:56.970 stealthed V shadowstrike Fluffy_Pillow 44.6/100: 45% energy | 1.0/5: 20% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation_final, elemental_whirl_mastery, unstable_flames(3), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:57.975 stealthed V shadowstrike Fluffy_Pillow 32.1/100: 32% energy | 3.0/5: 60% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation_final, elemental_whirl_mastery, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:58.978 Waiting     0.581 sec 19.5/100: 20% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage, masterful_navigation_final, elemental_whirl_mastery, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge
4:59.559 finish P eviscerate Fluffy_Pillow 30.2/100: 30% energy | 5.0/5: 100% combo_points shadow_dance, master_of_shadows, frothing_rage(2), quick_navigation, masterful_navigation_final, elemental_whirl_mastery, unstable_flames(4), archive_of_the_titans(20), resounding_protection, titanic_overcharge

Stats

Level Bonus (120) Race Bonus (blood_elf) Raid-Buffed Unbuffed Gear Amount
Strength 1467 -3 1524 1464 0
Agility 1467 1 6565 6147 4387 (3433)
Stamina 1001 0 9026 8206 7205
Intellect 1467 2 1681 1469 0
Spirit 0 0 0 0 0
Health 180520 164120 0
Energy 100 100 0
Combo Points 5 5 0
Crit 22.83% 22.83% 852
Haste 13.50% 13.50% 918
Damage / Heal Versatility 0.80% 0.80% 68
Attack Power 7222 6147 0
Mastery 59.22% 59.22% 1164
Armor 1897 1897 1897
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Hood of Pestilent Ichor
ilevel: 390, stats: { 260 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Unstable Flames, Resounding Protection, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Usurper's Bloodcaked Spaulders
ilevel: 390, stats: { 240 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Vampiric Speed, Azerite Empowered }
Local Chest Jerkin of the Aberrant Chimera
ilevel: 390, stats: { 320 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Archive of the Titans, Elemental Whirl, Resounding Protection, Azerite Empowered }
Local Waist Bloodstorm Buckle
ilevel: 385, stats: { 174 Armor, +247 AgiInt, +417 Sta, +115 Mastery, +68 Vers }
Local Legs Pathogenic Legwraps
ilevel: 385, stats: { 271 Armor, +329 AgiInt, +556 Sta, +154 Haste, +91 Mastery }
Local Feet Striders of the Putrescent Path
ilevel: 385, stats: { 213 Armor, +247 AgiInt, +417 Sta, +115 Mastery, +68 Crit }
Local Wrists Wristwraps of Coursing Miasma
ilevel: 385, stats: { 135 Armor, +185 AgiInt, +312 Sta, +83 Crit, +54 Haste }
Local Hands Gloves of Descending Madness
ilevel: 385, stats: { 193 Armor, +247 AgiInt, +417 Sta, +115 Haste, +68 Crit }
Local Finger1 Ring of the Infinite Void
ilevel: 385, stats: { +312 Sta, +240 Mastery, +191 Crit }, enchant: { +37 Mastery }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Mastery }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Plasma-Spattered Greatcloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +81 Mastery, +57 Crit }
Local Main Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: quick_navigation
Local Off Hand Latticework Scalpel
ilevel: 385, weapon: { 252 - 421, 1.8 }, stats: { +164 Agi, +277 Sta, +67 Crit, +55 Haste }, enchant: masterful_navigation

Talents

Level
15 Weaponmaster (Subtlety Rogue) Find Weakness (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus (Subtlety Rogue)
45 Vigor Deeper Stratagem Marked for Death
60 Soothing Darkness (Subtlety Rogue) Cheat Death Elusiveness
75 Shot in the Dark (Subtlety Rogue) Night Terrors (Subtlety Rogue) Prey on the Weak
90 Dark Shadow (Subtlety Rogue) Alacrity (Subtlety Rogue) Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Secret Technique (Subtlety Rogue) Shuriken Tornado (Subtlety Rogue)

Profile

rogue="T22_Rogue_Subtlety"
spec=subtlety
level=120
race=blood_elf
role=attack
position=back
talents=2330031

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/augmentation
actions.precombat+=/food
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
# Used to define when to use stealth CDs or builders
actions.precombat+=/variable,name=stealth_threshold,value=60+talent.vigor.enabled*35+talent.master_of_shadows.enabled*10
actions.precombat+=/stealth
actions.precombat+=/marked_for_death,precombat_seconds=15
actions.precombat+=/shadow_blades,precombat_seconds=1
actions.precombat+=/potion

# Executed every time the actor is available.
# Check CDs at first
actions=call_action_list,name=cds
# Run fully switches to the Stealthed Rotation (by doing so, it forces pooling if nothing is available).
actions+=/run_action_list,name=stealthed,if=stealthed.all
# Apply Nightblade at 2+ CP during the first 10 seconds, after that 4+ CP if it expires within the next GCD or is not up
actions+=/nightblade,if=target.time_to_die>6&remains<gcd.max&combo_points>=4-(time<10)*2
# Consider using a Stealth CD when reaching the energy threshold and having space for at least 4 CP
actions+=/call_action_list,name=stealth_cds,if=energy.deficit<=variable.stealth_threshold&combo_points.deficit>=4
# Finish at 4+ without DS, 5+ with DS (outside stealth)
actions+=/call_action_list,name=finish,if=combo_points>=4+talent.deeper_stratagem.enabled|target.time_to_die<=1&combo_points>=3
# Use a builder when reaching the energy threshold (minus 40 if none of Alacrity, Shadow Focus, and Master of Shadows is selected)
actions+=/call_action_list,name=build,if=energy.deficit<=variable.stealth_threshold-40*!(talent.alacrity.enabled|talent.shadow_focus.enabled|talent.master_of_shadows.enabled)
# Lowest priority in all of the APL because it causes a GCD
actions+=/arcane_torrent,if=energy.deficit>=15+energy.regen
actions+=/arcane_pulse
actions+=/lights_judgment

# Shuriken Toss at 29+ Sharpened Blades stacks. 1T at Rank 1, up to 4 at Rank 2, up to 5 at Rank 3
actions.build=shuriken_toss,if=buff.sharpened_blades.stack>=29&spell_targets.shuriken_storm<=1+3*azerite.sharpened_blades.rank=2+4*azerite.sharpened_blades.rank=3
actions.build+=/shuriken_storm,if=spell_targets.shuriken_storm>=2|buff.the_dreadlords_deceit.stack>=29
actions.build+=/gloomblade
actions.build+=/backstab

actions.cds=potion,if=buff.bloodlust.react|target.time_to_die<=60|(buff.vanish.up&(buff.shadow_blades.up|cooldown.shadow_blades.remains<=30))
actions.cds+=/blood_fury,if=stealthed.rogue
actions.cds+=/berserking,if=stealthed.rogue
actions.cds+=/fireblood,if=stealthed.rogue
actions.cds+=/ancestral_call,if=stealthed.rogue
actions.cds+=/symbols_of_death,if=dot.nightblade.ticking
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit
actions.cds+=/marked_for_death,if=raid_event.adds.in>30&!stealthed.all&combo_points.deficit>=cp_max_spend
actions.cds+=/shadow_blades,if=combo_points.deficit>=2+stealthed.all
actions.cds+=/shuriken_tornado,if=spell_targets>=3&dot.nightblade.ticking&buff.symbols_of_death.up&buff.shadow_dance.up
actions.cds+=/shadow_dance,if=!buff.shadow_dance.up&target.time_to_die<=5+talent.subterfuge.enabled

# Keep up Nightblade if it is about to run out. Do not use NB during Dance, if talented into Dark Shadow.
actions.finish=nightblade,if=(!talent.dark_shadow.enabled|!buff.shadow_dance.up)&target.time_to_die-remains>6&remains<tick_time*2&(spell_targets.shuriken_storm<4|!buff.symbols_of_death.up)
# Multidotting outside Dance on targets that will live for the duration of Nightblade with refresh during pandemic if you have less than 6 targets or play with Secret Technique.
actions.finish+=/nightblade,cycle_targets=1,if=spell_targets.shuriken_storm>=2&(spell_targets.shuriken_storm<=5|talent.secret_technique.enabled)&!buff.shadow_dance.up&target.time_to_die>=(5+(2*combo_points))&refreshable
# Refresh Nightblade early if it will expire during Symbols. Do that refresh if SoD gets ready in the next 5s.
actions.finish+=/nightblade,if=remains<cooldown.symbols_of_death.remains+10&cooldown.symbols_of_death.remains<=5&target.time_to_die-remains>cooldown.symbols_of_death.remains+5
# Secret Technique during Symbols. With Dark Shadow and multiple targets also only during Shadow Dance (until threshold in next line).
actions.finish+=/secret_technique,if=buff.symbols_of_death.up&(!talent.dark_shadow.enabled|spell_targets.shuriken_storm<2|buff.shadow_dance.up)
# With enough targets always use SecTec on CD.
actions.finish+=/secret_technique,if=spell_targets.shuriken_storm>=2+talent.dark_shadow.enabled+talent.nightstalker.enabled
actions.finish+=/eviscerate

# Helper Variable
actions.stealth_cds=variable,name=shd_threshold,value=cooldown.shadow_dance.charges_fractional>=1.75
# Vanish unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
actions.stealth_cds+=/vanish,if=!variable.shd_threshold&debuff.find_weakness.remains<1
# Pool for Shadowmeld + Shadowstrike unless we are about to cap on Dance charges. Only when Find Weakness is about to run out.
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40
actions.stealth_cds+=/shadowmeld,if=energy>=40&energy.deficit>=10&!variable.shd_threshold&debuff.find_weakness.remains<1
# With Dark Shadow only Dance when Nightblade will stay up. Use during Symbols or above threshold.
actions.stealth_cds+=/shadow_dance,if=(!talent.dark_shadow.enabled|dot.nightblade.remains>=5+talent.subterfuge.enabled)&(variable.shd_threshold|buff.symbols_of_death.remains>=1.2|spell_targets>=4&cooldown.symbols_of_death.remains>10)
actions.stealth_cds+=/shadow_dance,if=target.time_to_die<cooldown.symbols_of_death.remains

# If stealth is up, we really want to use Shadowstrike to benefits from the passive bonus, even if we are at max cp (from the precombat MfD).
actions.stealthed=shadowstrike,if=buff.stealth.up
# Finish at 4+ CP without DS, 5+ with DS, and 6 with DS after Vanish
actions.stealthed+=/call_action_list,name=finish,if=combo_points.deficit<=1-(talent.deeper_stratagem.enabled&buff.vanish.up)
# At 2 targets with Secret Technique keep up Find Weakness by cycling Shadowstrike.
actions.stealthed+=/shadowstrike,cycle_targets=1,if=talent.secret_technique.enabled&talent.find_weakness.enabled&debuff.find_weakness.remains<1&spell_targets.shuriken_storm=2&target.time_to_die-remains>6
actions.stealthed+=/shuriken_storm,if=spell_targets.shuriken_storm>=3
actions.stealthed+=/shadowstrike

head=hood_of_pestilent_ichor,id=160623,bonus_id=4824/1507/4775,azerite_powers=4/483/459/15/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=usurpers_bloodcaked_spaulders,id=160620,bonus_id=4824/1507/4775,azerite_powers=4/483/30/44/13
back=plasmaspattered_greatcloak,id=160644,bonus_id=4800/1507
chest=jerkin_of_the_aberrant_chimera,id=160619,bonus_id=4824/1507/4775,azerite_powers=4/483/21/15/13
wrists=wristwraps_of_coursing_miasma,id=160621,bonus_id=4800/1507
hands=gloves_of_descending_madness,id=160618,bonus_id=4800/1507
waist=bloodstorm_buckle,id=160622,bonus_id=4800/1507
legs=pathogenic_legwraps,id=160625,bonus_id=4800/1507
feet=striders_of_the_putrescent_path,id=160729,bonus_id=4800/1507
finger1=ring_of_the_infinite_void,id=160647,bonus_id=4800/1507,enchant=pact_of_mastery
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_mastery
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=quick_navigation
off_hand=latticework_scalpel,id=160683,bonus_id=4800/1507,enchant=masterful_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=852
# gear_haste_rating=918
# gear_mastery_rating=1164
# gear_versatility_rating=68
# gear_armor=1897

T22_Shaman_Enhancement : 17193 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17193.3 17193.3 20.3 / 0.118% 3533.3 / 20.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 2.49% 55.1 100.0% 100%
Talents
  • 15: Lightning Shield (Enhancement Shaman)
  • 30: Landslide (Enhancement Shaman)
  • 60: Searing Assault (Enhancement Shaman)
  • 90: Sundering (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T22_Shaman_Enhancement 17193
Flametongue 201 (1708) 1.2% (9.9%) 29.0 10.48sec 17665 15637 Direct 29.0 1640 3278 2076 26.6% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.99 28.99 0.00 0.00 1.1297 0.0000 60184.74 60184.74 0.00 15637.00 15637.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.27 73.38% 1640.05 1591 1812 1640.47 1600 1688 34888 34888 0.00
crit 7.72 26.62% 3278.32 3182 3624 3278.90 0 3624 25297 25297 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=0} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage.
 
    Flametongue Attack 783 4.6% 627.1 0.73sec 374 0 Direct 627.1 295 590 374 26.8% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 627.08 627.08 0.00 0.00 0.0000 0.0000 234591.26 234591.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 459.28 73.24% 295.20 286 325 295.29 292 299 135578 135578 0.00
crit 167.80 26.76% 590.07 571 650 590.25 582 603 99013 99013 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=0} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.044000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Searing Assault 725 4.2% 29.0 10.48sec 7497 0 Periodic 85.8 1997 3992 2531 26.8% 0.0% 57.2%

Stats details: searing_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.99 0.00 85.85 85.85 0.0000 2.0000 217320.03 217320.03 0.00 1265.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.9 73.23% 1997.37 1942 2212 1997.83 1969 2035 125567 125567 0.00
crit 23.0 26.77% 3992.37 3885 4424 3993.10 3903 4138 91753 91753 0.00
 
 

Action details: searing_assault

Static Values
  • id:268429
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:268429
  • name:Searing Assault
  • school:fire
  • tooltip:Suffering {$s1=0} Fire damage every $t1 sec.
  • description:{$@spelldesc192087=Flametongue now causes the target to burn for $268429o1 Fire damage over {$268429d=6 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Frenetic Blow (frentic_blow) 313 1.8% 3.6 72.14sec 25907 0 Direct 3.6 20372 40743 25907 27.2% 0.0%  

Stats details: frentic_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.63 3.63 0.00 0.00 0.0000 0.0000 93963.77 134332.49 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.64 72.83% 20371.63 20372 20372 19931.54 0 20372 53813 76932 29.40
crit 0.99 27.17% 40743.26 40743 40743 27095.16 0 40743 40151 57401 19.98
 
 

Action details: frentic_blow

Static Values
  • id:278148
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278148
  • name:Frenetic Blow
  • school:physical
  • tooltip:
  • description:Deal {$s1=13489} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:27064.61
  • base_dd_max:27064.61
 
Heed My Call 158 (226) 0.9% (1.3%) 7.5 36.61sec 9009 0 Direct 7.5 4971 9943 6306 26.8% 0.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 7.53 0.00 0.00 0.0000 0.0000 47501.28 47501.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.51 73.16% 4971.42 4971 4971 4964.79 0 4971 27397 27397 0.00
crit 2.02 26.84% 9942.84 9943 9943 8741.58 0 9943 20104 20104 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 68 0.4% 7.5 36.61sec 2703 0 Direct 7.5 2131 4261 2703 26.9% 0.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 7.53 0.00 0.00 0.0000 0.0000 20363.66 20363.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.51 73.12% 2130.61 2131 2131 2128.05 0 2131 11736 11736 0.00
crit 2.02 26.88% 4261.22 4261 4261 3745.82 0 4261 8628 8628 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Laser Matrix 1310 7.6% 15.2 19.43sec 25773 0 Direct 15.2 20338 40675 25773 26.7% 0.0%  

Stats details: laser_matrix

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.25 15.25 0.00 0.00 0.0000 0.0000 392994.26 392994.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.17 73.28% 20337.62 20338 20338 20337.62 20338 20338 227245 227245 0.00
crit 4.07 26.72% 40675.25 40675 40675 40100.29 0 40675 165749 165749 0.00
 
 

Action details: laser_matrix

Static Values
  • id:280705
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:280705
  • name:Laser Matrix
  • school:arcane
  • tooltip:
  • description:{$@spelldesc280559=Your spells and abilities have a chance to release a barrage of lasers, dealing {$s1=4508} Arcane damage split among all enemies and restoring {$s2=5635} health split among injured allies. Enables $@spellname280573 within Uldir.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18900.00
  • base_dd_max:18900.00
 
Lava Lash 1371 8.0% 54.5 5.24sec 7551 6599 Direct 54.5 5957 11913 7551 26.8% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.47 54.47 0.00 0.00 1.1444 0.0000 411360.54 411360.54 0.00 6598.77 6598.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.89 73.23% 5957.24 5827 6637 5957.92 5866 6100 237658 237658 0.00
crit 14.58 26.77% 11913.20 11654 13273 11915.28 11689 12538 173703 173703 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing {$s1=0} Fire damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Lightning Shield 628 3.6% 221.9 1.96sec 847 0 Direct 220.9 670 1340 850 26.9% 0.0%  

Stats details: lightning_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 221.92 220.92 0.00 0.00 0.0000 0.0000 187866.18 187866.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.53 73.12% 670.24 647 737 670.50 656 691 108262 108262 0.00
crit 59.39 26.88% 1340.33 1295 1475 1340.84 1308 1403 79604 79604 0.00
 
 

Action details: lightning_shield

Static Values
  • id:273324
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:273324
  • name:Lightning Shield
  • school:nature
  • tooltip:
  • description:{$@spelldesc192106=Surround yourself with a shield of lightning for {$d=3600 seconds}. Melee attackers have a chance to suffer {$192109s1=0} Nature damage, and add a charge to your shield. When you Stormstrike, it gains {$s1=2} charges. At {$192106u=20} charges, the shield overcharges, causing you to deal {$273324s1=0} Nature damage with each attack and generate ${{$273323s2=10}*10} Maelstrom over {$273323d=10 seconds}.}
 
main_hand 1364 8.0% 136.3 2.21sec 3003 1544 Direct 136.3 2785 5567 3003 26.8% 19.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.33 136.33 0.00 0.00 1.9457 0.0000 409454.90 585364.96 30.05 1543.65 1543.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.89 54.20% 2784.99 2730 3114 2785.38 2750 2846 205770 294173 30.05
crit 36.58 26.84% 5567.49 5460 6229 5568.29 5492 5719 203685 291192 30.05
miss 25.86 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
offhand 680 4.0% 136.1 2.21sec 1501 769 Direct 136.1 1392 2784 1501 26.8% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.10 136.10 0.00 0.00 1.9509 0.0000 204245.65 291993.68 30.05 769.24 769.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.80 54.22% 1392.35 1365 1557 1392.54 1377 1426 102755 146900 30.05
crit 36.46 26.79% 2783.79 2730 3114 2784.17 2747 2868 101491 145094 30.05
miss 25.84 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Rockbiter 1008 5.9% 63.5 4.75sec 4758 4191 Direct 63.5 3752 7500 4758 26.8% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.54 63.54 0.00 0.00 1.1353 0.0000 302321.17 302321.17 0.00 4191.34 4191.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.48 73.15% 3752.18 3646 4152 3753.00 3683 3828 174396 174396 0.00
crit 17.06 26.85% 7499.86 7291 8304 7501.23 7299 7868 127926 127926 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormstrike 0 (4973) 0.0% (29.0%) 81.3 3.65sec 18358 16009

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.31 0.00 0.00 0.00 1.1467 0.0000 0.00 0.00 0.00 16009.22 16009.22
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:9.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:azerite.lightning_conduit.enabled&!debuff.lightning_conduit.up&active_enemies>1&(buff.stormbringer.up|(variable.OCPool70&variable.furyCheck35))
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 3315 19.3% 81.3 3.65sec 12236 0 Direct 81.3 9660 19254 12236 26.9% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.31 81.31 0.00 0.00 0.0000 0.0000 994969.18 1422427.93 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.47 73.14% 9659.74 6171 17571 9654.01 7167 12956 574517 821341 30.05
crit 21.84 26.86% 19253.57 12343 35143 19246.96 13651 27331 420452 601087 30.05
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Stormstrike Off-Hand 1658 9.7% 81.3 3.65sec 6122 0 Direct 81.3 4828 9638 6122 26.9% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.31 81.31 0.00 0.00 0.0000 0.0000 497794.12 711656.47 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.44 73.10% 4827.79 3086 8786 4825.09 3674 6234 286949 410228 30.05
crit 21.88 26.90% 9638.16 6171 17571 9632.17 6580 13651 210845 301429 30.05
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Sundering 654 3.8% 7.4 41.95sec 26436 23310 Direct 7.4 20863 41685 26435 26.8% 0.0%  

Stats details: sundering

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.42 7.42 0.00 0.00 1.1342 0.0000 196174.60 196174.60 0.00 23309.72 23309.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.43 73.24% 20862.73 20201 23007 20862.50 0 23007 113383 113383 0.00
crit 1.99 26.76% 41684.90 40402 46013 37295.33 0 46013 82791 82791 0.00
 
 

Action details: sundering

Static Values
  • id:197214
  • school:flamestrike
  • resource:maelstrom
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:40.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:197214
  • name:Sundering
  • school:flamestrike
  • tooltip:Incapacitated.
  • description:Shatters a line of earth in front of you with your main hand weapon, causing {$s1=0} Flamestrike damage and Incapacitating any enemy hit for {$d=2 seconds}.
 
Windfury Attack 325 1.9% 119.6 4.94sec 814 0 Direct 119.6 642 1284 814 26.8% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.62 119.62 0.00 0.00 0.0000 0.0000 97379.30 139215.40 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.58 73.22% 642.33 621 707 642.53 628 666 56257 80426 30.05
crit 32.03 26.78% 1283.72 1241 1414 1284.14 1248 1352 41122 58789 30.05
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=25}% chance to trigger two extra attacks, dealing $25504sw1 Physical damage each.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Windlash 341 2.0% 18.4 11.22sec 5482 3767 Direct 18.4 4356 8706 5482 25.9% 0.0%  

Stats details: windlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.40 18.40 0.00 0.00 1.4554 0.0000 100848.78 100848.78 0.00 3766.81 3766.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.63 74.11% 4356.05 3903 4452 4355.36 3966 4435 59391 59391 0.00
crit 4.76 25.89% 8706.05 7806 8905 8665.05 0 8905 41458 41458 0.00
 
 

Action details: windlash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Windlash Off-Hand 168 1.0% 18.1 11.38sec 2751 1890 Direct 18.1 2178 4352 2751 26.3% 0.0%  

Stats details: windlash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.12 18.12 0.00 0.00 1.4556 0.0000 49854.64 49854.64 0.00 1889.72 1889.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.35 73.65% 2177.72 1952 2226 2177.35 1971 2218 29072 29072 0.00
crit 4.78 26.35% 4352.19 3903 4452 4336.19 0 4452 20783 20783 0.00
 
 

Action details: windlash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals {$s1=1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Windstrike 0 (1738) 0.0% (10.0%) 17.9 11.56sec 28800 30077

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 0.00 0.00 0.00 0.9576 0.0000 0.00 0.00 0.00 30076.72 30076.72
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:9.000
  • cooldown hasted:true
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 1159 6.7% 17.9 11.56sec 19206 0 Direct 17.9 15225 30332 19206 26.4% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 17.86 0.00 0.00 0.0000 0.0000 342915.35 342915.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.15 73.65% 15225.16 8823 25121 15134.40 9615 22960 200209 200209 0.00
crit 4.71 26.35% 30331.80 17646 50241 30015.62 0 50241 142707 142707 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Windstrike Off-Hand 579 3.3% 17.9 11.56sec 9594 0 Direct 17.9 7611 15173 9595 26.2% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.86 17.86 0.00 0.00 0.0000 0.0000 171306.38 171306.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.17 73.77% 7611.33 4411 12560 7567.57 4822 11139 100256 100256 0.00
crit 4.68 26.23% 15172.64 8823 25121 15014.70 0 25121 71051 71051 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - greater_earth_elemental 288 / 69
melee 288 0.4% 54.2 3.40sec 385 290 Direct 54.2 304 607 385 26.7% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.17 54.17 0.00 0.00 1.3268 0.0000 20841.87 29795.96 30.05 289.97 289.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.69 73.27% 303.77 290 330 304.16 297 312 12057 17237 30.05
crit 14.48 26.73% 606.57 580 661 607.29 582 646 8785 12559 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - spirit_wolf 2157 / 316
melee 2157 1.8% 81.5 6.27sec 1154 1119 Direct 81.5 915 1827 1154 26.2% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.54 81.54 0.00 0.00 1.0306 0.0000 94074.06 134490.17 30.05 1119.45 1119.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.21 73.84% 915.00 862 982 915.31 901 951 55090 78758 30.05
crit 21.33 26.16% 1827.24 1724 1963 1827.79 1741 1928 38984 55732 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
T22_Shaman_Enhancement
Ascendance 2.0 181.69sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9968 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.strike.remains>0
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=66}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Shaman_Enhancement
  • harmful:false
  • if_expr:
 
Berserking 2.0 191.34sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Earth Elemental 1.5 300.45sec

Stats details: earth_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: earth_elemental

Static Values
  • id:188616
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:188616
  • name:Earth Elemental
  • school:nature
  • tooltip:
  • description:{$@spelldesc198103=Calls forth a Greater Earth Elemental to protect you and your allies for {$188616d=60 seconds}.}
 
Feral Spirit 3.0 120.44sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.1013 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Shaman_Enhancement
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T22_Shaman_Enhancement
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Wind Shear 11.4 27.16sec

Stats details: wind_shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wind_shear

Static Values
  • id:57994
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57994
  • name:Wind Shear
  • school:nature
  • tooltip:
  • description:Disrupts the target's concentration with a burst of wind, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.7sec 181.7sec 10.14% 94.44% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=66}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Battle Potion of Agility 2.0 0.0 194.7sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_battle_potion_of_agility
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:900.00

Stack Uptimes

  • battle_potion_of_agility_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279152
  • name:Battle Potion of Agility
  • tooltip:Agility increased by $w1.
  • description:Increases your Agility by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 191.5sec 191.5sec 6.74% 7.54% 0.0(0.0) 2.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259454
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Deadly Navigation 6.2 23.2 52.0sec 10.3sec 68.72% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_deadly_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:50.00

Stack Uptimes

  • deadly_navigation_1:18.03%
  • deadly_navigation_2:17.36%
  • deadly_navigation_3:16.91%
  • deadly_navigation_4:16.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268905
  • name:Deadly Navigation
  • tooltip:Increases Critical Strike by $w1.
  • description:{$@spelldesc268907=Permanently enchant a weapon to sometimes increase Critical Strike by $268905s for {$268905d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268904s Critical Strike for {$268904d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Deadly Navigation (_final) 5.5 0.0 52.1sec 52.1sec 18.13% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_deadly_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:600.00

Stack Uptimes

  • deadly_navigation_final_1:18.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268904
  • name:Deadly Navigation
  • tooltip:Increases Critical Strike by $w1.
  • description:{$@spelldesc268907=Permanently enchant a weapon to sometimes increase Critical Strike by $268905s for {$268905d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268904s Critical Strike for {$268904d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Earthlink 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_earthlink
  • max_stacks:6
  • duration:900.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:agility
  • amount:24.00

Stack Uptimes

  • earthlink_1:16.67%
  • earthlink_2:16.67%
  • earthlink_3:16.67%
  • earthlink_4:16.67%
  • earthlink_5:16.67%
  • earthlink_6:16.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279928
  • name:Earthlink
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by $w1.
  • description:{$@spelldesc279926=Azerite energy courses through you, reaching ${{$s1=11}*6} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] and then diminishing down to {$s1=11} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat], cycling every 6 sec.}
  • max_stacks:6
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Flametongue 1.1 27.9 101.7sec 10.5sec 99.52% 99.52% 27.9(27.9) 0.1

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • flametongue_1:99.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=0} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Flask of the Currents 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_flask_of_the_currents
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:238.00

Stack Uptimes

  • flask_of_the_currents_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251836
  • name:Flask of the Currents
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frothing Rage 5.0 12.2 64.1sec 17.3sec 75.53% 0.00% 0.0(0.0) 0.6

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_frothing_rage
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Frenetic Corpuscle

Stack Uptimes

  • frothing_rage_1:27.60%
  • frothing_rage_2:25.10%
  • frothing_rage_3:22.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278143
  • name:Frothing Rage
  • tooltip:Becomes Frenetic Frenzy at {$u=4} charges, causing your next attack to deal additional damage.
  • description:
  • max_stacks:4
  • duration:45.00
  • cooldown:0.00
  • default_chance:101.00%
Landslide 9.6 3.1 30.6sec 22.7sec 37.44% 39.19% 3.1(3.1) 9.2

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • landslide_1:37.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Your next Stormstrike will deal {$s1=100}% increased damage.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] has a {$h=20}% chance to increase the damage of your next Stormstrike by {$202004s1=100}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Lightning Shield 10.5 198.3 29.7sec 1.4sec 100.00% 100.00% 9.5(9.5) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_lightning_shield
  • max_stacks:20
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lightning_shield_1:10.63%
  • lightning_shield_3:9.97%
  • lightning_shield_5:10.06%
  • lightning_shield_7:10.04%
  • lightning_shield_9:9.99%
  • lightning_shield_11:9.98%
  • lightning_shield_13:9.91%
  • lightning_shield_15:9.88%
  • lightning_shield_17:9.77%
  • lightning_shield_19:9.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192106
  • name:Lightning Shield
  • tooltip:Chance to deal {$192109s1=0} Nature damage when you take melee damage.
  • description:Surround yourself with a shield of lightning for {$d=3600 seconds}. Melee attackers have a chance to suffer {$192109s1=0} Nature damage, and add a charge to your shield. When you Stormstrike, it gains {$s1=2} charges. At {$192106u=20} charges, the shield overcharges, causing you to deal {$273324s1=0} Nature damage with each attack and generate ${{$273323s2=10}*10} Maelstrom over {$273323d=10 seconds}.
  • max_stacks:20
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Lightning Shield Overcharge 9.5 0.0 31.3sec 31.3sec 31.09% 33.79% 93.0(93.0) 9.2

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_lightning_shield_overcharge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stack Uptimes

  • lightning_shield_overcharge_1:31.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:273323
  • name:Lightning Shield Overcharge
  • tooltip:Melee attacks are causing an extra {$273324s1=0} Nature damage to the target. Generating {$s2=10} Maelstrom every $t2 sec.
  • description:{$@spelldesc192106=Surround yourself with a shield of lightning for {$d=3600 seconds}. Melee attackers have a chance to suffer {$192109s1=0} Nature damage, and add a charge to your shield. When you Stormstrike, it gains {$s1=2} charges. At {$192106u=20} charges, the shield overcharges, causing you to deal {$273324s1=0} Nature damage with each attack and generate ${{$273323s2=10}*10} Maelstrom over {$273323d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Natural Harmony: Fire 1.0 717.0 0.0sec 0.4sec 99.58% 0.00% 717.0(717.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_natural_harmony_fire
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:88.00

Stack Uptimes

  • natural_harmony_fire_1:99.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279028
  • name:Natural Harmony: Fire
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc278697=Dealing Fire damage grants {$s1=0} critical strike for {$279028d=12 seconds}. Dealing Frost damage grants {$s2=0} mastery for {$279029d=12 seconds}. Dealing Nature damage grants {$s3=0} haste for {$279033d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Natural Harmony: Nature 1.0 283.5 0.0sec 1.0sec 100.00% 0.00% 283.5(283.5) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_natural_harmony_nature
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:88.00

Stack Uptimes

  • natural_harmony_nature_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279033
  • name:Natural Harmony: Nature
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc278697=Dealing Fire damage grants {$s1=0} critical strike for {$279028d=12 seconds}. Dealing Frost damage grants {$s2=0} mastery for {$279029d=12 seconds}. Dealing Nature damage grants {$s3=0} haste for {$279033d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.9 0.0 59.5sec 37.3sec 37.91% 0.00% 0.0(0.0) 0.1

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:25.00

Stack Uptimes

  • overwhelming_power_1:1.48%
  • overwhelming_power_2:1.49%
  • overwhelming_power_3:1.49%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.51%
  • overwhelming_power_6:1.51%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.52%
  • overwhelming_power_9:1.53%
  • overwhelming_power_10:1.53%
  • overwhelming_power_11:1.54%
  • overwhelming_power_12:1.54%
  • overwhelming_power_13:1.54%
  • overwhelming_power_14:1.55%
  • overwhelming_power_15:1.56%
  • overwhelming_power_16:1.56%
  • overwhelming_power_17:1.57%
  • overwhelming_power_18:1.57%
  • overwhelming_power_19:1.57%
  • overwhelming_power_20:1.58%
  • overwhelming_power_21:1.59%
  • overwhelming_power_22:1.59%
  • overwhelming_power_23:1.60%
  • overwhelming_power_24:1.63%
  • overwhelming_power_25:0.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Quick Navigation 6.2 23.1 52.2sec 10.4sec 68.95% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:18.04%
  • quick_navigation_2:17.42%
  • quick_navigation_3:17.05%
  • quick_navigation_4:16.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.5 0.0 52.3sec 52.3sec 18.07% 0.00% 0.0(0.0) 5.3

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:18.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 41.2 2.7 7.1sec 6.7sec 14.27% 41.12% 4.0(4.1) 0.0

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • stormbringer_1:14.27%

Trigger Attempt Success

  • trigger_pct:97.06%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown, deals {$s4=25}% increased damage, and its cost is reduced by {$s3=100}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to deal {$201846s4=25}% increased damage, cost {$201846s3=100}% less Maelstrom, and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Titanic Overcharge 12.2 33.3 25.2sec 6.6sec 85.53% 0.00% 3.7(3.7) 11.4

Buff details

  • buff initial source:T22_Shaman_Enhancement
  • cooldown name:buff_titanic_overcharge
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Construct Overcharger

Stat Buff details

  • stat:haste_rating
  • amount:40.51

Stack Uptimes

  • titanic_overcharge_1:22.99%
  • titanic_overcharge_2:16.84%
  • titanic_overcharge_3:12.23%
  • titanic_overcharge_4:9.00%
  • titanic_overcharge_5:6.64%
  • titanic_overcharge_6:4.82%
  • titanic_overcharge_7:3.49%
  • titanic_overcharge_8:9.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:278070
  • name:Titanic Overcharge
  • tooltip:Haste increased by $w1.
  • description:Your attacks have a chance to increase your Haste by {$s1=36} for {$d=10 seconds}, stacking up to {$u=8} times.
  • max_stacks:8
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Flametongue: Windfury Attack 119.1 5.0sec
Lightning Shield Overcharge: Windfury Attack 41.5 13.2sec
Maelstrom Weapon: Windfury Attack 119.6 4.9sec
Stormbringer: Windfury Attack 7.5 35.4sec
Flametongue: main_hand 109.6 2.7sec
Lightning Shield Overcharge: main_hand 33.6 8.1sec
Maelstrom Weapon: main_hand 110.5 2.7sec
Stormbringer: main_hand 6.9 36.0sec
Windfury: main_hand 29.0 10.0sec
Flametongue: Windlash 18.3 11.3sec
Lightning Shield Overcharge: Windlash 6.3 30.4sec
Maelstrom Weapon: Windlash 18.4 11.2sec
Stormbringer: Windlash 1.2 82.2sec
Windfury: Windlash 4.8 43.4sec
Flametongue: offhand 109.4 2.7sec
Lightning Shield Overcharge: offhand 33.7 8.1sec
Maelstrom Weapon: offhand 110.3 2.7sec
Stormbringer: offhand 6.8 36.4sec
Flametongue: Windlash Off-Hand 18.0 11.4sec
Lightning Shield Overcharge: Windlash Off-Hand 6.2 30.3sec
Maelstrom Weapon: Windlash Off-Hand 18.1 11.4sec
Stormbringer: Windlash Off-Hand 1.2 84.4sec
Stormbringer: Rockbiter 4.0 54.9sec
Lightning Shield Overcharge: Windstrike 7.1 27.8sec
Flametongue: Windstrike 17.7 11.6sec
Stormbringer: Windstrike 1.1 75.5sec
Windfury: Windstrike 4.7 43.7sec
Flametongue: Windstrike Off-Hand 17.7 11.6sec
Lightning Shield Overcharge: Windstrike Off-Hand 7.1 27.8sec
Stormbringer: Windstrike Off-Hand 1.1 75.5sec
Stormbringer: Flametongue 1.8 80.8sec
Lightning Shield Overcharge: Sundering 2.2 82.4sec
Lightning Shield Overcharge: Stormstrike 32.1 8.5sec
Flametongue: Stormstrike 81.3 3.7sec
Stormbringer: Stormstrike 5.1 43.2sec
Windfury: Stormstrike 21.3 13.2sec
Flametongue: Stormstrike Off-Hand 81.3 3.7sec
Lightning Shield Overcharge: Stormstrike Off-Hand 32.1 8.5sec
Stormbringer: Stormstrike Off-Hand 5.1 43.4sec
Flametongue: Lava Lash 54.5 5.2sec
Lightning Shield Overcharge: Lava Lash 19.0 14.4sec
Stormbringer: Lava Lash 3.4 58.7sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Wind Shear15.3820.00136.750158.238115.904227.993
Rockbiter1.2040.0017.96717.3190.31252.605
Windstrike1.1750.0013.68514.3121.98130.342
Flametongue1.6380.00120.72841.05510.43581.684
Feral Spirit0.5730.0013.3960.8650.0004.216
Ascendance2.0070.00124.8651.7040.00024.865
Sundering2.2430.00147.09212.5360.21157.364
Stormstrike1.3680.0017.398106.24342.860189.558

Resources

Resource Usage Type Count Total Average RPE APR
T22_Shaman_Enhancement
lava_lash Maelstrom 54.5 2178.9 40.0 40.0 188.8
stormstrike Maelstrom 81.3 1371.4 16.9 16.9 1088.5
sundering Maelstrom 7.4 148.4 20.0 20.0 1321.8
windstrike Maelstrom 17.9 126.8 7.1 7.1 4054.8
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 119.62 478.42 (12.32%) 4.00 119.66 20.01%
Main Hand Maelstrom 110.47 492.99 (12.70%) 4.46 59.36 10.75%
Windlash Maelstrom 18.40 46.98 (1.21%) 2.55 45.00 48.92%
Off-Hand Maelstrom 110.26 487.17 (12.55%) 4.42 64.12 11.63%
Windlash Off-Hand Maelstrom 18.13 43.95 (1.13%) 2.43 46.67 51.50%
Rockbiter Maelstrom 63.54 1356.01 (34.93%) 21.34 232.38 14.63%
Feral Spirit Maelstrom 81.54 273.14 (7.04%) 3.35 134.58 33.01%
mana_regen Mana 194.13 0.00 (0.00%) 0.00 190856.21 100.00%
Lightning Shield Overcharge Maelstrom 93.04 703.81 (18.13%) 7.56 226.63 24.36%
Resource RPS-Gain RPS-Loss
Maelstrom 12.94 12.75
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Maelstrom 57.06 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T22_Shaman_Enhancement Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data T22_Shaman_Enhancement Damage Per Second
Count 7499
Mean 17193.27
Minimum 14314.86
Maximum 21375.80
Spread ( max - min ) 7060.94
Range [ ( max - min ) / 2 * 100% ] 20.53%
Standard Deviation 898.4951
5th Percentile 15760.02
95th Percentile 18703.90
( 95th Percentile - 5th Percentile ) 2943.88
Mean Distribution
Standard Deviation 10.3756
95.00% Confidence Intervall ( 17172.94 - 17213.61 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10491
0.1 Scale Factor Error with Delta=300 6892
0.05 Scale Factor Error with Delta=300 27567
0.01 Scale Factor Error with Delta=300 689153
Priority Target DPS
Sample Data T22_Shaman_Enhancement Priority Target Damage Per Second
Count 7499
Mean 17193.27
Minimum 14314.86
Maximum 21375.80
Spread ( max - min ) 7060.94
Range [ ( max - min ) / 2 * 100% ] 20.53%
Standard Deviation 898.4951
5th Percentile 15760.02
95th Percentile 18703.90
( 95th Percentile - 5th Percentile ) 2943.88
Mean Distribution
Standard Deviation 10.3756
95.00% Confidence Intervall ( 17172.94 - 17213.61 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10491
0.1 Scale Factor Error with Delta=300 6892
0.05 Scale Factor Error with Delta=300 27567
0.01 Scale Factor Error with Delta=300 689153
DPS(e)
Sample Data T22_Shaman_Enhancement Damage Per Second (Effective)
Count 7499
Mean 17193.27
Minimum 14314.86
Maximum 21375.80
Spread ( max - min ) 7060.94
Range [ ( max - min ) / 2 * 100% ] 20.53%
Damage
Sample Data T22_Shaman_Enhancement Damage
Count 7499
Mean 5033409.77
Minimum 3462835.50
Maximum 6624956.23
Spread ( max - min ) 3162120.73
Range [ ( max - min ) / 2 * 100% ] 31.41%
DTPS
Sample Data T22_Shaman_Enhancement Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Shaman_Enhancement Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Shaman_Enhancement Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Shaman_Enhancement Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Shaman_Enhancement Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Shaman_Enhancement Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Shaman_EnhancementTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Shaman_Enhancement Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
6 11.44 wind_shear
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck35,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>35))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool80,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>80)))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>70)))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>60)))
7 1.00 auto_attack
0.00 use_items
8 0.00 call_action_list,name=opener
9 0.00 call_action_list,name=asc,if=buff.ascendance.up
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=cds
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.asc
# count action,conditions
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
E 5.23 rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
F 17.86 windstrike
actions.buffs
# count action,conditions
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
G 20.29 rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
0.00 fury_of_air,if=!ticking&maelstrom>=20
H 1.08 flametongue,if=!buff.flametongue.up
0.00 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck25
I 2.20 flametongue,if=buff.flametongue.remains<4.8+gcd
0.00 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8+gcd&variable.furyCheck25
0.00 totem_mastery,if=buff.resonance_totem.remains<2
actions.cds
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
J 2.00 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
K 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
L 2.98 feral_spirit
M 2.00 ascendance,if=cooldown.strike.remains>0
N 1.47 earth_elemental
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 sundering,if=active_enemies>=3
0.00 stormstrike,cycle_targets=1,if=azerite.lightning_conduit.enabled&!debuff.lightning_conduit.up&active_enemies>1&(buff.stormbringer.up|(variable.OCPool70&variable.furyCheck35))
O 35.58 stormstrike,if=buff.stormbringer.up|(buff.gathering_storms.up&variable.OCPool70&variable.furyCheck35)
0.00 crash_lightning,if=active_enemies>=3&variable.furyCheck25
0.00 lightning_bolt,if=talent.overcharge.enabled&active_enemies=1&variable.furyCheck45&maelstrom>=40
P 45.73 stormstrike,if=variable.OCPool70&variable.furyCheck35
Q 7.42 sundering
0.00 crash_lightning,if=talent.forceful_winds.enabled&active_enemies>1&variable.furyCheck25
R 25.71 flametongue,if=talent.searing_assault.enabled
0.00 lava_lash,if=buff.hot_hand.react
0.00 crash_lightning,if=active_enemies>1&variable.furyCheck25
actions.filler
# count action,conditions
S 37.01 rockbiter,if=maelstrom<70
0.00 crash_lightning,if=talent.crashing_storm.enabled&variable.OCPool60
T 54.47 lava_lash,if=variable.OCPool80&variable.furyCheck45
0.00 rockbiter
0.00 flametongue
actions.opener
# count action,conditions
U 1.00 rockbiter,if=maelstrom<15&time<gcd

Sample Sequence

012457UH6LJNPGMFFEFFEFFFIEFFQEFFEOPROGPTTSTRPSSTTSPROPS6TTSTPRSTTSPOOOOOPGIQTSPSOPOOOOG6IPTGTOGOPRTSTSPSTRTTPOPGQRGTPST6STRPSTTLSPRTSTTPSTRTOOPGOOPRGQTGP6TOPOPRSSTTS6PRSOOOPTSRTTPSOPOPG6MFJKQEFFFEFHFEFTGOP6RGTOPSOOPRTTSTPG6TRTGOPQSTRSPSLTTSP6RTOPTSTTRGPT6SOPTROGPOPQSRTSPSTTSRP6STSOPR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T22_Shaman_Enhancement 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom
Pre precombat 1 food T22_Shaman_Enhancement 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom
Pre precombat 2 augmentation T22_Shaman_Enhancement 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom battle_potion_of_agility
Pre precombat 5 lightning_shield Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom battle_potion_of_agility
0:00.000 default 7 auto_attack Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom battle_potion_of_agility
0:00.000 opener U rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom frothing_rage, quick_navigation, deadly_navigation, titanic_overcharge, battle_potion_of_agility
0:01.246 buffs H flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom bloodlust, natural_harmony_nature, frothing_rage, quick_navigation, deadly_navigation, overwhelming_power(24), titanic_overcharge, battle_potion_of_agility
0:02.133 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation, deadly_navigation, overwhelming_power(23), titanic_overcharge, battle_potion_of_agility
0:02.133 cds L feral_spirit Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation, deadly_navigation, overwhelming_power(23), titanic_overcharge, battle_potion_of_agility
0:03.021 cds J berserking Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation, deadly_navigation, overwhelming_power(22), titanic_overcharge(2), battle_potion_of_agility
0:03.021 cds N earth_elemental Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation, deadly_navigation, overwhelming_power(22), titanic_overcharge(2), battle_potion_of_agility
0:03.021 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation, deadly_navigation, overwhelming_power(22), titanic_overcharge(2), battle_potion_of_agility
0:03.793 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation, deadly_navigation, overwhelming_power(22), titanic_overcharge(2), battle_potion_of_agility
0:04.566 cds M ascendance Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom bloodlust, berserking, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation, deadly_navigation, overwhelming_power(20), titanic_overcharge(2), battle_potion_of_agility
0:05.342 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation, deadly_navigation, overwhelming_power(19), titanic_overcharge(2), battle_potion_of_agility
0:06.120 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, frothing_rage, quick_navigation(2), deadly_navigation, overwhelming_power(18), titanic_overcharge(2), battle_potion_of_agility
0:06.897 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(2), overwhelming_power(18), titanic_overcharge(3), battle_potion_of_agility
0:07.670 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(2), overwhelming_power(17), titanic_overcharge(3), battle_potion_of_agility
0:08.448 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, frothing_rage, quick_navigation(2), deadly_navigation(2), overwhelming_power(16), titanic_overcharge(3), battle_potion_of_agility
0:09.227 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, frothing_rage, quick_navigation(2), deadly_navigation(2), overwhelming_power(15), titanic_overcharge(3), battle_potion_of_agility
0:10.006 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, frothing_rage, quick_navigation(2), deadly_navigation(2), overwhelming_power(14), titanic_overcharge(3), battle_potion_of_agility
0:10.789 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, frothing_rage, quick_navigation(2), deadly_navigation(2), overwhelming_power(14), titanic_overcharge(3), battle_potion_of_agility
0:11.571 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(2), overwhelming_power(13), titanic_overcharge(3), battle_potion_of_agility
0:12.355 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, berserking, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(2), overwhelming_power(12), titanic_overcharge(4), battle_potion_of_agility
0:13.137 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(2), overwhelming_power(11), titanic_overcharge(4), battle_potion_of_agility
0:14.038 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power(10), titanic_overcharge(5), battle_potion_of_agility
0:14.933 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power(10), titanic_overcharge(6), battle_potion_of_agility
0:15.826 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power(8), titanic_overcharge(6), battle_potion_of_agility
0:16.723 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power(7), titanic_overcharge(6), battle_potion_of_agility
0:17.621 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power(6), titanic_overcharge(6), battle_potion_of_agility
0:18.521 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power(5), titanic_overcharge(6), battle_potion_of_agility
0:19.425 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power(4), titanic_overcharge(6), battle_potion_of_agility
0:20.333 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power(3), titanic_overcharge(6), battle_potion_of_agility
0:21.243 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power(2), titanic_overcharge(7), battle_potion_of_agility
0:22.151 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(2), overwhelming_power, titanic_overcharge(8), battle_potion_of_agility
0:23.057 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:23.967 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:24.875 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, flametongue, landslide, frothing_rage, quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:25.784 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:26.692 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:27.601 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:28.509 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:29.418 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:30.326 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:31.232 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 10.0/100: 10% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(3), quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:32.139 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(3), quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:33.049 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(3), quick_navigation(3), deadly_navigation(2), titanic_overcharge(8)
0:33.955 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(3), quick_navigation(3), deadly_navigation(3), titanic_overcharge(8)
0:34.864 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation(3), titanic_overcharge(8)
0:35.772 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation(3), titanic_overcharge(8)
0:36.679 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(3), quick_navigation(3), deadly_navigation(3), titanic_overcharge(8)
0:37.586 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, stormbringer, frothing_rage(3), quick_navigation(3), deadly_navigation(3), titanic_overcharge(8)
0:38.494 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, quick_navigation(3), deadly_navigation(4), titanic_overcharge(8)
0:39.403 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, quick_navigation(3), deadly_navigation(4), titanic_overcharge(8)
0:40.314 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(4), titanic_overcharge(8)
0:40.314 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom bloodlust, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(4), titanic_overcharge(8)
0:41.223 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(4), titanic_overcharge(8)
0:42.402 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(3), deadly_navigation(4), titanic_overcharge(8)
0:43.585 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(24), titanic_overcharge(8)
0:44.682 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(23), titanic_overcharge(8)
0:45.782 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(22), titanic_overcharge(8)
0:46.885 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(21), titanic_overcharge(8)
0:47.991 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(20), titanic_overcharge(8)
0:49.100 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(18)
0:50.256 Waiting     0.900 sec 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(17)
0:51.156 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(16)
0:52.498 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), flametongue, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(15)
0:53.666 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), flametongue, stormbringer, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(14), titanic_overcharge
0:54.830 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, stormbringer, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(13), titanic_overcharge
0:55.999 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, stormbringer, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(12), titanic_overcharge
0:57.169 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, stormbringer, frothing_rage, quick_navigation(4), deadly_navigation(4), overwhelming_power(10), titanic_overcharge
0:58.346 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, stormbringer, frothing_rage, quick_navigation_final, deadly_navigation(4), overwhelming_power(9), titanic_overcharge
0:59.475 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation_final, deadly_navigation(4), overwhelming_power(8), titanic_overcharge
1:00.606 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage, quick_navigation_final, deadly_navigation(4), overwhelming_power(7), titanic_overcharge
1:01.741 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage, quick_navigation_final, deadly_navigation(4), overwhelming_power(6), titanic_overcharge
1:02.880 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage, quick_navigation_final, deadly_navigation(4), overwhelming_power(5)
1:04.026 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage, quick_navigation_final, deadly_navigation_final, overwhelming_power(3)
1:05.180 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation_final, overwhelming_power(2)
1:06.336 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation_final, overwhelming_power, titanic_overcharge
1:07.490 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), deadly_navigation_final, titanic_overcharge
1:08.730 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, stormbringer, frothing_rage(2), deadly_navigation_final, titanic_overcharge(2)
1:09.966 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), deadly_navigation_final, titanic_overcharge(4)
1:11.192 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), deadly_navigation_final, titanic_overcharge(5)
1:12.410 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation, deadly_navigation_final, titanic_overcharge(5)
1:13.621 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(2), titanic_overcharge(5)
1:14.824 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(2), titanic_overcharge(5)
1:16.027 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(2), titanic_overcharge(5)
1:17.230 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(2), titanic_overcharge(5)
1:17.230 buffs I flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(2), titanic_overcharge(5)
1:18.431 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(2), titanic_overcharge(6)
1:19.628 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation(2), titanic_overcharge(6)
1:20.825 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation(2), titanic_overcharge(6)
1:22.022 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation(2), titanic_overcharge(6)
1:23.218 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, stormbringer, frothing_rage(2), quick_navigation(2), titanic_overcharge(6)
1:24.415 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, stormbringer, frothing_rage(2), quick_navigation(2), titanic_overcharge(6)
1:25.612 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(2), titanic_overcharge(6)
1:26.809 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation(2), deadly_navigation, titanic_overcharge(6)
1:28.006 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation(2), deadly_navigation
1:29.239 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation(2), deadly_navigation
1:30.471 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation(2), deadly_navigation(2), titanic_overcharge
1:31.696 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation(2), deadly_navigation(2), titanic_overcharge
1:32.923 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation(2), deadly_navigation(3), titanic_overcharge
1:34.151 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation(2), deadly_navigation(4), titanic_overcharge
1:35.375 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(2), deadly_navigation(4), titanic_overcharge
1:36.601 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(3), deadly_navigation_final, titanic_overcharge
1:37.819 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(3), deadly_navigation_final, titanic_overcharge(2)
1:39.032 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge(2)
1:40.240 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge(2)
1:41.446 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge(2)
1:42.652 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge(2)
1:43.859 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge(3)
1:45.061 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge(3)
1:46.262 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(2), quick_navigation(4), titanic_overcharge(4)
1:47.457 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(2), quick_navigation(4), titanic_overcharge(4)
1:48.653 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(2), quick_navigation(4), titanic_overcharge(4)
1:49.847 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(2), quick_navigation(4), titanic_overcharge(4)
1:51.041 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, quick_navigation(4), titanic_overcharge(4)
1:52.236 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation(4), titanic_overcharge(5)
1:53.427 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation_final, titanic_overcharge(5)
1:54.562 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation_final, titanic_overcharge(6)
1:54.562 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation_final, titanic_overcharge(6)
1:55.694 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation_final, overwhelming_power(25), titanic_overcharge(6)
1:56.753 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, quick_navigation_final, overwhelming_power(24), titanic_overcharge(6)
1:57.816 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, overwhelming_power(23), titanic_overcharge(7)
1:58.877 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, overwhelming_power(22), titanic_overcharge(7)
1:59.941 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, overwhelming_power(21), titanic_overcharge(7)
2:01.006 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, overwhelming_power(19), titanic_overcharge(7)
2:02.077 cds L feral_spirit Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, overwhelming_power(18), titanic_overcharge(8)
2:03.203 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, deadly_navigation(2), overwhelming_power(17), titanic_overcharge(8)
2:04.349 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, frothing_rage, deadly_navigation(2), overwhelming_power(16), titanic_overcharge(8)
2:05.495 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, deadly_navigation(2), overwhelming_power(15), titanic_overcharge(8)
2:06.647 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, deadly_navigation(2), overwhelming_power(14), titanic_overcharge(8)
2:07.801 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, deadly_navigation(3), overwhelming_power(13), titanic_overcharge(8)
2:08.957 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, deadly_navigation(3), overwhelming_power(12), titanic_overcharge(8)
2:10.118 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, deadly_navigation(3), overwhelming_power(10), titanic_overcharge(8)
2:11.285 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage, deadly_navigation(3), overwhelming_power(9), titanic_overcharge(8)
2:12.452 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage, deadly_navigation_final, overwhelming_power(8)
2:13.670 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, deadly_navigation_final, overwhelming_power(7)
2:14.892 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(2), deadly_navigation_final, overwhelming_power(6)
2:16.135 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage(2), quick_navigation, deadly_navigation_final, overwhelming_power(4), titanic_overcharge
2:17.356 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, stormbringer, frothing_rage(2), quick_navigation, deadly_navigation_final, overwhelming_power(3), titanic_overcharge
2:18.579 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, stormbringer, frothing_rage(2), quick_navigation, deadly_navigation_final, overwhelming_power(2), titanic_overcharge
2:19.804 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), quick_navigation(2), deadly_navigation_final, overwhelming_power, titanic_overcharge
2:21.028 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(2), deadly_navigation_final, titanic_overcharge
2:22.254 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), quick_navigation(2), deadly_navigation_final, titanic_overcharge
2:23.482 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), quick_navigation(2), titanic_overcharge
2:24.709 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(2), titanic_overcharge(2)
2:25.928 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(3), titanic_overcharge(3)
2:27.135 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(3), overwhelming_power(25), titanic_overcharge(3)
2:28.260 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(3), overwhelming_power(24), titanic_overcharge(3)
2:29.389 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(3), overwhelming_power(23), titanic_overcharge(3)
2:30.521 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage(2), quick_navigation(3), overwhelming_power(22), titanic_overcharge(3)
2:31.656 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation, overwhelming_power(21), titanic_overcharge(3)
2:32.795 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(2), overwhelming_power(20), titanic_overcharge(3)
2:32.795 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(2), overwhelming_power(20), titanic_overcharge(3)
2:33.936 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(3), deadly_navigation(2), overwhelming_power(19), titanic_overcharge(3)
2:35.079 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(2), overwhelming_power(17)
2:36.245 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(3), deadly_navigation(2), overwhelming_power(16)
2:37.416 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 30.0/100: 30% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(3), overwhelming_power(15)
2:38.587 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 0.0/100: 0% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(3), overwhelming_power(14)
2:39.763 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(3), overwhelming_power(13), titanic_overcharge
2:40.937 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage(2), quick_navigation(3), deadly_navigation(3), overwhelming_power(12), titanic_overcharge(2)
2:42.110 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(3), overwhelming_power(10), titanic_overcharge(2)
2:43.289 Waiting     0.800 sec 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(3), overwhelming_power(9), titanic_overcharge(2)
2:44.089 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(4), overwhelming_power(8), titanic_overcharge(2)
2:45.274 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 5.0/100: 5% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(4), overwhelming_power(7), titanic_overcharge(2)
2:46.465 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(4), overwhelming_power(6), titanic_overcharge(2)
2:46.465 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(4), overwhelming_power(6), titanic_overcharge(2)
2:47.657 Waiting     0.100 sec 20000.0/20000: 100% mana | 10.0/100: 10% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(4), overwhelming_power(5), titanic_overcharge(3)
2:47.757 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 10.0/100: 10% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(4), overwhelming_power(5), titanic_overcharge(3)
2:49.196 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation(3), deadly_navigation(4), overwhelming_power(3), titanic_overcharge(3)
2:50.400 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(4), deadly_navigation(4), overwhelming_power(2), titanic_overcharge(4)
2:51.587 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(4), deadly_navigation(4), overwhelming_power, titanic_overcharge(5)
2:52.772 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(4), deadly_navigation(4), titanic_overcharge(5)
2:53.962 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation(4), deadly_navigation(4), titanic_overcharge(5)
2:55.152 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(4), titanic_overcharge(5)
2:56.289 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(4), titanic_overcharge(6)
2:57.422 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(4), titanic_overcharge(6)
2:58.552 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(4), titanic_overcharge(6)
2:59.685 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, landslide, quick_navigation_final, deadly_navigation(4), titanic_overcharge(6)
3:00.817 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, quick_navigation_final, deadly_navigation(4), titanic_overcharge(6)
3:01.950 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 25.0/100: 25% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, landslide, quick_navigation_final, deadly_navigation_final, titanic_overcharge(6)
3:03.082 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, landslide, stormbringer, quick_navigation_final, deadly_navigation_final, titanic_overcharge(6)
3:04.213 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, deadly_navigation_final, titanic_overcharge(6)
3:05.425 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, stormbringer, deadly_navigation_final
3:06.672 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, quick_navigation, deadly_navigation_final
3:07.913 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation, deadly_navigation_final, titanic_overcharge
3:09.147 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation, deadly_navigation_final, titanic_overcharge
3:09.147 cds M ascendance Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation, deadly_navigation_final, titanic_overcharge
3:10.382 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation, deadly_navigation_final, titanic_overcharge(2)
3:11.611 cds J berserking Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, quick_navigation(2), titanic_overcharge(3)
3:11.611 cds K potion Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, quick_navigation(2), titanic_overcharge(3)
3:11.611 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, quick_navigation(2), titanic_overcharge(3), battle_potion_of_agility
3:12.670 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(3), titanic_overcharge(3), battle_potion_of_agility
3:13.721 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, quick_navigation(3), titanic_overcharge(4), battle_potion_of_agility
3:14.769 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation(4), titanic_overcharge(4), battle_potion_of_agility
3:15.808 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), titanic_overcharge(4), battle_potion_of_agility
3:16.849 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), titanic_overcharge(4), battle_potion_of_agility
3:17.888 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(4), titanic_overcharge(4), battle_potion_of_agility
3:18.961 buffs H flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, frothing_rage, quick_navigation(4), titanic_overcharge(5), battle_potion_of_agility
3:19.996 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage, quick_navigation(4), titanic_overcharge(5), battle_potion_of_agility
3:21.029 asc E rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom berserking, ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, titanic_overcharge(5), battle_potion_of_agility
3:22.018 asc F windstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(9), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, titanic_overcharge(5), battle_potion_of_agility
3:23.154 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom ascendance, natural_harmony_fire, natural_harmony_nature, lightning_shield(11), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation_final, titanic_overcharge(5), battle_potion_of_agility
3:24.291 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, stormbringer, frothing_rage, quick_navigation_final, deadly_navigation, titanic_overcharge(5), battle_potion_of_agility
3:25.428 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, stormbringer, frothing_rage, quick_navigation_final, deadly_navigation, titanic_overcharge(5), battle_potion_of_agility
3:26.564 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, titanic_overcharge(5), battle_potion_of_agility
3:27.701 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, titanic_overcharge(5), battle_potion_of_agility
3:27.701 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, titanic_overcharge(5), battle_potion_of_agility
3:28.861 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, battle_potion_of_agility
3:30.024 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, frothing_rage, quick_navigation_final, deadly_navigation, battle_potion_of_agility
3:31.188 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, stormbringer, frothing_rage, deadly_navigation, battle_potion_of_agility
3:32.436 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, frothing_rage, deadly_navigation, battle_potion_of_agility
3:33.683 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage, deadly_navigation, titanic_overcharge, battle_potion_of_agility
3:34.925 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, stormbringer, frothing_rage, quick_navigation, deadly_navigation, titanic_overcharge, battle_potion_of_agility
3:36.161 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, landslide, stormbringer, frothing_rage, quick_navigation, deadly_navigation, titanic_overcharge, battle_potion_of_agility
3:37.397 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, landslide, frothing_rage, quick_navigation, deadly_navigation, titanic_overcharge
3:38.631 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage, quick_navigation, deadly_navigation, titanic_overcharge(2)
3:39.860 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage, quick_navigation, deadly_navigation, titanic_overcharge(2)
3:41.088 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage, quick_navigation(2), deadly_navigation, titanic_overcharge(2)
3:42.308 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage, quick_navigation(2), deadly_navigation, titanic_overcharge(2)
3:43.527 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 95.0/100: 95% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, landslide, frothing_rage, quick_navigation(2), deadly_navigation, titanic_overcharge(2)
3:44.749 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage, quick_navigation(2), deadly_navigation(2), titanic_overcharge(2)
3:45.970 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation(2), deadly_navigation(2), titanic_overcharge(2)
3:47.190 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(3), titanic_overcharge(2)
3:47.190 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(3), titanic_overcharge(2)
3:48.403 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(3)
3:49.630 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, frothing_rage, quick_navigation(3), deadly_navigation(4)
3:50.855 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 35.0/100: 35% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation(4)
3:52.079 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, stormbringer, frothing_rage, quick_navigation(3), deadly_navigation_final
3:53.304 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, frothing_rage, quick_navigation(3), deadly_navigation_final
3:54.530 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(4), deadly_navigation_final, titanic_overcharge
3:55.744 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage, quick_navigation(4), deadly_navigation_final, titanic_overcharge
3:56.956 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge
3:58.167 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge
3:59.379 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 60.0/100: 60% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge
4:00.592 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, frothing_rage(2), quick_navigation(4), deadly_navigation_final, titanic_overcharge
4:01.804 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 65.0/100: 65% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation(4), titanic_overcharge
4:03.017 cds L feral_spirit Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation(4), titanic_overcharge
4:04.230 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation(4), titanic_overcharge
4:05.442 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation(4)
4:06.662 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, frothing_rage(2), quick_navigation(4), titanic_overcharge
4:07.874 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage(2), quick_navigation(4), titanic_overcharge
4:09.087 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(2), quick_navigation(4), titanic_overcharge
4:09.087 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(2), quick_navigation(4), titanic_overcharge
4:10.300 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, frothing_rage(2), quick_navigation(4), deadly_navigation, titanic_overcharge
4:11.513 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(4), deadly_navigation(2), titanic_overcharge
4:12.725 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(2), titanic_overcharge
4:13.882 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(2), titanic_overcharge
4:15.039 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(2), titanic_overcharge(2)
4:16.193 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 90.0/100: 90% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, landslide, frothing_rage(2), quick_navigation_final, deadly_navigation(2), titanic_overcharge(2)
4:17.345 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(2), titanic_overcharge(2)
4:18.497 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(2), titanic_overcharge(2)
4:19.650 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(2), titanic_overcharge(2)
4:20.802 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(3), titanic_overcharge(2)
4:21.954 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation_final, deadly_navigation(3), titanic_overcharge(2)
4:23.107 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), deadly_navigation(3), titanic_overcharge(2)
4:23.107 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation, deadly_navigation(3), titanic_overcharge(2)
4:24.335 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), quick_navigation, deadly_navigation(3), titanic_overcharge(3)
4:25.557 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(3), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation, deadly_navigation(4), titanic_overcharge(3)
4:26.779 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation, deadly_navigation(4), titanic_overcharge(3)
4:28.002 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation, deadly_navigation(4), titanic_overcharge(3)
4:29.242 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(5), lightning_shield_overcharge, flametongue, stormbringer, frothing_rage(2), quick_navigation(2), deadly_navigation_final, titanic_overcharge(3)
4:30.456 buffs G rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), lightning_shield_overcharge, flametongue, frothing_rage(2), quick_navigation(2), deadly_navigation_final, titanic_overcharge(3)
4:31.669 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 100.0/100: 100% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(7), flametongue, landslide, frothing_rage(2), quick_navigation(2), deadly_navigation_final, titanic_overcharge(3)
4:32.883 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 75.0/100: 75% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(9), flametongue, landslide, stormbringer, frothing_rage(2), quick_navigation(2), deadly_navigation_final, titanic_overcharge(3)
4:34.096 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 80.0/100: 80% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(11), flametongue, landslide, frothing_rage(2), quick_navigation(2), deadly_navigation_final
4:35.328 core Q sundering Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage(3), quick_navigation(2), deadly_navigation_final
4:36.561 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, frothing_rage(3), quick_navigation(2), deadly_navigation_final
4:37.792 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 70.0/100: 70% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(2), deadly_navigation_final, titanic_overcharge
4:39.017 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(2), titanic_overcharge
4:40.243 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, landslide, quick_navigation(2), titanic_overcharge(2)
4:41.464 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(13), flametongue, quick_navigation(2), titanic_overcharge(2)
4:42.683 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, quick_navigation(2), titanic_overcharge(2)
4:43.903 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 85.0/100: 85% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, quick_navigation(2), titanic_overcharge(2)
4:45.123 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, quick_navigation(2), titanic_overcharge(2)
4:46.343 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 10.0/100: 10% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, quick_navigation(2), titanic_overcharge(2)
4:47.564 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, quick_navigation(2), titanic_overcharge(3)
4:48.778 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 45.0/100: 45% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(15), flametongue, quick_navigation(2), overwhelming_power(24), titanic_overcharge(3)
4:49.913 default 6 wind_shear Fluffy_Pillow 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation(2), overwhelming_power(23), titanic_overcharge(3)
4:49.913 Waiting     0.800 sec 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation(2), overwhelming_power(23), titanic_overcharge(3)
4:50.713 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation(2), overwhelming_power(22), titanic_overcharge(3)
4:52.059 filler T lava_lash Fluffy_Pillow 20000.0/20000: 100% mana | 50.0/100: 50% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation(2), overwhelming_power(20), titanic_overcharge(3)
4:53.205 Waiting     2.100 sec 20000.0/20000: 100% mana | 15.0/100: 15% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation(2), overwhelming_power(19), titanic_overcharge(3)
4:55.305 filler S rockbiter Fluffy_Pillow 20000.0/20000: 100% mana | 20.0/100: 20% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, quick_navigation(2), deadly_navigation(2), overwhelming_power(17), titanic_overcharge(3)
4:56.653 core O stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(17), flametongue, stormbringer, quick_navigation(3), deadly_navigation(2), overwhelming_power(16)
4:57.822 core P stormstrike Fluffy_Pillow 20000.0/20000: 100% mana | 55.0/100: 55% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield(19), flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(15)
4:58.993 core R flametongue Fluffy_Pillow 20000.0/20000: 100% mana | 40.0/100: 40% maelstrom natural_harmony_fire, natural_harmony_nature, lightning_shield, lightning_shield_overcharge, flametongue, quick_navigation(3), deadly_navigation(2), overwhelming_power(14)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 6566 6148 4387 (3433)
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 1676 1464 0
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 20000 20000 0
Maelstrom 100 100 0
Spell Power 8540 7341 0
Crit 22.86% 22.86% 926
Haste 19.31% 19.31% 1313
Damage / Heal Versatility 2.48% 2.48% 211
ManaReg per Second 640 640 0
Attack Power 7223 6148 0
Mastery 31.36% 31.36% 553
Armor 2738 2738 2738
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 386.00
Local Head Crest of the Undying Visionary
ilevel: 390, stats: { 381 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Natural Harmony, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Spaulders of Coagulated Viscera
ilevel: 390, stats: { 352 Armor, +491 AgiInt, +892 Sta }
azerite powers: { Laser Matrix, Heed My Call, Azerite Empowered }
Local Chest C'thraxxi General's Hauberk
ilevel: 390, stats: { 469 Armor, +655 AgiInt, +1189 Sta }
azerite powers: { Laser Matrix, Earthlink, Azerite Empowered }
Local Waist Titanspark Energy Girdle
ilevel: 385, stats: { 255 Armor, +247 AgiInt, +417 Sta, +96 Haste, +88 Crit }
Local Legs Blighted Anima Greaves
ilevel: 385, stats: { 397 Armor, +329 AgiInt, +556 Sta, +149 Haste, +96 Vers }
Local Feet Fused Monstrosity Stompers
ilevel: 385, stats: { 312 Armor, +247 AgiInt, +417 Sta, +115 Vers, +68 Crit }
Local Wrists Rubywrought Sparkguards
ilevel: 385, stats: { 198 Armor, +185 AgiInt, +312 Sta, +78 Haste, +60 Mastery }
Local Hands Oblivion Crushers
ilevel: 385, stats: { 283 Armor, +247 AgiInt, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Finger2 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Trinket1 Construct Overcharger
ilevel: 385, stats: { +313 Agi }
Local Trinket2 Frenetic Corpuscle
ilevel: 385, stats: { +313 Agi }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Mother's Twin Gaze
ilevel: 385, weapon: { 424 - 547, 2.6 }, stats: { +164 Agi, +277 Sta, +69 Haste, +53 Crit }, enchant: quick_navigation
Local Off Hand Mother's Twin Gaze
ilevel: 385, weapon: { 424 - 547, 2.6 }, stats: { +164 Agi, +277 Sta, +69 Haste, +53 Crit }, enchant: deadly_navigation

Talents

Level
15 Boulderfist (Enhancement Shaman) Hot Hand (Enhancement Shaman) Lightning Shield (Enhancement Shaman)
30 Landslide (Enhancement Shaman) Forceful Winds (Enhancement Shaman) Totem Mastery (Enhancement Shaman)
45 Spirit Wolf (Enhancement Shaman) Earth Shield (Enhancement Shaman) Static Charge (Enhancement Shaman)
60 Searing Assault (Enhancement Shaman) Hailstorm (Enhancement Shaman) Overcharge (Enhancement Shaman)
75 Nature's Guardian Feral Lunge (Enhancement Shaman) Wind Rush Totem
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Elemental Spirits (Enhancement Shaman) Earthen Spike (Enhancement Shaman) Ascendance (Enhancement Shaman)

Profile

shaman="T22_Shaman_Enhancement"
spec=enhancement
level=120
race=troll
role=attack
position=back
talents=3101033

# Default consumables
potion=battle_potion_of_agility
flask=currents
food=bountiful_captains_feast
augmentation=battle_scarred

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck35,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>35))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool80,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>80)))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>70)))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|active_enemies>1|(talent.overcharge.enabled&active_enemies=1&(cooldown.lightning_bolt.remains>=2*gcd|maelstrom>60)))
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/call_action_list,name=asc,if=buff.ascendance.up
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.asc=crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
actions.asc+=/rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
actions.asc+=/windstrike

actions.buffs=crash_lightning,if=!buff.crash_lightning.up&active_enemies>1&variable.furyCheck25
actions.buffs+=/rockbiter,if=talent.landslide.enabled&!buff.landslide.up&charges_fractional>1.7
actions.buffs+=/fury_of_air,if=!ticking&maelstrom>=20
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck25
actions.buffs+=/flametongue,if=buff.flametongue.remains<4.8+gcd
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8+gcd&variable.furyCheck25
actions.buffs+=/totem_mastery,if=buff.resonance_totem.remains<2

# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions.cds=bloodlust,if=target.health.pct<25|time>0.500
actions.cds+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.cds+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.cds+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.cds+=/feral_spirit
actions.cds+=/ascendance,if=cooldown.strike.remains>0
actions.cds+=/earth_elemental

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/stormstrike,cycle_targets=1,if=azerite.lightning_conduit.enabled&!debuff.lightning_conduit.up&active_enemies>1&(buff.stormbringer.up|(variable.OCPool70&variable.furyCheck35))
actions.core+=/stormstrike,if=buff.stormbringer.up|(buff.gathering_storms.up&variable.OCPool70&variable.furyCheck35)
actions.core+=/crash_lightning,if=active_enemies>=3&variable.furyCheck25
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&active_enemies=1&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=variable.OCPool70&variable.furyCheck35
actions.core+=/sundering
actions.core+=/crash_lightning,if=talent.forceful_winds.enabled&active_enemies>1&variable.furyCheck25
actions.core+=/flametongue,if=talent.searing_assault.enabled
actions.core+=/lava_lash,if=buff.hot_hand.react
actions.core+=/crash_lightning,if=active_enemies>1&variable.furyCheck25

actions.filler=rockbiter,if=maelstrom<70
actions.filler+=/crash_lightning,if=talent.crashing_storm.enabled&variable.OCPool60
actions.filler+=/lava_lash,if=variable.OCPool80&variable.furyCheck45
actions.filler+=/rockbiter
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<gcd

head=crest_of_the_undying_visionary,id=160630,bonus_id=4824/1507/4775,azerite_powers=416/30/0/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536
shoulders=spaulders_of_coagulated_viscera,id=160731,bonus_id=4824/1507/4775,azerite_powers=485/22/0/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=cthraxxi_generals_hauberk,id=160725,bonus_id=4824/1507/4775,azerite_powers=485/461/0/13
wrists=rubywrought_sparkguards,id=160629,bonus_id=4800/1507
hands=oblivion_crushers,id=160721,bonus_id=4800/1507
waist=titanspark_energy_girdle,id=160633,bonus_id=4800/1507
legs=blighted_anima_greaves,id=160716,bonus_id=4800/1507
feet=fused_monstrosity_stompers,id=160628,bonus_id=4800/1507
finger1=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
finger2=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=construct_overcharger,id=160652,bonus_id=4800/1507
trinket2=frenetic_corpuscle,id=160648,bonus_id=4800/1507
main_hand=mothers_twin_gaze,id=160682,bonus_id=4800/1507,enchant=quick_navigation
off_hand=mothers_twin_gaze,id=160682,bonus_id=4800/1507,enchant=deadly_navigation

# Gear Summary
# gear_ilvl=386.19
# gear_agility=4387
# gear_stamina=7205
# gear_crit_rating=926
# gear_haste_rating=1313
# gear_mastery_rating=553
# gear_versatility_rating=211
# gear_armor=2738

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:
Total Events Processed: 274799768
Max Event Queue: 407
Sim Seconds: 2250297
CPU Seconds: 518.3689
Physical Seconds: 260.8828
Speed Up: 4341

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
T22_Death_Knight_Blood T22_Death_Knight_Blood augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood auto_attack_mh 0 746123 2487 25.08 4782 9563 125.4 125.4 24.8% 0.0% 0.0% 3.0% 2.40sec 1076253 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood blood_boil 50842 326737 1089 11.24 4626 9246 56.2 56.2 25.7% 0.0% 0.0% 0.0% 5.34sec 326737 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood blood_plague ticks -55078 118614 395 19.75 956 1912 56.2 98.8 25.6% 0.0% 0.0% 0.0% 5.34sec 118614 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood blood_shield 77535 6640 22 31.47 42 0 44.4 157.3 0.0% 0.0% 0.0% 0.0% 6.55sec 3666982 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood dancing_rune_weapon 49028 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.30sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood death_and_decay 43265 114143 380 32.83 553 1106 15.2 164.2 25.7% 0.0% 0.0% 0.0% 19.48sec 114143 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood death_strike 49998 546989 1823 8.89 9871 19759 44.4 44.4 25.0% 0.0% 0.0% 3.0% 6.55sec 789094 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood death_strike_heal 45470 12930 43 8.89 291 0 44.4 44.4 0.0% 0.0% 0.0% 0.0% 6.55sec 1089480 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood heart_strike 206930 282982 943 17.43 2607 5215 87.2 87.2 24.9% 0.0% 0.0% 3.0% 3.38sec 408218 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood marrowrend 195182 119240 397 4.73 4071 8125 23.7 23.7 24.2% 0.0% 0.0% 3.0% 12.85sec 172009 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood mind_freeze 47528 0 0 0.00 0 0 10.6 0.0 0.0% 0.0% 0.0% 0.0% 29.37sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood rune_strike 210764 66116 220 1.61 6606 13216 8.0 8.0 24.8% 0.0% 0.0% 3.0% 38.21sec 95373 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood touch_of_the_grave 127802 69038 230 3.59 3059 6109 18.0 18.0 25.7% 0.0% 0.0% 0.0% 17.04sec 69038 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood unholy_strength 53365 4810 16 4.74 203 0 23.7 23.7 0.0% 0.0% 0.0% 0.0% 12.62sec 451277 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood wasting_infection ticks -278110 31501 105 8.63 581 1162 7.8 43.2 25.6% 0.0% 0.0% 0.0% 35.40sec 31501 300.00sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon blood_boil 50842 7038 297 8.66 1655 3302 3.4 3.4 24.6% 0.0% 0.0% 0.0% 76.39sec 7038 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon blood_plague ticks -55078 9271 31 4.50 328 655 3.4 22.5 25.8% 0.0% 0.0% 0.0% 76.39sec 9271 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon death_strike 49998 15732 664 9.68 3275 6557 3.8 3.8 25.6% 0.0% 0.0% 0.0% 42.35sec 22490 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon heart_strike 206930 8916 376 19.63 914 1826 7.8 7.8 25.9% 0.0% 0.0% 0.0% 35.24sec 12746 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon main_hand 0 17083 721 20.06 1723 3442 7.9 7.9 25.3% 0.0% 0.0% 0.0% 34.77sec 24422 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon marrowrend 195182 6690 282 9.47 1452 2903 3.7 3.7 23.3% 0.0% 0.0% 0.0% 42.64sec 9565 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_dancing_rune_weapon rune_strike 210764 5949 251 5.07 2370 4739 2.0 2.0 25.5% 0.0% 0.0% 0.0% 2.53sec 8504 23.69sec
T22_Death_Knight_Blood T22_Death_Knight_Blood_bloodworm main_hand 0 246794 1254 122.79 487 974 402.9 402.9 25.7% 0.0% 0.0% 0.0% 0.73sec 352822 196.88sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery a_murder_of_crows ticks -131894 381813 1273 17.05 3319 7139 5.5 85.3 30.3% 0.0% 0.0% 0.0% 60.59sec 545848 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery aspect_of_the_wild 193530 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.78sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery auto_shot 75 569822 1899 23.90 3721 7581 119.8 119.5 27.1% 0.0% 0.0% 0.0% 2.51sec 814629 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery azerite_globules 279958 39517 132 2.65 2386 4776 13.2 13.2 25.1% 0.0% 0.0% 0.0% 22.36sec 39517 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery barbed_shot ticks -217200 89894 300 26.23 686 0 37.1 131.1 0.0% 0.0% 0.0% 0.0% 8.08sec 128514 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery_cat stomp 201754 173945 580 7.42 3562 7634 37.1 37.1 27.6% 0.0% 0.0% 0.0% 8.08sec 248675 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery bestial_wrath 19574 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 37.93sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery blood_fury 20572 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.86sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery chimaera_shot 53209 0 0 0.00 0 0 23.2 0.0 0.0% 0.0% 0.0% 0.0% 13.09sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery chimaera_shot_frost 171454 124034 413 2.32 8354 17088 0.0 11.6 27.0% 0.0% 0.0% 0.0% 0.00sec 124034 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery chimaera_shot_nature 171457 124007 413 2.32 8354 17082 0.0 11.6 27.0% 0.0% 0.0% 0.0% 0.00sec 124007 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery cobra_shot 193455 453650 1512 17.21 4091 8361 86.3 86.1 27.6% 0.0% 0.0% 0.0% 3.43sec 648547 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery frentic_blow 278148 76078 254 0.60 20443 40888 3.0 3.0 24.9% 0.0% 0.0% 0.0% 81.20sec 108763 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery heed_my_call 271685 84571 282 1.35 10046 20093 6.7 6.7 25.1% 0.0% 0.0% 0.0% 40.23sec 84571 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery heed_my_call_aoe 271686 36280 121 1.35 4306 8611 6.7 6.7 25.2% 0.0% 0.0% 0.0% 40.23sec 36280 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery kill_command 34026 0 0 0.00 0 0 55.3 0.0 0.0% 0.0% 0.0% 0.0% 5.42sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery_cat kill_command 83381 906963 3023 11.05 12539 26705 55.3 55.3 27.3% 0.0% 0.0% 0.0% 5.42sec 1296612 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery_cat claw 16827 896196 2987 16.77 8187 17435 83.8 83.8 27.0% 0.0% 0.0% 0.0% 3.60sec 1281219 300.00sec
T22_Hunter_Beast_Mastery T22_Hunter_Beast_Mastery_cat melee 0 874205 2914 57.82 2318 4926 289.1 289.1 27.1% 0.0% 0.0% 0.0% 1.03sec 1249780 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship aimed_shot 19434 1613734 5379 7.21 30135 60345 35.1 36.1 48.4% 0.0% 0.0% 0.0% 8.44sec 2307027 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship arcane_shot 185358 839221 2797 10.95 13105 26215 54.8 54.7 17.0% 0.0% 0.0% 0.0% 5.42sec 839221 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship auto_shot 75 493177 1644 21.19 3975 7950 106.2 105.9 17.1% 0.0% 0.0% 0.0% 2.83sec 705056 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship frentic_blow 278148 84626 282 0.65 22092 44185 3.3 3.3 17.2% 0.0% 0.0% 0.0% 77.57sec 120982 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship heed_my_call 271685 133735 446 1.41 16174 32348 7.1 7.1 17.2% 0.0% 0.0% 0.0% 38.67sec 133735 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship heed_my_call_aoe 271686 57322 191 1.41 6932 13864 7.1 7.1 17.2% 0.0% 0.0% 0.0% 38.67sec 57322 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship hunters_mark 257284 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship kul_tiran_cannonball_runner 271197 48415 161 10.48 789 1578 52.4 52.4 17.1% 0.0% 0.0% 0.0% 5.15sec 48415 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship lights_judgment 255647 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 150.51sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship lights_judgment_damage 256893 94357 315 0.49 32615 65191 2.5 2.5 17.3% 0.0% 0.0% 0.0% 150.53sec 94357 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship rapid_fire ticks -257044 480057 1600 29.77 2507 5004 14.9 148.9 29.2% 0.0% 0.0% 0.0% 20.66sec 686298 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship serpent_sting 271788 60845 203 5.04 2063 4126 25.3 25.2 17.1% 0.0% 0.0% 0.0% 11.96sec 352852 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship serpent_sting ticks -271788 292007 973 24.65 2024 4046 25.3 123.2 17.1% 0.0% 0.0% 0.0% 11.96sec 352852 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship steady_shot 56641 457068 1524 13.56 5754 11508 67.9 67.8 17.1% 0.0% 0.0% 0.0% 4.26sec 653434 300.00sec
T22_Hunter_Marksmanship T22_Hunter_Marksmanship trueshot 193526 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.24sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival auto_attack_mh 0 660431 2201 24.43 4453 8902 122.2 122.2 21.4% 0.0% 0.0% 0.0% 2.45sec 944166 300.00sec
T22_Hunter_Survival T22_Hunter_Survival azerite_globules 279958 43421 145 2.97 2405 4811 14.9 14.9 21.4% 0.0% 0.0% 0.0% 19.95sec 43421 300.00sec
T22_Hunter_Survival T22_Hunter_Survival coordinated_assault 266779 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.35sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival flanking_strike 269751 0 0 0.00 0 0 7.7 0.0 0.0% 0.0% 0.0% 0.0% 41.47sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival flanking_strike_damage 269752 78466 262 1.53 8404 16804 0.0 7.7 21.7% 0.0% 0.0% 0.0% 0.00sec 112177 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat flanking_strike 259516 64573 215 1.53 6913 13849 7.7 7.7 21.7% 0.0% 0.0% 0.0% 41.47sec 92315 300.00sec
T22_Hunter_Survival T22_Hunter_Survival flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival frentic_blow 278148 92316 308 0.74 20699 41398 3.7 3.7 20.9% 0.0% 0.0% 0.0% 71.73sec 131977 300.00sec
T22_Hunter_Survival T22_Hunter_Survival harpoon 190925 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival kill_command 259489 0 0 0.00 0 0 77.8 0.0 0.0% 0.0% 0.0% 0.0% 3.80sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat kill_command 259277 327736 1092 15.56 3470 6942 77.8 77.8 21.4% 0.0% 0.0% 0.0% 3.80sec 662229 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat kill_command ticks -259277 193691 646 39.00 819 1637 77.8 195.0 21.3% 0.0% 0.0% 0.0% 3.80sec 662229 300.00sec
T22_Hunter_Survival T22_Hunter_Survival potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival raptor_strike 186270 1127373 3758 19.61 9467 18948 98.0 98.0 21.4% 0.0% 0.0% 0.0% 3.03sec 1611715 300.00sec
T22_Hunter_Survival T22_Hunter_Survival serpent_sting 259491 304210 1014 8.28 6049 12086 41.4 41.4 21.5% 0.0% 0.0% 0.0% 7.28sec 786005 300.00sec
T22_Hunter_Survival T22_Hunter_Survival serpent_sting ticks -259491 481795 1606 26.66 2979 5960 41.4 133.3 21.3% 0.0% 0.0% 0.0% 7.28sec 786005 300.00sec
T22_Hunter_Survival T22_Hunter_Survival latent_poison 273289 442811 1476 17.52 4159 8331 87.6 87.6 21.5% 0.0% 0.0% 0.0% 3.40sec 442811 300.00sec
T22_Hunter_Survival T22_Hunter_Survival summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival wildfire_bomb 259495 0 0 0.00 0 0 30.9 0.0 0.0% 0.0% 0.0% 0.0% 9.77sec 0 300.00sec
T22_Hunter_Survival T22_Hunter_Survival wildfire_bomb_impact 265157 342145 1140 6.18 9117 18232 0.0 30.9 21.4% 0.0% 0.0% 0.0% 0.00sec 342145 300.00sec
T22_Hunter_Survival T22_Hunter_Survival wildfire_bomb_dot ticks -269747 333030 1110 36.38 1508 3016 0.0 181.9 21.4% 0.0% 0.0% 0.0% 0.00sec 333030 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat claw 16827 328602 1095 16.74 3231 6468 83.7 83.7 21.5% 0.0% 0.0% 0.0% 3.61sec 469776 300.00sec
T22_Hunter_Survival T22_Hunter_Survival_cat melee 0 412452 1375 48.41 1404 2808 242.1 242.1 21.4% 0.0% 0.0% 0.0% 1.24sec 589650 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution avenging_wrath 31884 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.33sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution blade_of_justice 184575 473727 1579 9.03 8153 17061 45.2 45.2 26.2% 0.0% 0.0% 0.0% 6.67sec 677249 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution crusader_strike 35395 337042 1123 12.35 4265 8876 61.8 61.8 25.8% 0.0% 0.0% 0.0% 4.66sec 481842 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution hammer_of_wrath 24275 260681 869 3.59 10562 22336 18.0 18.0 33.5% 0.0% 0.0% 0.0% 17.04sec 260681 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution heed_my_call 271685 50118 167 1.56 5060 10121 7.8 7.8 26.7% 0.0% 0.0% 0.0% 35.42sec 50118 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution heed_my_call_aoe 271686 21381 71 1.56 2169 4338 7.8 7.8 26.1% 0.0% 0.0% 0.0% 35.42sec 21381 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution inquisition 84963 0 0 0.00 0 0 7.3 0.0 0.0% 0.0% 0.0% 0.0% 43.89sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution judgment 20271 409905 1366 6.65 9596 20042 33.3 33.3 26.1% 0.0% 0.0% 0.0% 9.08sec 409905 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution laser_matrix 280705 411607 1372 3.15 20702 41404 15.8 15.8 26.2% 0.0% 0.0% 0.0% 18.71sec 411607 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution melee 0 603744 2012 23.09 4113 8325 115.5 115.5 26.5% 0.0% 0.0% 0.0% 2.59sec 863125 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution rebuke 96231 0 0 0.00 0 0 10.4 0.0 0.0% 0.0% 0.0% 0.0% 30.06sec 0 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution shield_of_vengeance 184662 0 0 0.60 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 120.33sec 145220 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution shield_of_vengeance_proc 184689 139381 465 0.57 48574 0 3.0 2.9 0.0% 0.0% 0.0% 0.0% 119.83sec 139381 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution templars_verdict 85256 2357839 7859 14.04 25860 54238 70.2 70.2 27.2% 0.0% 0.0% 0.0% 4.21sec 2357839 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution voided_sectors 278153 116013 387 1.96 9354 18708 9.8 9.8 26.2% 0.0% 0.0% 0.0% 28.77sec 116013 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution wake_of_ashes 255937 195928 653 1.34 22562 47366 6.7 6.7 27.1% 0.0% 0.0% 0.0% 47.79sec 195928 300.00sec
T22_Paladin_Retribution T22_Paladin_Retribution wasting_infection ticks -278110 31438 105 8.60 577 1154 7.8 43.0 26.7% 0.0% 0.0% 0.0% 35.44sec 31438 300.00sec
T22_Priest_Shadow T22_Priest_Shadow augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow dark_ascension 280711 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.38sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow dark_ascension_damage 280800 135658 452 2.18 8608 25611 5.5 10.9 22.5% 0.0% 0.0% 0.0% 60.38sec 135658 300.00sec
T22_Priest_Shadow T22_Priest_Shadow flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow heed_my_call 271685 43367 145 1.47 4824 9650 7.4 7.4 22.0% 0.0% 0.0% 0.0% 37.49sec 43367 300.00sec
T22_Priest_Shadow T22_Priest_Shadow heed_my_call_aoe 271686 18598 62 1.47 2067 4135 7.4 7.4 22.0% 0.0% 0.0% 0.0% 37.49sec 18598 300.00sec
T22_Priest_Shadow T22_Priest_Shadow mind_blast 205351 766788 2556 10.04 12481 24865 49.2 50.2 22.5% 0.0% 0.0% 0.0% 5.99sec 766788 300.00sec
T22_Priest_Shadow T22_Priest_Shadow mind_flay ticks -15407 734511 2448 39.62 3024 6014 76.2 198.1 22.9% 0.0% 0.0% 0.0% 3.84sec 734511 300.00sec
T22_Priest_Shadow T22_Priest_Shadow mindbender 200174 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 60.68sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_crash 205385 0 0 0.00 0 0 14.8 0.0 0.0% 0.0% 0.0% 0.0% 20.76sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_crash_damage 205386 163812 546 2.95 9176 18288 14.7 14.7 21.3% 0.0% 0.0% 0.0% 20.76sec 163812 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_word_pain 589 18203 61 1.51 1981 3953 7.5 7.5 22.0% 0.0% 0.0% 0.0% 41.46sec 464835 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadow_word_pain ticks -589 446632 1489 38.48 1904 3794 7.5 192.4 22.1% 0.0% 0.0% 0.0% 41.46sec 464835 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadowy_apparitions 78203 0 0 0.00 0 0 42.5 0.0 0.0% 0.0% 0.0% 0.0% 6.84sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadowy_apparition 148859 76552 255 8.38 1828 0 41.9 41.9 0.0% 0.0% 0.0% 0.0% 6.83sec 76552 300.00sec
T22_Priest_Shadow T22_Priest_Shadow shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow vampiric_touch ticks -34914 382210 1274 25.41 2465 4909 5.8 127.1 22.2% 0.0% 0.0% 0.0% 54.20sec 382210 300.00sec
T22_Priest_Shadow T22_Priest_Shadow void_bolt 205448 831219 2771 12.73 10822 21608 63.8 63.7 20.7% 0.0% 0.0% 0.0% 4.70sec 831219 300.00sec
T22_Priest_Shadow T22_Priest_Shadow void_eruption 228260 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 60.04sec 0 300.00sec
T22_Priest_Shadow T22_Priest_Shadow void_eruption_damage 228360 116820 389 1.94 8403 25088 4.9 9.7 22.0% 0.0% 0.0% 0.0% 60.04sec 116820 300.00sec
T22_Priest_Shadow T22_Priest_Shadow volatile_blood_explosion 278057 51767 173 1.46 5802 11608 7.4 7.3 22.2% 0.0% 0.0% 0.0% 37.27sec 51767 300.00sec
T22_Priest_Shadow T22_Priest_Shadow_mindbender melee 0 351178 4424 52.82 4180 8359 69.9 69.9 20.2% 0.0% 0.0% 0.0% 4.05sec 351178 79.38sec
T22_Rogue_Assassination T22_Rogue_Assassination augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination auto_attack_mh 0 568455 1895 44.47 2373 4735 222.3 222.3 26.9% 19.0% 0.0% 0.0% 1.35sec 812675 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination auto_attack_oh 1 281181 937 44.06 1184 2366 220.3 220.3 26.9% 19.0% 0.0% 0.0% 1.36sec 401982 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 240.20sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination deadly_poison_dot ticks -2818 327001 1090 39.58 1303 2601 504.8 197.9 26.9% 0.0% 0.0% 0.0% 0.77sec 327001 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination deadly_poison_instant 113780 609359 2031 100.75 954 1904 503.8 503.8 26.9% 0.0% 0.0% 0.0% 0.77sec 609359 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination envenom 32645 795074 2650 7.92 15819 31576 39.6 39.6 27.1% 0.0% 0.0% 0.0% 7.50sec 795074 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination frentic_blow 278148 92942 310 0.72 20390 40778 3.6 3.6 27.1% 0.0% 0.0% 0.0% 73.03sec 132872 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination garrote ticks -703 715154 2384 39.66 2849 5668 16.9 198.3 26.9% 0.0% 0.0% 0.0% 18.11sec 715154 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination mutilate 1329 0 0 0.00 0 0 93.8 0.0 0.0% 0.0% 0.0% 0.0% 3.20sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination mutilate_mh 5374 434068 1447 18.76 3647 7287 93.8 93.8 26.9% 0.0% 0.0% 0.0% 3.20sec 620552 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination mutilate_oh 27576 217031 723 18.76 1824 3643 93.8 93.8 26.9% 0.0% 0.0% 0.0% 3.20sec 310271 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination poison_bomb 255546 121467 405 7.92 2419 4829 39.6 39.6 26.9% 0.0% 0.0% 0.0% 6.52sec 121467 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination rupture ticks -1943 580171 1934 39.31 2327 4647 13.3 196.5 26.9% 0.0% 0.0% 0.0% 22.54sec 580171 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination toxic_blade 245388 153687 512 2.44 9929 19797 12.2 12.2 27.0% 0.0% 0.0% 0.0% 25.17sec 153687 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination vanish 1856 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 127.69sec 0 300.00sec
T22_Rogue_Assassination T22_Rogue_Assassination vendetta 79140 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.10sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw adrenaline_rush 13750 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 72.70sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw ambush 8676 72085 240 1.33 8488 17283 6.6 6.6 27.1% 0.0% 0.0% 0.0% 57.21sec 103055 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw auto_attack_mh 0 739813 2466 42.84 3110 6344 214.2 214.2 29.0% 19.1% 0.0% 0.0% 1.41sec 1057652 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw auto_attack_oh 1 365463 1218 42.28 1555 3172 211.4 211.4 29.0% 19.0% 0.0% 0.0% 1.42sec 522474 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw between_the_eyes 199804 221106 737 1.63 7600 31274 8.2 8.2 82.3% 0.0% 0.0% 0.0% 24.67sec 316098 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw dispatch 2098 1104274 3681 11.69 14529 29703 58.5 58.5 28.7% 0.0% 0.0% 0.0% 5.01sec 1578692 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw frentic_blow 278148 110601 369 0.80 21095 43019 4.0 4.0 30.0% 0.0% 0.0% 0.0% 66.70sec 158117 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw killing_spree 51690 0 0 0.00 0 0 5.7 0.0 0.0% 0.0% 0.0% 0.0% 49.98sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw killing_spree_mh ticks -57841 97142 324 0.00 2191 4466 33.8 0.0 30.0% 0.0% 0.0% 0.0% 7.15sec 138877 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw killing_spree_oh ticks -57842 97165 324 0.00 2191 4467 33.8 0.0 30.0% 0.0% 0.0% 0.0% 7.15sec 138910 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw main_gauche 86392 632143 2107 23.41 4129 8423 117.1 117.1 29.6% 0.0% 0.0% 0.0% 2.65sec 903725 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw pistol_shot 185763 523957 1747 10.25 7829 15910 51.2 51.2 29.7% 0.0% 0.0% 0.0% 5.77sec 749060 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw roll_the_bones 193316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.23sec 0 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw sinister_strike 193315 964489 3215 36.59 4025 8183 131.4 183.0 30.0% 0.0% 0.0% 0.0% 2.27sec 1378853 300.00sec
T22_Rogue_Outlaw T22_Rogue_Outlaw vanish 1856 0 0 0.00 0 0 5.6 0.0 0.0% 0.0% 0.0% 0.0% 57.21sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety arcane_torrent 25046 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 91.05sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety auto_attack_mh 0 529696 1766 42.03 2391 4783 210.1 210.1 24.5% 19.0% 0.0% 0.0% 1.43sec 682729 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety auto_attack_oh 1 262929 876 41.70 1196 2392 208.5 208.5 24.5% 19.0% 0.0% 0.0% 1.44sec 338934 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety backstab 53 464562 1549 13.48 5538 11075 67.4 67.4 24.4% 0.0% 0.0% 0.0% 4.19sec 608241 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety eviscerate 196819 1915943 6386 12.17 25329 50683 60.8 60.8 24.3% 0.0% 0.0% 0.0% 4.92sec 2452097 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety frentic_blow 278148 80997 270 0.65 20091 40186 3.2 3.2 24.5% 0.0% 0.0% 0.0% 77.46sec 115795 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety marked_for_death 137619 0 0 0.00 0 0 9.8 0.0 0.0% 0.0% 0.0% 0.0% 34.32sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety nightblade ticks -195452 634128 2114 36.84 2768 5534 19.8 184.2 24.4% 0.0% 0.0% 0.0% 15.06sec 634128 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadow_blades 121471 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.08sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadow_blades_attack 279043 118657 396 4.49 5280 0 22.5 22.5 0.0% 0.0% 0.0% 0.0% 9.60sec 118657 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadow_dance 185313 0 0 0.00 0 0 22.7 0.0 0.0% 0.0% 0.0% 0.0% 13.48sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety shadowstrike 185438 968327 3228 17.67 8818 17636 88.4 88.4 24.3% 0.0% 0.0% 0.0% 3.42sec 1234108 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety symbols_of_death 212283 0 0 0.00 0 0 10.3 0.0 0.0% 0.0% 0.0% 0.0% 30.27sec 0 300.00sec
T22_Rogue_Subtlety T22_Rogue_Subtlety vanish 1856 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 129.75sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.69sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 191.34sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement earth_elemental 188616 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.45sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.44sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement flametongue 193796 60185 201 5.80 1640 3278 29.0 29.0 26.6% 0.0% 0.0% 0.0% 10.48sec 60185 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement flametongue_attack 10444 234591 782 125.42 295 590 627.1 627.1 26.8% 0.0% 0.0% 0.0% 0.73sec 234591 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement searing_assault ticks -268429 217320 724 17.17 1997 3992 29.0 85.8 26.8% 0.0% 0.0% 0.0% 10.48sec 217320 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement frentic_blow 278148 93964 313 0.73 20372 40743 3.6 3.6 27.2% 0.0% 0.0% 0.0% 72.14sec 134332 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement heed_my_call 271685 47501 158 1.51 4971 9943 7.5 7.5 26.8% 0.0% 0.0% 0.0% 36.61sec 47501 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement heed_my_call_aoe 271686 20364 68 1.51 2131 4261 7.5 7.5 26.9% 0.0% 0.0% 0.0% 36.61sec 20364 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement laser_matrix 280705 392994 1310 3.05 20338 40675 15.2 15.2 26.7% 0.0% 0.0% 0.0% 19.43sec 392994 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement lava_lash 60103 411361 1371 10.89 5957 11913 54.5 54.5 26.8% 0.0% 0.0% 0.0% 5.24sec 411361 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement lightning_shield 273324 187866 626 44.18 670 1340 221.9 220.9 26.9% 0.0% 0.0% 0.0% 1.96sec 187866 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement main_hand 0 409455 1365 27.27 2785 5567 136.3 136.3 26.8% 19.0% 0.0% 0.0% 2.21sec 585365 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement offhand 1 204246 681 27.22 1392 2784 136.1 136.1 26.8% 19.0% 0.0% 0.0% 2.21sec 291994 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement rockbiter 193786 302321 1008 12.71 3752 7500 63.5 63.5 26.8% 0.0% 0.0% 0.0% 4.75sec 302321 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement stormstrike 17364 0 0 0.00 0 0 81.3 0.0 0.0% 0.0% 0.0% 0.0% 3.65sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement stormstrike_mh 32175 994969 3317 16.26 9660 19254 81.3 81.3 26.9% 0.0% 0.0% 0.0% 3.65sec 1422428 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement stormstrike_offhand 32176 497794 1659 16.26 4828 9638 81.3 81.3 26.9% 0.0% 0.0% 0.0% 3.65sec 711656 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement sundering 197214 196175 654 1.48 20863 41685 7.4 7.4 26.8% 0.0% 0.0% 0.0% 41.95sec 196175 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement wind_shear 57994 0 0 0.00 0 0 11.4 0.0 0.0% 0.0% 0.0% 0.0% 27.16sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windfury_attack 25504 97379 325 23.92 642 1284 119.6 119.6 26.8% 0.0% 0.0% 0.0% 4.94sec 139215 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windlash 114089 100849 336 3.68 4356 8706 18.4 18.4 25.9% 0.0% 0.0% 0.0% 11.22sec 100849 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windlash_offhand 114093 49855 166 3.62 2178 4352 18.1 18.1 26.3% 0.0% 0.0% 0.0% 11.38sec 49855 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windstrike 115356 0 0 0.00 0 0 17.9 0.0 0.0% 0.0% 0.0% 0.0% 11.56sec 0 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windstrike_mh 115357 342915 1143 3.57 15225 30332 17.9 17.9 26.4% 0.0% 0.0% 0.0% 11.56sec 342915 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement windstrike_offhand 115360 171306 571 3.57 7611 15173 17.9 17.9 26.2% 0.0% 0.0% 0.0% 11.56sec 171306 300.00sec
T22_Shaman_Enhancement T22_Shaman_Enhancement_greater_earth_elemental melee 0 20842 285 44.51 304 607 54.2 54.2 26.7% 0.0% 0.0% 0.0% 3.40sec 29796 73.04sec
T22_Shaman_Enhancement T22_Shaman_Enhancement_spirit_wolf melee 0 94074 2154 112.01 915 1827 81.5 81.5 26.2% 0.0% 0.0% 0.0% 6.27sec 134490 43.68sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
155814.6 0.0 Health 84.10% 5.6 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.61% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.61%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.56% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.55% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.03% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.54% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.48% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.50% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.22% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.22%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.46% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.05% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Azerite Globules 13.9 26.8 22.2sec 7.4sec 67.46% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Beast_Mastery
  • cooldown name:buff_azerite_globules
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • azerite_globules_1:34.07%
  • azerite_globules_2:33.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279956
  • name:Azerite Globules
  • tooltip:Accumulating unstable globules.
  • description:
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Azerite Globules 15.5 30.1 19.7sec 6.6sec 67.09% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_azerite_globules
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • azerite_globules_1:33.76%
  • azerite_globules_2:33.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279956
  • name:Azerite Globules
  • tooltip:Accumulating unstable globules.
  • description:
  • max_stacks:3
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Find Weakness 9.4 78.9 33.6sec 3.4sec 78.22% 79.68% 78.9(78.9) 8.5

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • find_weakness_1:78.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:$w1% of armor is ignored by the attacking Rogue.
  • description:{$@spelldesc91023=Your Shadowstrike and Cheap Shot reveal a flaw in your target's defenses, causing all your attacks to bypass $91021s1% of that enemy's armor for {$91021d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hunter's Mark 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • hunters_mark_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:257284
  • name:Hunter's Mark
  • tooltip:Damage taken from the Hunter increased by $s1%. Can always be seen and tracked by the Hunter.
  • description:Apply Hunter's Mark to the target, increasing all damage you deal to the marked target by $s1%. If the target dies while affected by Hunter's Mark, you instantly gain $259558s1 Focus. The target can always be seen and tracked by the Hunter. Only one Hunter's Mark can be applied at a time.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 32.9 0.3 9.2sec 9.1sec 25.37% 46.59% 0.3(0.3) 0.0

Buff details

  • buff initial source:T22_Paladin_Retribution
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • judgment_1:25.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's next Holy Power spender.
  • description:{$@spelldesc20271=Judges the target, dealing $s1 Holy damage{$?s231663=false}[, and causing them to take $197277s1% increased damage from your next ability that costs Holy Power.][]{$?s137027=false}[ |cFFFFFFFFGenerates $220637s1 Holy Power.][]}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Latent Poison 88.3 86.4 3.4sec 1.7sec 66.63% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Survival
  • cooldown name:buff_latent_poison
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:2100.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • latent_poison_1:37.30%
  • latent_poison_2:17.00%
  • latent_poison_3:9.88%
  • latent_poison_4:2.21%
  • latent_poison_5:0.23%
  • latent_poison_6:0.01%
  • latent_poison_7:0.00%
  • latent_poison_8:0.00%
  • latent_poison_9:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:273286
  • name:Latent Poison
  • tooltip:The Hunter's next Raptor Strike will consume all stacks of Latent Poison to deal additional Nature damage.
  • description:{$@spelldesc273283=Serpent Sting damage applies Latent Poison, stacking up to {$273286u=10} times. Your {$?s259387=false}[Mongoose Bite][Raptor Strike] consumes all applications of Latent Poison to deal $s1 Nature damage per stack.}
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:273283
  • name:Latent Poison
  • tooltip:
  • description:Serpent Sting damage applies Latent Poison, stacking up to {$273286u=10} times. Your {$?s259387=false}[Mongoose Bite][Raptor Strike] consumes all applications of Latent Poison to deal $s1 Nature damage per stack.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Marked for Death 1.0 8.8 106.0sec 34.3sec 100.00% 0.00% 8.8(8.8) 0.0

Buff details

  • buff initial source:T22_Rogue_Subtlety
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • marked_for_death_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Steady Aim 31.3 36.5 9.3sec 4.3sec 52.65% 85.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:T22_Hunter_Marksmanship
  • cooldown name:buff_steady_aim
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:2400.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • steady_aim_1:26.33%
  • steady_aim_2:16.06%
  • steady_aim_3:8.14%
  • steady_aim_4:1.90%
  • steady_aim_5:0.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:277959
  • name:Steady Aim
  • tooltip:The Hunter's next Aimed Shot will deal $w1 more damage.
  • description:{$@spelldesc277651=Steady Shot increases the damage of your next Aimed Shot against the target by $s1, stacking up to {$277959u=5} times.}
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%

Trigger Spell details

  • id:277651
  • name:Steady Aim
  • tooltip:
  • description:Steady Shot increases the damage of your next Aimed Shot against the target by $s1, stacking up to {$277959u=5} times.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Toxic Blade 12.2 0.0 25.2sec 25.2sec 36.17% 39.31% 0.0(0.0) 11.9

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_toxic_blade
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • toxic_blade_1:36.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:245389
  • name:Toxic Blade
  • tooltip:$s1% increased damage taken from poisons from the casting Rogue.
  • description:{$@spelldesc245388=Stab your enemy with a toxic poisoned blade, dealing $s2 Nature damage. Your Nature damage done against the target is increased by $245389s1% for {$245389d=9 seconds}. |cFFFFFFFFAwards $s3 combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:9.00
  • cooldown:0.00
  • default_chance:0.00%
Vendetta 3.0 0.0 120.1sec 120.1sec 19.35% 16.48% 0.0(0.0) 2.8

Buff details

  • buff initial source:T22_Rogue_Assassination
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vendetta_1:19.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility. Generates ${$256495s1*{$256495d=3 seconds}/5} Energy over {$256495d=3 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your $?c1[Chaos][Fire] damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 155814.65
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7499
Mean 300.00
Minimum 240.01
Maximum 359.98
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 20.00%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 156705.70
Minimum 149209.81
Maximum 165246.67
Spread ( max - min ) 16036.86
Range [ ( max - min ) / 2 * 100% ] 5.12%
Standard Deviation 2410.6009
5th Percentile 152917.57
95th Percentile 160805.30
( 95th Percentile - 5th Percentile ) 7887.73
Mean Distribution
Standard Deviation 27.8371
95.00% Confidence Intervall ( 156651.14 - 156760.26 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 910
0.1 Scale Factor Error with Delta=300 49607
0.05 Scale Factor Error with Delta=300 198425
0.01 Scale Factor Error with Delta=300 4960602
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 3825
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=102.749,attack_speed=2,aoe_tanks=1
2 7.77 spell_dot,damage=410.997,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 8.50 spell_nuke,damage=154.124,cooldown=35,attack_speed=2,aoe_tanks=1
4 10.68 melee_nuke,damage=308.248,cooldown=27,attack_speed=2,aoe_tanks=1

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 57506983 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste inf% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 3336 3336
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=102.749,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=410.997,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=154.124,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=308.248,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.