close

SimulationCraft 710-01

for World of Warcraft 7.1.0 Live (wow build level 22900, git build 354ae31)

Current simulator hotfixes

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mark of the Hidden Satyr

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 In-game testing shows that the damage from this ability is roughly 10% higher than what spelldata shows.
Mark of the Hidden Satyr (effect#1) average 29.13 26.49

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Hunter_BM_T19M : 379228 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
379227.9 379227.9 267.2 / 0.070% 45917.4 / 12.1% 6985.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.9 14.9 Focus 30.76% 40.4 100.0% 100%
Talents
  • 15: Big Game Hunter (Beast Mastery Hunter)
  • 30: Stomp (Beast Mastery Hunter)
  • 60: Bestial Fury (Beast Mastery Hunter)
  • 90: A Murder of Crows
  • 100: Killer Cobra (Beast Mastery Hunter)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hunter_BM_T19M 379228
A Murder of Crows 0 (27233) 0.0% (7.2%) 5.5 60.33sec 1486770 1209178

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.49 0.00 85.57 0.00 1.2296 0.9358 0.00 0.00 0.00 94083.83 1209177.79
 
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target, dealing ${{$131900s1=1}*16} Physical damage over {$d=15 seconds}. When a target dies while affected by this ability, its cooldown will reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    A Murder of Crows (crow_peck) 27233 7.2% 0.0 0.00sec 0 0 Direct 85.6 74206 151202 95471 27.6%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 85.57 0.00 0.00 0.0000 0.0000 8169205.17 12009505.40 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.94 72.38% 74206.05 58455 104905 74268.34 65557 84836 4595998 6756552 31.98
crit 23.63 27.62% 151202.24 116909 209811 151291.37 129066 183419 3573207 5252953 31.98
 
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.620000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
auto_shot 16857 4.5% 122.9 2.46sec 41234 16940 Direct 122.9 29920 62420 41234 34.8%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.86 122.86 0.00 0.00 2.4341 0.0000 5065920.95 7447383.65 31.98 16940.05 16940.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.09 65.19% 29919.85 25164 36740 29928.53 28433 31639 2396223 3522674 31.98
crit 42.77 34.81% 62419.56 50328 73479 62454.11 57211 68849 2669698 3924709 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Cobra Shot 38325 10.1% 70.2 4.25sec 163889 134433 Direct 70.0 117206 241843 164368 37.8%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.24 70.03 0.00 0.00 1.2191 0.0000 11511271.42 16922659.36 31.98 134433.50 134433.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.53 62.16% 117206.26 89840 131167 117241.85 108732 125263 5102492 7501147 31.98
crit 26.50 37.84% 241843.13 179680 262333 241979.66 217250 262333 6408779 9421513 31.98
 
 

Action details: cobra_shot

Static Values
  • id:193455
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90
Spelldata
  • id:193455
  • name:Cobra Shot
  • school:physical
  • tooltip:
  • description:A quick shot causing ${$sw2*$<mult>} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.40
 
Deadly Grace 12355 3.2% 28.5 3.24sec 128323 0 Direct 28.5 99520 203107 128322 27.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.47 28.47 0.00 0.00 0.0000 0.0000 3653471.29 3653471.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.55 72.19% 99519.90 79173 115593 99427.73 86840 113676 2045556 2045556 0.00
crit 7.92 27.81% 203106.88 158346 231185 203018.42 0 231185 1607916 1607916 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Dire Beast 0 (48986) 0.0% (12.9%) 34.3 8.86sec 429721 419346

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.25 0.00 0.00 0.00 1.0248 0.0000 0.00 0.00 0.00 419345.59 419345.59
 
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.bestial_wrath.remains>2
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r
 
    dire_beast_melee (dire_beast) 32347 6.5% 183.5 1.64sec 40548 25061 Direct 183.5 32044 64083 40548 26.5%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.45 183.45 0.00 0.00 1.6180 0.0000 7438774.13 10935702.59 31.98 25060.98 25060.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.76 73.46% 32043.99 31174 38319 32043.92 31174 33670 4318221 6348194 31.98
crit 48.70 26.54% 64082.69 62347 76638 64081.27 62347 68089 3120553 4587508 31.98
 
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stomp (dire_beast) 31636 6.4% 34.3 8.86sec 212534 0 Direct 34.3 168204 336291 212541 26.4%  

Stats details: stomp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.25 34.25 0.00 0.00 0.0000 0.0000 7279417.49 10701433.23 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.22 73.63% 168204.38 163671 201186 168201.29 163671 179253 4241718 6235727 31.98
crit 9.03 26.37% 336291.27 327341 402372 336222.17 0 376109 3037700 4465706 31.97
 
 

Action details: stomp

Static Values
  • id:201754
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201754
  • name:Stomp
  • school:physical
  • tooltip:
  • description:{$@spelldesc199530=When your Dire Beasts charge in, they will stomp the ground, dealing ${($76657m1/100+1)*({$201754s1=1})*1.35} Physical damage to all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Kill Command 0 (140114) 0.0% (37.0%) 73.3 4.10sec 573710 561081

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.34 0.00 0.00 0.00 1.0225 0.0000 0.00 0.00 0.00 561080.88 561080.88
 
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:7.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.
 
    Kill Command (cat) 89543 23.6% 73.3 4.10sec 366637 0 Direct 73.3 260646 530013 366631 39.3%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.34 73.34 0.00 0.00 0.0000 0.0000 26888127.19 39528093.88 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.48 60.65% 260646.40 194844 349677 260639.47 238855 286895 11593826 17044023 31.98
crit 28.86 39.35% 530012.70 389689 699354 530188.73 472193 596173 15294301 22484071 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (cat) 17941 4.7% 29.4 10.13sec 183226 0 Direct 29.4 183224 0 183224 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.40 29.40 0.00 0.00 0.0000 0.0000 5387080.75 5387080.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.40 100.00% 183224.40 97422 349677 183289.30 135951 234992 5387081 5387081 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:284472.87
  • base_dd_max:284472.87
 
    Kill Command (hati) 27200 7.2% 73.3 4.10sec 111381 0 Direct 73.3 87182 176368 111382 27.1%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.34 73.34 0.00 0.00 0.0000 0.0000 8168379.52 12008291.63 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.44 72.87% 87182.03 64948 116559 87194.53 81411 95321 4658938 6849081 31.98
crit 19.90 27.13% 176368.35 129896 233118 176446.56 148094 202563 3509441 5159211 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (hati) 5430 1.4% 29.3 10.10sec 55642 0 Direct 29.3 55642 0 55642 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.31 29.31 0.00 0.00 0.0000 0.0000 1630745.76 1630745.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.31 100.00% 55641.76 32474 116559 55662.98 42211 72321 1630746 1630746 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94824.29
  • base_dd_max:94824.29
 
Pepper Breath 3927 1.0% 14.1 21.07sec 83938 0 Periodic 69.6 16974 0 16974 0.0% 5.8%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.07 0.00 70.07 69.58 0.0000 0.2498 1181007.92 1181007.92 0.00 67482.31 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.6 100.00% 16974.45 68 16990 16975.48 16548 16990 1181008 1181008 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Titan's Thunder 0 (20567) 0.0% (5.4%) 5.4 61.04sec 1144480 0

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
 
    Titan's Thunder (cat) 5592 1.5% 5.4 61.04sec 310993 0 Periodic 42.5 30743 62441 39471 27.5% 14.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 42.48 42.48 0.0000 1.0000 1676764.22 1676764.22 0.00 39471.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.8 72.46% 30742.72 23873 42843 30778.70 25454 37927 946355 946355 0.00
crit 11.7 27.54% 62440.65 47745 85686 62535.54 47745 79752 730409 730409 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 9292 1.9% 5.2 63.74sec 414996 0 Periodic 40.6 41222 82410 52663 27.8% 13.5%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.15 0.00 40.59 40.59 0.0000 1.0000 2137402.30 2137402.30 0.00 52663.54 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.3 72.22% 41222.24 40104 49296 41217.73 40104 46701 1208376 1208376 0.00
crit 11.3 27.78% 82409.68 80207 98592 82403.08 80207 94455 929026 929026 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 3864 0.2% 0.5 102.16sec 409157 0 Periodic 3.7 41270 82462 52119 26.3% 1.2%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.47 0.00 3.67 3.67 0.0000 1.0000 191234.60 191234.60 0.00 52121.72 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.7 73.66% 41270.12 40104 49296 15864.25 0 48682 111545 111545 0.00
crit 1.0 26.34% 82462.18 80207 98592 28981.61 0 98592 79690 79690 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 1591 0.0% 0.0 120.66sec 418848 0 Periodic 0.3 41400 83034 53675 29.5% 0.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.04 0.00 0.34 0.34 0.0000 1.0000 18367.72 18367.72 0.00 53706.77 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.2 70.52% 41400.28 40104 49296 1807.48 0 48989 9991 9991 0.00
crit 0.1 29.48% 83034.11 80207 98592 3387.19 0 98592 8377 8377 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 343 0.0% 0.0 0.00sec 381385 0 Periodic 0.1 42114 85171 58675 38.5% 0.0%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.01 0.00 0.06 0.06 0.0000 1.0000 3232.07 3232.07 0.00 58764.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.0 61.54% 42114.22 40104 49296 353.10 0 45436 1428 1428 0.00
crit 0.0 38.46% 85171.06 80207 96750 717.37 0 94302 1804 1804 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (hati) 7149 1.9% 5.4 61.04sec 397584 0 Periodic 42.5 39283 79763 50461 27.6% 14.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 42.48 42.48 0.0000 1.0000 2143636.86 2143636.86 0.00 50462.26 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.7 72.39% 39283.02 30502 54741 39321.57 32186 48498 1207945 1207945 0.00
crit 11.7 27.61% 79762.89 61005 109482 79863.98 61005 103359 935692 935692 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 5628 1.5% 10.4 27.80sec 161777 0 Direct 71.8 18509 37487 23545 26.5%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.45 71.79 0.00 0.00 0.0000 0.0000 1690346.33 1690346.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.74 73.46% 18509.45 15351 22412 18511.29 15351 22141 976212 976212 0.00
crit 19.05 26.54% 37487.25 30702 44825 37465.00 30702 44825 714134 714134 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
pet - cat 155647 / 155647
Claw 21268 5.6% 100.8 3.00sec 63459 63175 Direct 100.8 45571 93490 63460 37.3%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.75 100.75 0.00 0.00 1.0045 0.0000 6393728.07 9399385.89 31.98 63175.39 63175.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.14 62.67% 45571.06 19845 71231 45582.74 40681 50145 2877448 4230122 31.98
crit 37.61 37.33% 93490.21 39691 142461 93561.26 80275 110608 3516280 5169264 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 21302 5.6% 201.2 1.49sec 31805 21336 Direct 201.2 22848 46593 31804 37.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.25 201.25 0.00 0.00 1.4907 0.0000 6400528.52 9409383.20 31.98 21335.52 21335.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.33 62.28% 22847.83 18557 33303 22851.75 21358 24850 2863626 4209801 31.98
crit 75.91 37.72% 46592.71 37113 66605 46612.43 42928 51091 3536903 5199582 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - hati 62482 / 62482
hati_melee 22703 6.0% 182.9 1.64sec 37291 22746 Direct 183.9 29216 59144 37088 26.3%  

Stats details: hati_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 182.93 183.93 0.00 0.00 1.6394 0.0000 6821622.81 10028431.69 31.98 22746.17 22746.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.55 73.70% 29216.30 23435 42551 29222.59 27550 31426 3960282 5821990 31.98
crit 48.38 26.30% 59143.91 46870 85102 59162.78 52489 66279 2861340 4206441 31.98
 
 

Action details: hati_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Hunter_BM_T19M
Aspect of the Wild 2.8 127.29sec

Stats details: aspect_of_the_wild

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 37.46 0.00 0.0000 0.7446 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_wild

Static Values
  • id:193530
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bestial_wrath.up
Spelldata
  • id:193530
  • name:Aspect of the Wild
  • school:physical
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_BM_T19M
  • harmful:false
  • if_expr:
 
Bestial Wrath 8.9 35.37sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.93 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=true}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_BM_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Wild 2.8 0.0 127.3sec 127.3sec 12.05% 7.10% 36.1(36.1) 2.7

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:13.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:12.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bestial Wrath 8.9 0.0 35.4sec 35.4sec 43.58% 62.05% 0.0(0.0) 8.5

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • bestial_wrath_1:43.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=true}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Big Game Hunter 1.0 0.0 0.0sec 0.0sec 13.49% 18.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_big_game_hunter
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • big_game_hunter_1:13.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204308
  • name:Big Game Hunter
  • tooltip:
  • description:Increases the critical strike chance of your auto shot and Cobra Shot by {$s1=50}% on targets who are above {$s2=80}% health.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 11.65% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dire Beast 34.2 0.0 12.2sec 8.9sec 81.24% 77.77% 0.0(0.0) 24.2

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_dire_beast
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.50

Stack Uptimes

  • dire_beast_1:73.05%
  • dire_beast_2:7.62%
  • dire_beast_3:0.54%
  • dire_beast_4:0.03%
  • dire_beast_5:0.00%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:120694
  • name:Dire Beast
  • tooltip:Your Dire Beast is granting you {$s1=3} Focus every $t1 sec.
  • description:{$@spelldesc120679=Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Focused Lightning 3.5 0.0 70.4sec 69.6sec 22.23% 22.23% 3.3(3.3) 0.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_focused_lightning
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:643.16

Stack Uptimes

  • focused_lightning_1:2.22%
  • focused_lightning_2:2.22%
  • focused_lightning_3:2.22%
  • focused_lightning_4:2.22%
  • focused_lightning_5:2.22%
  • focused_lightning_6:2.22%
  • focused_lightning_7:2.22%
  • focused_lightning_8:2.22%
  • focused_lightning_9:2.22%
  • focused_lightning_10:2.22%

Trigger Attempt Success

  • trigger_pct:99.88%

Spelldata details

  • id:215632
  • name:Focused Lightning
  • tooltip:Mastery increased by {$s1=608}.
  • description:{$@spelldesc215630=Your ranged attacks and spells have a chance to trigger Focused Lightning, granting you {$215632s1=608} Mastery every $215631t1 sec. After {$215631d=10 seconds}, this bonus decreases every $215632t2 sec.}
  • max_stacks:10
  • duration:11.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.4 2.9 25.9sec 20.3sec 25.76% 25.76% 2.9(2.9) 11.2

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 58.3sec 0.0sec 19.61% 19.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
cat: Aspect of the Wild 2.8 0.0 127.3sec 127.3sec 12.05% 14.68% 36.1(36.1) 2.7

Buff details

  • buff initial source:Hunter_BM_T19M_cat
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:13.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:12.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
cat: Bestial Wrath 8.9 0.0 35.4sec 35.4sec 43.58% 49.51% 0.0(0.0) 8.5

Buff details

  • buff initial source:Hunter_BM_T19M_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • bestial_wrath_1:43.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=false}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
hati: Bestial Wrath 8.9 0.0 35.4sec 35.4sec 43.58% 51.30% 0.0(0.0) 8.5

Buff details

  • buff initial source:Hunter_BM_T19M_hati
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • bestial_wrath_1:43.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=false}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_BM_T19M
a_murder_of_crows Focus 5.5 154.3 28.1 28.1 52946.0
cobra_shot Focus 70.2 2418.4 34.4 34.4 4759.8
kill_command Focus 73.3 1903.8 26.0 26.0 22100.7
pet - cat
claw Focus 100.8 4726.9 46.9 46.9 1352.6
Resource Gains Type Count Total Average Overflow
dire_beast Focus 1160.18 390.64 (8.87%) 0.34 1.81 0.46%
aspect_of_the_wild Focus 105.65 353.13 (8.01%) 3.34 8.36 2.31%
focus_regen Focus 1492.94 3662.56 (83.12%) 2.45 4.23 0.12%
pet - cat
focus_regen Focus 625.91 4383.77 (94.29%) 7.00 197.55 4.31%
aspect_of_the_wild Focus 91.59 265.33 (5.71%) 2.90 96.16 26.60%
Resource RPS-Gain RPS-Loss
Focus 14.65 14.88
Combat End Resource Mean Min Max
Focus 70.09 0.00 140.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 87.6%
Uptimes %
Focus Cap 0.1%
cat-Focus Cap 2.2%

Procs

Count Interval
starved: a_murder_of_crows 3.1 5.3sec
wild_call 8.6 32.0sec

Statistics & Data Analysis

Fight Length
Sample Data Hunter_BM_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Hunter_BM_T19M Damage Per Second
Count 7499
Mean 379227.87
Minimum 341963.53
Maximum 427359.76
Spread ( max - min ) 85396.23
Range [ ( max - min ) / 2 * 100% ] 11.26%
Standard Deviation 11803.9943
5th Percentile 360627.89
95th Percentile 400005.63
( 95th Percentile - 5th Percentile ) 39377.74
Mean Distribution
Standard Deviation 136.3099
95.00% Confidence Intervall ( 378960.70 - 379495.03 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3721
0.1 Scale Factor Error with Delta=300 1189437
0.05 Scale Factor Error with Delta=300 4757750
0.01 Scale Factor Error with Delta=300 118943756
Priority Target DPS
Sample Data Hunter_BM_T19M Priority Target Damage Per Second
Count 7499
Mean 379227.87
Minimum 341963.53
Maximum 427359.76
Spread ( max - min ) 85396.23
Range [ ( max - min ) / 2 * 100% ] 11.26%
Standard Deviation 11803.9943
5th Percentile 360627.89
95th Percentile 400005.63
( 95th Percentile - 5th Percentile ) 39377.74
Mean Distribution
Standard Deviation 136.3099
95.00% Confidence Intervall ( 378960.70 - 379495.03 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3721
0.1 Scale Factor Error with Delta=300 1189437
0.05 Scale Factor Error with Delta=300 4757750
0.01 Scale Factor Error with Delta=300 118943756
DPS(e)
Sample Data Hunter_BM_T19M Damage Per Second (Effective)
Count 7499
Mean 379227.87
Minimum 341963.53
Maximum 427359.76
Spread ( max - min ) 85396.23
Range [ ( max - min ) / 2 * 100% ] 11.26%
Damage
Sample Data Hunter_BM_T19M Damage
Count 7499
Mean 31271223.06
Minimum 22646100.83
Maximum 40069274.23
Spread ( max - min ) 17423173.40
Range [ ( max - min ) / 2 * 100% ] 27.86%
DTPS
Sample Data Hunter_BM_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hunter_BM_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hunter_BM_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hunter_BM_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hunter_BM_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hunter_BM_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hunter_BM_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hunter_BM_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
7 1.00 potion,name=deadly_grace
8 5.50 a_murder_of_crows
0.00 stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
9 34.26 dire_beast,if=cooldown.bestial_wrath.remains>2
0.00 dire_frenzy,if=cooldown.bestial_wrath.remains>2
A 2.84 aspect_of_the_wild,if=buff.bestial_wrath.up
0.00 barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
B 5.39 titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
C 8.93 bestial_wrath
0.00 multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
D 73.35 kill_command
0.00 multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
0.00 chimaera_shot,if=focus<90
E 70.24 cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

Sample Sequence

024568C9ABDEDEDEDE9DEDEDEDE9DED9EDEC9DEDEDEDE9D9EDD9ED78CED9BEDEDED9EDD9EDE9CDEDEDED9EDED9D8D9B9CAEDEDEDED9EDEDEE9DEED9EDE9CDEDEDEDE9D8EBD9DED9EDE9CDE9DEDEDEDE9DD9ED89CEBDEADEDE9DEDEDE9EDED9EDE9CEDEDEDED9EDED89

Sample Sequence Table

time name target resources buffs
Pre flask Hunter_BM_T19M 140.0/140: 100% focus
Pre summon_pet Fluffy_Pillow 140.0/140: 100% focus
Pre potion Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
Pre augmentation Hunter_BM_T19M 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 a_murder_of_crows Fluffy_Pillow 140.0/140: 100% focus bloodlust, potion_of_deadly_grace
0:00.991 bestial_wrath Fluffy_Pillow 125.1/140: 89% focus bloodlust, potion_of_deadly_grace
0:00.991 dire_beast Fluffy_Pillow 125.1/140: 89% focus bloodlust, bestial_wrath, potion_of_deadly_grace
0:01.746 aspect_of_the_wild Fluffy_Pillow 137.7/140: 98% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:01.746 titans_thunder Fluffy_Pillow 137.7/140: 98% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:01.746 kill_command Fluffy_Pillow 137.7/140: 98% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:02.502 cobra_shot Fluffy_Pillow 133.8/140: 96% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:03.494 kill_command Fluffy_Pillow 128.3/140: 92% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:04.250 cobra_shot Fluffy_Pillow 124.5/140: 89% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:05.240 kill_command Fluffy_Pillow 118.9/140: 85% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:05.995 cobra_shot Fluffy_Pillow 115.1/140: 82% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:06.987 kill_command Fluffy_Pillow 109.6/140: 78% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:07.741 cobra_shot Fluffy_Pillow 105.7/140: 75% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:08.732 dire_beast Fluffy_Pillow 100.2/140: 72% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:09.479 kill_command Fluffy_Pillow 120.6/140: 86% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:10.235 cobra_shot Fluffy_Pillow 117.0/140: 84% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:11.214 kill_command Fluffy_Pillow 111.3/140: 80% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:11.968 cobra_shot Fluffy_Pillow 107.6/140: 77% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:12.943 kill_command Fluffy_Pillow 101.8/140: 73% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:13.697 cobra_shot Fluffy_Pillow 98.1/140: 70% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:14.673 kill_command Fluffy_Pillow 92.4/140: 66% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:15.433 cobra_shot Fluffy_Pillow 81.9/140: 58% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:16.423 dire_beast Fluffy_Pillow 66.4/140: 47% focus bloodlust, dire_beast, potion_of_deadly_grace
0:17.296 kill_command Fluffy_Pillow 81.0/140: 58% focus bloodlust, dire_beast, potion_of_deadly_grace
0:18.051 Waiting 3.400 sec 63.6/140: 45% focus bloodlust, dire_beast, potion_of_deadly_grace
0:21.451 cobra_shot Fluffy_Pillow 120.4/140: 86% focus bloodlust, dire_beast, potion_of_deadly_grace
0:22.442 kill_command Fluffy_Pillow 96.9/140: 69% focus bloodlust, dire_beast, potion_of_deadly_grace
0:23.194 Waiting 1.000 sec 79.5/140: 57% focus bloodlust, dire_beast, potion_of_deadly_grace
0:24.194 dire_beast Fluffy_Pillow 96.2/140: 69% focus bloodlust, dire_beast, potion_of_deadly_grace
0:25.189 Waiting 0.400 sec 112.8/140: 81% focus bloodlust, dire_beast, potion_of_deadly_grace
0:25.589 cobra_shot Fluffy_Pillow 119.5/140: 85% focus bloodlust, dire_beast, potion_of_deadly_grace
0:26.579 Waiting 0.600 sec 96.0/140: 69% focus bloodlust, dire_beast, potion_of_deadly_grace
0:27.179 kill_command Fluffy_Pillow 106.0/140: 76% focus bloodlust, dire_beast, potion_of_deadly_grace
0:28.133 Waiting 1.700 sec 91.9/140: 66% focus bloodlust, dire_beast
0:29.833 cobra_shot Fluffy_Pillow 120.3/140: 86% focus bloodlust, dire_beast
0:30.823 bestial_wrath Fluffy_Pillow 96.9/140: 69% focus bloodlust, dire_beast
0:30.991 Waiting 1.100 sec 99.7/140: 71% focus bloodlust, bestial_wrath, dire_beast
0:32.091 dire_beast Fluffy_Pillow 118.0/140: 84% focus bloodlust, bestial_wrath, dire_beast
0:33.089 kill_command Fluffy_Pillow 134.7/140: 96% focus bloodlust, bestial_wrath, dire_beast
0:33.843 cobra_shot Fluffy_Pillow 123.3/140: 88% focus bloodlust, bestial_wrath, dire_beast
0:34.835 kill_command Fluffy_Pillow 107.8/140: 77% focus bloodlust, bestial_wrath, dire_beast
0:35.590 cobra_shot Fluffy_Pillow 96.4/140: 69% focus bloodlust, bestial_wrath, dire_beast
0:36.582 kill_command Fluffy_Pillow 81.0/140: 58% focus bloodlust, bestial_wrath, dire_beast
0:37.336 cobra_shot Fluffy_Pillow 69.6/140: 50% focus bloodlust, bestial_wrath, dire_beast
0:38.329 kill_command Fluffy_Pillow 54.2/140: 39% focus bloodlust, bestial_wrath, dire_beast
0:39.083 cobra_shot Fluffy_Pillow 42.8/140: 31% focus bloodlust, bestial_wrath, dire_beast
0:40.075 dire_beast Fluffy_Pillow 24.9/140: 18% focus bestial_wrath, dire_beast
0:41.399 kill_command Fluffy_Pillow 42.4/140: 30% focus bestial_wrath, dire_beast
0:42.500 dire_beast Fluffy_Pillow 32.9/140: 24% focus bestial_wrath, dire_beast
0:43.602 cobra_shot Fluffy_Pillow 49.1/140: 35% focus bestial_wrath, dire_beast(2)
0:44.890 kill_command Fluffy_Pillow 36.0/140: 26% focus bestial_wrath, dire_beast(2)
0:45.992 Waiting 5.100 sec 28.2/140: 20% focus dire_beast(2)
0:51.092 kill_command Fluffy_Pillow 98.0/140: 70% focus
0:52.406 Waiting 0.200 sec 83.4/140: 60% focus
0:52.606 dire_beast Fluffy_Pillow 85.7/140: 61% focus
0:53.865 Waiting 1.300 sec 102.1/140: 73% focus dire_beast
0:55.165 cobra_shot Fluffy_Pillow 119.3/140: 85% focus dire_beast, mark_of_the_claw
0:56.433 Waiting 1.000 sec 96.3/140: 69% focus dire_beast, mark_of_the_claw
0:57.433 kill_command Fluffy_Pillow 109.6/140: 78% focus dire_beast, mark_of_the_claw
0:58.745 potion Fluffy_Pillow 97.2/140: 69% focus dire_beast, mark_of_the_claw
0:58.745 Waiting 1.100 sec 97.2/140: 69% focus dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:59.845 a_murder_of_crows Fluffy_Pillow 111.8/140: 80% focus dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:01.270 bestial_wrath Fluffy_Pillow 99.8/140: 71% focus potion_of_deadly_grace
1:01.270 cobra_shot Fluffy_Pillow 99.8/140: 71% focus bestial_wrath, potion_of_deadly_grace
1:02.557 kill_command Fluffy_Pillow 82.8/140: 59% focus bestial_wrath, potion_of_deadly_grace
1:03.657 dire_beast Fluffy_Pillow 71.7/140: 51% focus bestial_wrath, potion_of_deadly_grace
1:04.759 titans_thunder Fluffy_Pillow 86.2/140: 62% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:04.759 cobra_shot Fluffy_Pillow 86.2/140: 62% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:06.045 kill_command Fluffy_Pillow 71.2/140: 51% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:07.146 cobra_shot Fluffy_Pillow 61.7/140: 44% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:08.434 kill_command Fluffy_Pillow 46.7/140: 33% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:09.536 cobra_shot Fluffy_Pillow 37.2/140: 27% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:10.823 Waiting 0.200 sec 22.2/140: 16% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:11.023 kill_command Fluffy_Pillow 24.8/140: 18% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:12.126 Waiting 1.600 sec 13.7/140: 10% focus bestial_wrath, potion_of_deadly_grace
1:13.726 dire_beast Fluffy_Pillow 32.4/140: 23% focus bestial_wrath, potion_of_deadly_grace
1:15.010 cobra_shot Fluffy_Pillow 49.2/140: 35% focus bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:16.280 kill_command Fluffy_Pillow 34.2/140: 24% focus dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:17.348 Waiting 5.100 sec 18.5/140: 13% focus dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:22.448 kill_command Fluffy_Pillow 85.4/140: 61% focus potion_of_deadly_grace
1:23.744 Waiting 0.200 sec 70.6/140: 50% focus potion_of_deadly_grace
1:23.944 dire_beast Fluffy_Pillow 72.9/140: 52% focus potion_of_deadly_grace
1:25.199 Waiting 2.300 sec 89.2/140: 64% focus dire_beast, potion_of_deadly_grace
1:27.499 cobra_shot Fluffy_Pillow 119.6/140: 85% focus dire_beast, potion_of_deadly_grace
1:28.786 Waiting 0.100 sec 96.5/140: 69% focus dire_beast
1:28.886 kill_command Fluffy_Pillow 97.9/140: 70% focus dire_beast
1:30.156 Waiting 2.700 sec 84.6/140: 60% focus dire_beast
1:32.856 cobra_shot Fluffy_Pillow 119.0/140: 85% focus
1:34.145 dire_beast Fluffy_Pillow 94.1/140: 67% focus
1:35.466 bestial_wrath Fluffy_Pillow 111.2/140: 79% focus dire_beast
1:35.466 kill_command Fluffy_Pillow 111.2/140: 79% focus bestial_wrath, dire_beast
1:36.556 cobra_shot Fluffy_Pillow 101.8/140: 73% focus bestial_wrath, dire_beast, mark_of_the_claw
1:37.824 kill_command Fluffy_Pillow 86.7/140: 62% focus bestial_wrath, dire_beast, mark_of_the_claw
1:38.896 cobra_shot Fluffy_Pillow 77.0/140: 55% focus bestial_wrath, dire_beast, mark_of_the_claw
1:40.166 kill_command Fluffy_Pillow 62.0/140: 44% focus bestial_wrath, dire_beast, mark_of_the_claw
1:41.238 cobra_shot Fluffy_Pillow 52.3/140: 37% focus bestial_wrath, dire_beast, mark_of_the_claw
1:42.507 kill_command Fluffy_Pillow 35.5/140: 25% focus bestial_wrath
1:43.608 dire_beast Fluffy_Pillow 24.4/140: 17% focus bestial_wrath
1:44.709 cobra_shot Fluffy_Pillow 38.9/140: 28% focus bestial_wrath, dire_beast
1:45.995 Waiting 0.100 sec 23.9/140: 17% focus bestial_wrath, dire_beast
1:46.095 kill_command Fluffy_Pillow 25.2/140: 18% focus bestial_wrath, dire_beast
1:47.197 Waiting 1.300 sec 15.7/140: 11% focus bestial_wrath, dire_beast
1:48.497 cobra_shot Fluffy_Pillow 32.9/140: 23% focus bestial_wrath, dire_beast
1:49.786 Waiting 0.500 sec 17.9/140: 13% focus bestial_wrath, dire_beast
1:50.286 kill_command Fluffy_Pillow 24.5/140: 17% focus bestial_wrath, dire_beast
1:51.387 Waiting 2.300 sec 15.0/140: 11% focus dire_beast
1:53.687 dire_beast Fluffy_Pillow 42.2/140: 30% focus
1:54.974 Waiting 1.500 sec 58.9/140: 42% focus dire_beast
1:56.474 kill_command Fluffy_Pillow 78.7/140: 56% focus dire_beast
1:57.803 Waiting 2.000 sec 66.2/140: 47% focus dire_beast
1:59.803 a_murder_of_crows Fluffy_Pillow 92.8/140: 66% focus dire_beast, mark_of_the_claw
2:01.267 Waiting 1.600 sec 82.4/140: 59% focus dire_beast, mark_of_the_claw
2:02.867 kill_command Fluffy_Pillow 102.2/140: 73% focus mark_of_the_claw
2:04.117 dire_beast Fluffy_Pillow 87.1/140: 62% focus mark_of_the_claw
2:05.196 titans_thunder Fluffy_Pillow 101.4/140: 72% focus dire_beast, focused_lightning
2:05.196 Waiting 0.900 sec 101.4/140: 72% focus dire_beast, focused_lightning
2:06.096 dire_beast Fluffy_Pillow 113.2/140: 81% focus dire_beast, focused_lightning(2)
2:07.198 bestial_wrath Fluffy_Pillow 129.4/140: 92% focus dire_beast(2), focused_lightning(3)
2:07.198 aspect_of_the_wild Fluffy_Pillow 129.4/140: 92% focus bestial_wrath, dire_beast(2), focused_lightning(3)
2:07.198 cobra_shot Fluffy_Pillow 129.4/140: 92% focus aspect_of_the_wild, bestial_wrath, dire_beast(2), focused_lightning(3)
2:08.485 kill_command Fluffy_Pillow 129.2/140: 92% focus aspect_of_the_wild, bestial_wrath, dire_beast(2), focused_lightning(4)
2:09.588 cobra_shot Fluffy_Pillow 132.4/140: 95% focus aspect_of_the_wild, bestial_wrath, dire_beast(2), focused_lightning(5)
2:10.876 kill_command Fluffy_Pillow 132.2/140: 94% focus aspect_of_the_wild, bestial_wrath, dire_beast(2), focused_lightning(6)
2:11.977 cobra_shot Fluffy_Pillow 135.4/140: 97% focus aspect_of_the_wild, bestial_wrath, dire_beast(2), focused_lightning(7)
2:13.265 kill_command Fluffy_Pillow 133.3/140: 95% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(9)
2:14.367 cobra_shot Fluffy_Pillow 134.3/140: 96% focus aspect_of_the_wild, bestial_wrath, focused_lightning(10)
2:15.655 kill_command Fluffy_Pillow 130.2/140: 93% focus aspect_of_the_wild, bestial_wrath, focused_lightning(10)
2:16.757 dire_beast Fluffy_Pillow 130.1/140: 93% focus aspect_of_the_wild, bestial_wrath, focused_lightning(9)
2:17.857 cobra_shot Fluffy_Pillow 140.0/140: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(8)
2:19.146 kill_command Fluffy_Pillow 137.9/140: 98% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(6)
2:20.246 cobra_shot Fluffy_Pillow 138.9/140: 99% focus bestial_wrath, dire_beast, focused_lightning(5)
2:21.533 kill_command Fluffy_Pillow 123.9/140: 88% focus bestial_wrath, dire_beast, focused_lightning(4)
2:22.634 Waiting 0.400 sec 114.4/140: 82% focus dire_beast, focused_lightning(3)
2:23.034 cobra_shot Fluffy_Pillow 119.7/140: 85% focus dire_beast, focused_lightning(2)
2:24.321 Waiting 1.900 sec 96.7/140: 69% focus dire_beast, focused_lightning
2:26.221 cobra_shot Fluffy_Pillow 119.5/140: 85% focus
2:27.508 dire_beast Fluffy_Pillow 94.5/140: 68% focus
2:28.609 kill_command Fluffy_Pillow 109.0/140: 78% focus dire_beast
2:29.711 Waiting 2.000 sec 93.6/140: 67% focus dire_beast
2:31.711 cobra_shot Fluffy_Pillow 120.0/140: 86% focus dire_beast
2:32.999 Waiting 1.700 sec 96.9/140: 69% focus dire_beast
2:34.699 cobra_shot Fluffy_Pillow 119.4/140: 85% focus dire_beast
2:35.986 kill_command Fluffy_Pillow 94.4/140: 67% focus
2:37.087 Waiting 0.500 sec 77.3/140: 55% focus
2:37.587 dire_beast Fluffy_Pillow 83.1/140: 59% focus
2:38.875 Waiting 1.500 sec 99.8/140: 71% focus dire_beast
2:40.375 cobra_shot Fluffy_Pillow 119.8/140: 86% focus dire_beast, mark_of_the_claw
2:41.645 Waiting 0.500 sec 96.7/140: 69% focus dire_beast, mark_of_the_claw
2:42.145 kill_command Fluffy_Pillow 103.4/140: 74% focus dire_beast, mark_of_the_claw
2:43.427 Waiting 2.200 sec 90.5/140: 65% focus dire_beast, mark_of_the_claw
2:45.627 cobra_shot Fluffy_Pillow 119.9/140: 86% focus dire_beast, focused_lightning(2)
2:46.914 Waiting 0.800 sec 95.4/140: 68% focus focused_lightning(3), mark_of_the_claw
2:47.714 dire_beast Fluffy_Pillow 104.9/140: 75% focus focused_lightning(4), mark_of_the_claw
2:48.985 bestial_wrath Fluffy_Pillow 121.5/140: 87% focus dire_beast, focused_lightning(5), mark_of_the_claw
2:48.985 kill_command Fluffy_Pillow 121.5/140: 87% focus bestial_wrath, dire_beast, focused_lightning(5), mark_of_the_claw
2:50.053 cobra_shot Fluffy_Pillow 111.8/140: 80% focus bestial_wrath, dire_beast, focused_lightning(6), mark_of_the_claw
2:51.322 kill_command Fluffy_Pillow 96.8/140: 69% focus bestial_wrath, dire_beast, focused_lightning(7), mark_of_the_claw
2:52.401 cobra_shot Fluffy_Pillow 87.0/140: 62% focus bestial_wrath, dire_beast, focused_lightning(8)
2:53.688 kill_command Fluffy_Pillow 72.0/140: 51% focus bestial_wrath, dire_beast, focused_lightning(10)
2:54.789 cobra_shot Fluffy_Pillow 62.5/140: 45% focus bestial_wrath, dire_beast, focused_lightning(10)
2:56.075 kill_command Fluffy_Pillow 45.6/140: 33% focus bestial_wrath, focused_lightning(9)
2:57.177 cobra_shot Fluffy_Pillow 34.4/140: 25% focus bestial_wrath, focused_lightning(8)
2:58.466 dire_beast Fluffy_Pillow 17.5/140: 13% focus bestial_wrath, focused_lightning(7)
2:59.567 kill_command Fluffy_Pillow 32.0/140: 23% focus bestial_wrath, dire_beast, focused_lightning(5)
3:00.670 Waiting 0.200 sec 22.6/140: 16% focus bestial_wrath, dire_beast, focused_lightning(4)
3:00.870 a_murder_of_crows Fluffy_Pillow 25.2/140: 18% focus bestial_wrath, dire_beast, focused_lightning(4)
3:02.158 Waiting 1.100 sec 18.2/140: 13% focus bestial_wrath, dire_beast, focused_lightning(3)
3:03.258 cobra_shot Fluffy_Pillow 32.7/140: 23% focus bestial_wrath, dire_beast, focused_lightning(2)
3:04.545 Waiting 0.500 sec 17.7/140: 13% focus dire_beast
3:05.045 titans_thunder Fluffy_Pillow 24.3/140: 17% focus dire_beast
3:05.196 Waiting 0.300 sec 26.3/140: 19% focus dire_beast
3:05.496 kill_command Fluffy_Pillow 30.2/140: 22% focus dire_beast
3:06.597 Waiting 1.900 sec 14.3/140: 10% focus
3:08.497 dire_beast Fluffy_Pillow 36.7/140: 26% focus mark_of_the_claw
3:09.784 Waiting 1.900 sec 53.5/140: 38% focus dire_beast, mark_of_the_claw
3:11.684 kill_command Fluffy_Pillow 78.9/140: 56% focus dire_beast, mark_of_the_claw
3:12.916 Waiting 4.100 sec 65.4/140: 47% focus dire_beast, mark_of_the_claw
3:17.016 cobra_shot Fluffy_Pillow 119.1/140: 85% focus
3:18.302 kill_command Fluffy_Pillow 94.1/140: 67% focus
3:19.403 dire_beast Fluffy_Pillow 77.0/140: 55% focus
3:20.501 Waiting 2.100 sec 91.5/140: 65% focus dire_beast, mark_of_the_claw
3:22.601 cobra_shot Fluffy_Pillow 119.6/140: 85% focus dire_beast, mark_of_the_claw
3:23.868 Waiting 0.600 sec 96.5/140: 69% focus dire_beast, mark_of_the_claw
3:24.468 kill_command Fluffy_Pillow 104.5/140: 75% focus dire_beast, mark_of_the_claw
3:25.723 Waiting 2.200 sec 91.3/140: 65% focus dire_beast, mark_of_the_claw
3:27.923 cobra_shot Fluffy_Pillow 119.7/140: 85% focus
3:29.210 Waiting 0.200 sec 94.7/140: 68% focus
3:29.410 dire_beast Fluffy_Pillow 97.0/140: 69% focus
3:30.681 bestial_wrath Fluffy_Pillow 113.5/140: 81% focus dire_beast
3:30.681 Waiting 0.200 sec 113.5/140: 81% focus bestial_wrath, dire_beast
3:30.881 kill_command Fluffy_Pillow 116.2/140: 83% focus bestial_wrath, dire_beast
3:32.146 cobra_shot Fluffy_Pillow 108.9/140: 78% focus bestial_wrath, dire_beast
3:33.433 dire_beast Fluffy_Pillow 93.8/140: 67% focus bestial_wrath, dire_beast
3:34.535 kill_command Fluffy_Pillow 110.0/140: 79% focus bestial_wrath, dire_beast(2)
3:35.634 cobra_shot Fluffy_Pillow 102.2/140: 73% focus bestial_wrath, dire_beast(2), mark_of_the_claw
3:36.903 kill_command Fluffy_Pillow 89.0/140: 64% focus bestial_wrath, dire_beast(2), mark_of_the_claw
3:37.971 cobra_shot Fluffy_Pillow 79.3/140: 57% focus bestial_wrath, dire_beast, mark_of_the_claw
3:39.241 kill_command Fluffy_Pillow 64.3/140: 46% focus bestial_wrath, dire_beast, mark_of_the_claw
3:40.310 cobra_shot Fluffy_Pillow 54.6/140: 39% focus bestial_wrath, dire_beast, mark_of_the_claw
3:41.578 kill_command Fluffy_Pillow 38.0/140: 27% focus bestial_wrath
3:42.679 Waiting 0.500 sec 26.9/140: 19% focus bestial_wrath
3:43.179 cobra_shot Fluffy_Pillow 32.7/140: 23% focus bestial_wrath
3:44.468 dire_beast Fluffy_Pillow 15.8/140: 11% focus bestial_wrath
3:45.569 kill_command Fluffy_Pillow 30.3/140: 22% focus bestial_wrath, dire_beast
3:46.672 Waiting 5.100 sec 20.9/140: 15% focus dire_beast
3:51.772 kill_command Fluffy_Pillow 88.7/140: 63% focus dire_beast, mark_of_the_claw
3:53.002 Waiting 1.400 sec 73.6/140: 53% focus mark_of_the_claw
3:54.402 dire_beast Fluffy_Pillow 90.2/140: 64% focus mark_of_the_claw
3:55.711 Waiting 0.900 sec 107.3/140: 77% focus dire_beast, mark_of_the_claw
3:56.611 cobra_shot Fluffy_Pillow 119.3/140: 85% focus dire_beast, mark_of_the_claw
3:57.878 Waiting 0.200 sec 96.2/140: 69% focus dire_beast, mark_of_the_claw
3:58.078 kill_command Fluffy_Pillow 98.9/140: 71% focus dire_beast, mark_of_the_claw
3:59.323 Waiting 1.300 sec 85.5/140: 61% focus dire_beast, mark_of_the_claw
4:00.623 a_murder_of_crows Fluffy_Pillow 102.9/140: 74% focus dire_beast, mark_of_the_claw
4:02.137 dire_beast Fluffy_Pillow 93.1/140: 66% focus dire_beast
4:03.239 bestial_wrath Fluffy_Pillow 107.6/140: 77% focus dire_beast
4:03.239 Waiting 0.900 sec 107.6/140: 77% focus bestial_wrath, dire_beast
4:04.139 cobra_shot Fluffy_Pillow 119.5/140: 85% focus bestial_wrath, dire_beast
4:05.426 titans_thunder Fluffy_Pillow 104.5/140: 75% focus bestial_wrath, dire_beast
4:05.426 kill_command Fluffy_Pillow 104.5/140: 75% focus bestial_wrath, dire_beast
4:06.527 cobra_shot Fluffy_Pillow 95.0/140: 68% focus bestial_wrath, dire_beast
4:07.815 aspect_of_the_wild Fluffy_Pillow 80.0/140: 57% focus bestial_wrath, dire_beast
4:07.815 kill_command Fluffy_Pillow 80.0/140: 57% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:08.917 cobra_shot Fluffy_Pillow 81.5/140: 58% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(2)
4:10.206 kill_command Fluffy_Pillow 78.9/140: 56% focus aspect_of_the_wild, bestial_wrath, focused_lightning(3)
4:11.307 cobra_shot Fluffy_Pillow 78.8/140: 56% focus aspect_of_the_wild, bestial_wrath, focused_lightning(4)
4:12.595 dire_beast Fluffy_Pillow 74.7/140: 53% focus aspect_of_the_wild, bestial_wrath, focused_lightning(5)
4:13.697 kill_command Fluffy_Pillow 100.3/140: 72% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(6)
4:14.783 cobra_shot Fluffy_Pillow 101.7/140: 73% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(7), mark_of_the_claw
4:16.052 kill_command Fluffy_Pillow 99.3/140: 71% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(9), mark_of_the_claw
4:17.122 cobra_shot Fluffy_Pillow 100.3/140: 72% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(10), mark_of_the_claw
4:18.391 kill_command Fluffy_Pillow 97.9/140: 70% focus aspect_of_the_wild, dire_beast, focused_lightning(10), mark_of_the_claw
4:19.459 Waiting 1.200 sec 92.9/140: 66% focus aspect_of_the_wild, dire_beast, focused_lightning(9), mark_of_the_claw
4:20.659 cobra_shot Fluffy_Pillow 120.8/140: 86% focus aspect_of_the_wild, focused_lightning(8), mark_of_the_claw
4:21.927 dire_beast Fluffy_Pillow 97.4/140: 70% focus focused_lightning(6), mark_of_the_claw
4:22.995 Waiting 0.600 sec 111.6/140: 80% focus dire_beast, focused_lightning(5), mark_of_the_claw
4:23.595 cobra_shot Fluffy_Pillow 119.6/140: 85% focus dire_beast, focused_lightning(5), mark_of_the_claw
4:24.864 kill_command Fluffy_Pillow 96.6/140: 69% focus dire_beast, focused_lightning(4)
4:25.967 Waiting 2.900 sec 81.1/140: 58% focus dire_beast, focused_lightning(2)
4:28.867 cobra_shot Fluffy_Pillow 119.4/140: 85% focus dire_beast
4:30.153 Waiting 0.900 sec 95.0/140: 68% focus
4:31.053 kill_command Fluffy_Pillow 105.5/140: 75% focus
4:32.381 dire_beast Fluffy_Pillow 91.0/140: 65% focus
4:33.482 Waiting 1.100 sec 105.6/140: 75% focus dire_beast
4:34.582 cobra_shot Fluffy_Pillow 120.1/140: 86% focus dire_beast
4:35.869 Waiting 1.600 sec 97.0/140: 69% focus dire_beast
4:37.469 kill_command Fluffy_Pillow 118.1/140: 84% focus dire_beast
4:38.798 Waiting 1.100 sec 105.7/140: 75% focus dire_beast
4:39.898 cobra_shot Fluffy_Pillow 120.2/140: 86% focus dire_beast
4:41.187 Waiting 1.300 sec 95.3/140: 68% focus
4:42.487 dire_beast Fluffy_Pillow 110.5/140: 79% focus
4:43.749 bestial_wrath Fluffy_Pillow 126.9/140: 91% focus dire_beast
4:43.749 cobra_shot Fluffy_Pillow 126.9/140: 91% focus bestial_wrath, dire_beast
4:45.035 kill_command Fluffy_Pillow 112.0/140: 80% focus bestial_wrath, dire_beast, mark_of_the_claw
4:46.106 cobra_shot Fluffy_Pillow 102.3/140: 73% focus bestial_wrath, dire_beast, mark_of_the_claw
4:47.374 kill_command Fluffy_Pillow 87.3/140: 62% focus bestial_wrath, dire_beast, mark_of_the_claw
4:48.445 cobra_shot Fluffy_Pillow 77.6/140: 55% focus bestial_wrath, dire_beast, mark_of_the_claw
4:49.713 kill_command Fluffy_Pillow 62.5/140: 45% focus bestial_wrath, dire_beast, mark_of_the_claw
4:50.784 cobra_shot Fluffy_Pillow 51.2/140: 37% focus bestial_wrath, mark_of_the_claw
4:52.053 kill_command Fluffy_Pillow 34.3/140: 24% focus bestial_wrath, focused_lightning(2), mark_of_the_claw
4:53.123 dire_beast Fluffy_Pillow 23.0/140: 16% focus bestial_wrath, focused_lightning(3), mark_of_the_claw
4:54.191 cobra_shot Fluffy_Pillow 37.2/140: 27% focus bestial_wrath, dire_beast, focused_lightning(4), mark_of_the_claw
4:55.459 Waiting 0.200 sec 22.2/140: 16% focus bestial_wrath, dire_beast, focused_lightning(5), mark_of_the_claw
4:55.659 kill_command Fluffy_Pillow 24.8/140: 18% focus bestial_wrath, dire_beast, focused_lightning(5), mark_of_the_claw
4:56.728 Waiting 1.300 sec 15.1/140: 11% focus bestial_wrath, dire_beast, focused_lightning(6), mark_of_the_claw
4:58.028 cobra_shot Fluffy_Pillow 32.5/140: 23% focus bestial_wrath, dire_beast, focused_lightning(8), mark_of_the_claw
4:59.295 Waiting 1.000 sec 17.4/140: 12% focus dire_beast, focused_lightning(9), mark_of_the_claw
5:00.295 kill_command Fluffy_Pillow 30.8/140: 22% focus dire_beast, focused_lightning(10)
5:01.397 Waiting 1.400 sec 14.0/140: 10% focus focused_lightning(10)
5:02.797 a_murder_of_crows Fluffy_Pillow 30.4/140: 22% focus focused_lightning(8)
5:04.085 dire_beast Fluffy_Pillow 15.4/140: 11% focus focused_lightning(7)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6231 6231 0
Agility 29075 27710 17363 (13690)
Stamina 41882 41882 25957
Intellect 6005 6005 0
Spirit 2 2 0
Health 2512920 2512920 0
Focus 140 140 0
Crit 24.67% 24.67% 3384
Haste 16.90% 16.90% 5491
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 29075 27710 0
Mastery 80.32% 80.32% 9694
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1448 Sta, +1115 Mastery, +939 Haste }, enchant: mark_of_the_claw
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 880, stats: { 341 Armor, +1930 Sta, +1287 AgiInt, +735 Mastery, +360 Haste }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist Roar of the Seven Lions
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 Agi, +626 Haste, +469 Mastery }
Local Legs Singular Chain Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +1012 Mastery, +448 Haste }
Local Feet Black Venom Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +759 Haste, +336 Mastery }
Local Wrists Manacles of the Nightmare Colossus
ilevel: 880, stats: { 199 Armor, +1447 Sta, +965 AgiInt, +481 Haste, +340 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Finger1 Mindrend Band
ilevel: 880, stats: { +1448 Sta, +1292 Mastery, +763 Haste }, enchant: { +200 Mastery }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Trinket2 Stormsinger Fulmination Charge
ilevel: 840, stats: { +1123 AgiInt }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand Titanstrike
ilevel: 906, weapon: { 11779 - 11781, 3 }, stats: { +2186 Agi, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Big Game Hunter (Beast Mastery Hunter) Way of the Cobra (Beast Mastery Hunter) Dire Stable (Beast Mastery Hunter)
30 Stomp (Beast Mastery Hunter) Dire Frenzy (Beast Mastery Hunter) Chimaera Shot (Beast Mastery Hunter)
45 Posthaste Farstrider Trailblazer
60 One with the Pack (Beast Mastery Hunter) Bestial Fury (Beast Mastery Hunter) Blink Strikes (Beast Mastery Hunter)
75 Binding Shot Wyvern Sting Intimidation (Beast Mastery Hunter)
90 A Murder of Crows Barrage Volley
100 Stampede (Beast Mastery Hunter) Killer Cobra (Beast Mastery Hunter) Aspect of the Beast

Profile

hunter="Hunter_BM_T19M"
level=110
race=pandaren
role=attack
position=ranged_back
talents=1102012
artifact=56:0:0:0:0:868:3:869:3:870:3:871:3:872:3:873:3:874:3:875:3:876:1:877:1:878:1:879:1:880:1:881:1:882:1:1095:3:1336:1
spec=beast_mastery

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=deadly_grace
actions+=/a_murder_of_crows
actions+=/stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
actions+=/dire_beast,if=cooldown.bestial_wrath.remains>2
actions+=/dire_frenzy,if=cooldown.bestial_wrath.remains>2
actions+=/aspect_of_the_wild,if=buff.bestial_wrath.up
actions+=/barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
actions+=/titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
actions+=/bestial_wrath
actions+=/multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
actions+=/kill_command
actions+=/multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
actions+=/chimaera_shot,if=focus<90
actions+=/cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806,enchant=mark_of_the_claw
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=manacles_of_the_nightmare_colossus,id=139222,bonus_id=1806
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1806
waist=roar_of_the_seven_lions,id=137080,bonus_id=1806
legs=singular_chain_leggings,id=139215,bonus_id=1806
feet=black_venom_sabatons,id=139219,bonus_id=1806
finger1=mindrend_band,id=138220,bonus_id=1806,enchant=200mastery
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200mastery
trinket1=twisting_wind,id=139323,bonus_id=1806
trinket2=stormsinger_fulmination_charge,id=137367,bonus_id=1727
main_hand=titanstrike,id=128861,gem_id=139262/139269/139255,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=879.07
# gear_agility=17363
# gear_stamina=25957
# gear_crit_rating=3384
# gear_haste_rating=5491
# gear_mastery_rating=9694
# gear_armor=2758
summon_pet=cat

Hunter_MM_T19M : 359806 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
359805.7 359805.7 372.7 / 0.104% 64653.2 / 18.0% 19219.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
18.7 18.7 Focus 12.93% 37.0 100.0% 100%
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 60: Patient Sniper (Marksmanship Hunter)
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hunter_MM_T19M 359806
Aimed Shot 148189 (173606) 41.2% (48.3%) 91.6 3.26sec 569265 384278 Direct 91.5 325712 774409 486558 35.8%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.59 91.47 0.00 0.00 1.4814 0.0000 44505501.37 65427302.70 31.98 384278.37 384278.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.68 64.15% 325712.03 122561 456909 325743.99 303972 350097 19112347 28096960 31.98
crit 32.79 35.85% 774409.01 261055 1489522 775112.87 670583 915992 25393154 37330342 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 25417 7.1% 0.0 0.00sec 0 0 Direct 81.9 62310 148801 93200 35.7%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 81.90 0.00 0.00 0.0000 0.0000 7633387.95 11221803.33 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.65 64.29% 62309.90 24032 89590 62309.79 38622 71469 3280717 4822965 31.98
crit 29.25 35.71% 148800.95 51187 292063 148637.29 97576 204780 4352671 6398838 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 16087 4.5% 119.4 2.52sec 40491 16177 Direct 119.4 29694 65657 40491 30.0%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.36 119.36 0.00 0.00 2.5031 0.0000 4833075.83 7105079.26 31.98 16176.63 16176.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.53 69.98% 29693.72 29694 29694 29693.72 29694 29694 2480200 3646129 31.98
crit 35.84 30.02% 65656.91 59387 89081 65712.35 59387 74234 2352876 3458951 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 42709 11.9% 13.7 22.87sec 937750 355478 Periodic 218.2 44090 93309 58841 30.0% 10.9%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.69 0.00 218.17 218.17 2.6380 0.1497 12837390.40 18872179.87 31.98 355478.37 355478.37
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 152.8 70.03% 44090.40 42914 53327 44087.46 42914 48547 6736463 9903239 31.98
crit 65.4 29.97% 93309.22 85827 159982 93300.06 85827 109702 6100927 8968941 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 14591 4.0% 33.9 8.92sec 127394 0 Direct 33.9 79173 204753 127501 38.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.88 33.85 0.00 0.00 0.0000 0.0000 4316443.55 4316443.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.82 61.51% 79173.00 79173 79173 79173.00 79173 79173 1648749 1648749 0.00
crit 13.03 38.49% 204752.51 158346 237519 204821.10 166263 237519 2667694 2667694 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 54510 (58521) 15.2% (16.3%) 28.9 10.42sec 607290 522132 Direct 28.9 375507 843582 565650 40.6%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.94 28.94 0.00 0.00 1.1631 0.0000 16371289.42 24067346.18 31.98 522131.70 522131.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.19 59.38% 375506.81 147515 458282 375457.65 318411 414427 6453165 9486764 31.98
crit 11.76 40.62% 843582.01 295031 1374846 844832.11 615723 1151860 9918125 14580583 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Call of the Hunter 4011 1.1% 12.1 46.49sec 99301 0 Direct 12.1 70835 163507 99300 30.7%  

Stats details: call_of_the_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.14 12.14 0.00 0.00 0.0000 0.0000 1205230.12 1771802.44 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.41 69.28% 70834.77 70835 70835 70834.77 70835 70835 595658 875674 31.98
crit 3.73 30.72% 163506.54 141670 212504 158671.28 0 212504 609572 896129 31.05
 
 

Action details: call_of_the_hunter

Static Values
  • id:191070
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191070
  • name:Call of the Hunter
  • school:physical
  • tooltip:
  • description:{$@spelldesc191048=When you Marked Shot, |cFFFFCC99Thas'dorah|r has a chance to call forth a barrage of wind arrows to strike all Vulnerable targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 4088 1.1% 14.6 20.22sec 83975 0 Periodic 72.4 16972 0 16972 0.0% 6.1%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.63 0.00 72.90 72.40 0.0000 0.2497 1228781.48 1228781.48 0.00 67493.22 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.4 100.00% 16972.17 68 16990 16973.19 16485 16990 1228781 1228781 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Sidewinders 17299 4.8% 33.1 9.15sec 157036 134709 Direct 33.1 114546 255613 157037 30.1%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.08 33.08 0.00 0.00 1.1658 0.0000 5195059.24 5195059.24 0.00 134709.17 134709.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.12 69.88% 114545.90 114546 114546 114545.90 114546 114546 2647998 2647998 0.00
crit 9.96 30.12% 255613.42 229092 343638 255865.25 229092 343638 2547062 2547062 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Tormenting Cyclone 5209 1.4% 10.9 26.59sec 143934 0 Direct 74.9 15351 33713 20910 30.3%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.88 74.87 0.00 0.00 0.0000 0.0000 1565443.76 1565443.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.20 69.73% 15351.00 15351 15351 15351.00 15351 15351 801374 801374 0.00
crit 22.66 30.27% 33712.84 30702 46053 33663.10 30702 44774 764070 764070 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Windburst 27697 7.7% 13.2 21.89sec 629061 510785 Direct 14.2 440645 931829 586385 29.7%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.23 14.20 0.00 0.00 1.2316 0.0000 8324256.79 12237445.97 31.98 510784.61 510784.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.98 70.33% 440644.96 429136 533273 440628.73 429136 502038 4399789 6468107 31.98
crit 4.21 29.67% 931829.19 858272 1599820 927620.75 0 1599820 3924467 5769339 31.73
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Hunter_MM_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_MM_T19M
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_MM_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.3 157.95sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.28 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:140.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 17.88% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 1.0 114.9 0.0sec 0.5sec 18.67% 18.67% 85.9(85.9) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.24%
  • bullseye_2:0.25%
  • bullseye_3:0.22%
  • bullseye_4:0.21%
  • bullseye_5:0.21%
  • bullseye_6:0.18%
  • bullseye_7:0.18%
  • bullseye_8:0.18%
  • bullseye_9:0.17%
  • bullseye_10:0.17%
  • bullseye_11:0.17%
  • bullseye_12:0.16%
  • bullseye_13:0.16%
  • bullseye_14:0.15%
  • bullseye_15:0.14%
  • bullseye_16:0.14%
  • bullseye_17:0.13%
  • bullseye_18:0.14%
  • bullseye_19:0.13%
  • bullseye_20:0.14%
  • bullseye_21:0.15%
  • bullseye_22:0.15%
  • bullseye_23:0.16%
  • bullseye_24:0.16%
  • bullseye_25:0.16%
  • bullseye_26:0.16%
  • bullseye_27:0.15%
  • bullseye_28:0.14%
  • bullseye_29:0.13%
  • bullseye_30:13.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Lightning 3.4 0.0 70.1sec 69.4sec 22.08% 22.08% 3.3(3.3) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_focused_lightning
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:643.16

Stack Uptimes

  • focused_lightning_1:2.21%
  • focused_lightning_2:2.21%
  • focused_lightning_3:2.21%
  • focused_lightning_4:2.21%
  • focused_lightning_5:2.21%
  • focused_lightning_6:2.21%
  • focused_lightning_7:2.21%
  • focused_lightning_8:2.21%
  • focused_lightning_9:2.21%
  • focused_lightning_10:2.21%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:215632
  • name:Focused Lightning
  • tooltip:Mastery increased by {$s1=608}.
  • description:{$@spelldesc215630=Your ranged attacks and spells have a chance to trigger Focused Lightning, granting you {$215632s1=608} Mastery every $215631t1 sec. After {$215631d=10 seconds}, this bonus decreases every $215632t2 sec.}
  • max_stacks:10
  • duration:11.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 9.3 0.3 30.1sec 29.1sec 7.06% 11.29% 0.3(0.3) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.12%
  • lock_and_load_2:2.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.4 3.0 26.0sec 20.3sec 25.69% 25.69% 3.0(3.0) 11.1

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Marking Targets 27.6 8.3 11.0sec 8.5sec 34.92% 49.43% 8.3(8.3) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:34.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 257.4sec 0.0sec 19.60% 19.60% 0.0(0.0) 2.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rapid Killing 2.3 0.0 203.1sec 158.0sec 11.33% 19.09% 0.0(0.0) 2.3

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:11.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sentinel's Sight 32.9 0.2 9.2sec 9.2sec 37.47% 33.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_sentinels_sight
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • sentinels_sight_1:37.32%
  • sentinels_sight_2:0.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208913
  • name:Sentinel's Sight
  • tooltip:Increases the damage of your next Aimed Shot by {$s1=10}%.
  • description:{$@spelldesc208912=Each enemy you hit with Multi-Shot increases the damage of your next Aimed Shot by {$208913s1=10}%, stacking up to {$208913u=20} times.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Trueshot 2.3 0.0 203.1sec 158.0sec 11.33% 19.80% 0.0(0.0) 2.3

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:11.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_MM_T19M
aimed_shot Focus 91.6 3645.7 39.8 39.8 14301.3
barrage Focus 13.7 821.4 60.0 60.0 15629.2
marked_shot Focus 28.9 868.3 30.0 30.0 20243.1
windburst Focus 14.2 284.7 20.0 21.5 29243.3
Resource Gains Type Count Total Average Overflow
sidewinders Focus 33.08 1801.94 (32.48%) 54.47 17.56 0.97%
focus_regen Focus 1161.79 3745.80 (67.52%) 3.22 100.21 2.61%
Resource RPS-Gain RPS-Loss
Focus 18.45 18.69
Combat End Resource Mean Min Max
Focus 77.29 2.29 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 1.9%

Procs

Count Interval
starved: barrage 229.7 2.1sec
lock_and_load 9.5 29.1sec
no_vuln_aimed_shot 2.2 78.1sec
no_vuln_marked_shot 0.5 90.8sec
marking_targets 35.8 8.4sec
wasted_marking_targets 8.3 32.6sec

Statistics & Data Analysis

Fight Length
Sample Data Hunter_MM_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Hunter_MM_T19M Damage Per Second
Count 7499
Mean 359805.67
Minimum 304650.73
Maximum 439957.67
Spread ( max - min ) 135306.94
Range [ ( max - min ) / 2 * 100% ] 18.80%
Standard Deviation 16467.8492
5th Percentile 334383.56
95th Percentile 388518.08
( 95th Percentile - 5th Percentile ) 54134.52
Mean Distribution
Standard Deviation 190.1670
95.00% Confidence Intervall ( 359432.95 - 360178.39 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 80
0.1% Error 8046
0.1 Scale Factor Error with Delta=300 2315034
0.05 Scale Factor Error with Delta=300 9260137
0.01 Scale Factor Error with Delta=300 231503432
Priority Target DPS
Sample Data Hunter_MM_T19M Priority Target Damage Per Second
Count 7499
Mean 359805.67
Minimum 304650.73
Maximum 439957.67
Spread ( max - min ) 135306.94
Range [ ( max - min ) / 2 * 100% ] 18.80%
Standard Deviation 16467.8492
5th Percentile 334383.56
95th Percentile 388518.08
( 95th Percentile - 5th Percentile ) 54134.52
Mean Distribution
Standard Deviation 190.1670
95.00% Confidence Intervall ( 359432.95 - 360178.39 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 80
0.1% Error 8046
0.1 Scale Factor Error with Delta=300 2315034
0.05 Scale Factor Error with Delta=300 9260137
0.01 Scale Factor Error with Delta=300 231503432
DPS(e)
Sample Data Hunter_MM_T19M Damage Per Second (Effective)
Count 7499
Mean 359805.67
Minimum 304650.73
Maximum 439957.67
Spread ( max - min ) 135306.94
Range [ ( max - min ) / 2 * 100% ] 18.80%
Damage
Sample Data Hunter_MM_T19M Damage
Count 7499
Mean 108015859.90
Minimum 77893640.79
Maximum 143255247.76
Spread ( max - min ) 65361606.96
Range [ ( max - min ) / 2 * 100% ] 30.26%
DTPS
Sample Data Hunter_MM_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hunter_MM_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hunter_MM_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hunter_MM_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hunter_MM_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hunter_MM_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hunter_MM_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hunter_MM_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
0.00 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
8 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
9 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
A 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
B 4.18 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
C 8.51 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
D 13.29 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
E 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
F 8.06 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
0.00 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
G 52.29 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
H 28.91 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
I 21.70 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
J 2.96 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
K 20.49 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
L 0.39 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
M 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
N 1.28 trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
O 1.00 trueshot
P 1.74 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
Q 3.45 marked_shot
R 1.03 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
S 1.00 barrage
T 7.92 aimed_shot,if=execute_time<debuff.vulnerability.remains
U 1.96 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
V 0.83 marked_shot
0.00 windburst
W 1.44 aimed_shot,if=execute_time<debuff.vulnerability.remains
X 0.84 sidewinders
Y 0.04 aimed_shot
0.00 arcane_shot

Sample Sequence

04567OSTPQTTTUQTTUQRRTPQHHHHBDKGGGIFHHHKGGIDHKCGIKGGIHDHHFCGIHFHHKGDGGIHFBHKGDGGJKGGIKCGIDHHHHKGGIHBDFHHLKGGIHKCDGIHFHHKGCDGJKGGIKGGIKCDGGIHKGGIHBDFGGGIKGGIKGCMNIDFGGGIHHHFGGIHKCDGGGJKGVWXV

Sample Sequence Table

time name target resources buffs
Pre flask Hunter_MM_T19M 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Hunter_MM_T19M 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus mark_of_the_claw, potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus mark_of_the_claw, potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus bloodlust, rapid_killing, trueshot, mark_of_the_claw, potion_of_deadly_grace
0:01.611 aimed_shot Fluffy_Pillow 104.8/150: 70% focus bloodlust, rapid_killing, trueshot, mark_of_the_claw, potion_of_deadly_grace
0:02.542 sidewinders Fluffy_Pillow 74.9/150: 50% focus bloodlust, marking_targets, rapid_killing, trueshot, mark_of_the_claw, potion_of_deadly_grace
0:03.296 marked_shot Fluffy_Pillow 146.1/150: 97% focus bloodlust, marking_targets, rapid_killing, trueshot, sentinels_sight, mark_of_the_claw, potion_of_deadly_grace
0:04.050 aimed_shot Fluffy_Pillow 132.4/150: 88% focus bloodlust, marking_targets, rapid_killing, trueshot, sentinels_sight, mark_of_the_claw, potion_of_deadly_grace
0:04.978 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bloodlust, marking_targets, rapid_killing, trueshot, mark_of_the_claw, potion_of_deadly_grace
0:05.908 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bloodlust, marking_targets, rapid_killing, trueshot, mark_of_the_claw, potion_of_deadly_grace
0:06.839 sidewinders Fluffy_Pillow 40.0/150: 27% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:07.592 marked_shot Fluffy_Pillow 111.0/150: 74% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:08.346 aimed_shot Fluffy_Pillow 97.0/150: 65% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:09.289 aimed_shot Fluffy_Pillow 67.1/150: 45% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:10.234 sidewinders Fluffy_Pillow 37.2/150: 25% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:10.988 marked_shot Fluffy_Pillow 108.2/150: 72% focus bloodlust, lock_and_load(2), rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:11.742 aimed_shot Fluffy_Pillow 94.3/150: 63% focus bloodlust, lock_and_load(2), rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:12.497 aimed_shot Fluffy_Pillow 110.3/150: 74% focus bloodlust, lock_and_load, rapid_killing, trueshot, potion_of_deadly_grace
0:13.253 aimed_shot Fluffy_Pillow 126.4/150: 84% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:14.197 sidewinders Fluffy_Pillow 96.5/150: 64% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:14.951 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:15.706 aimed_shot Fluffy_Pillow 131.8/150: 88% focus bloodlust, sentinels_sight, potion_of_deadly_grace
0:17.025 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, lock_and_load, marking_targets, potion_of_deadly_grace
0:18.016 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets, potion_of_deadly_grace
0:19.334 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bloodlust, marking_targets, potion_of_deadly_grace
0:20.655 barrage Fluffy_Pillow 70.1/150: 47% focus bloodlust, marking_targets, potion_of_deadly_grace
0:22.945 windburst Fluffy_Pillow 44.9/150: 30% focus bloodlust, marking_targets, potion_of_deadly_grace
0:23.939 sidewinders Fluffy_Pillow 40.0/150: 27% focus bloodlust, marking_targets, potion_of_deadly_grace
0:24.932 aimed_shot Fluffy_Pillow 110.1/150: 73% focus bloodlust, sentinels_sight, potion_of_deadly_grace
0:26.252 aimed_shot Fluffy_Pillow 80.4/150: 54% focus bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:27.554 aimed_shot Fluffy_Pillow 50.5/150: 34% focus bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:28.857 Waiting 0.700 sec 20.6/150: 14% focus bloodlust, mark_of_the_claw
0:29.557 marked_shot Fluffy_Pillow 31.4/150: 21% focus bloodlust, mark_of_the_claw
0:30.535 Waiting 1.600 sec 16.4/150: 11% focus bloodlust, mark_of_the_claw
0:32.135 sidewinders Fluffy_Pillow 40.9/150: 27% focus bloodlust
0:33.125 aimed_shot Fluffy_Pillow 111.0/150: 74% focus bloodlust, marking_targets, sentinels_sight, focused_lightning, mark_of_the_claw
0:34.427 aimed_shot Fluffy_Pillow 81.0/150: 54% focus bloodlust, marking_targets, focused_lightning(3), mark_of_the_claw
0:35.728 aimed_shot Fluffy_Pillow 51.1/150: 34% focus bloodlust, marking_targets, focused_lightning(4), mark_of_the_claw
0:37.029 sidewinders Fluffy_Pillow 21.2/150: 14% focus bloodlust, marking_targets, focused_lightning(5), mark_of_the_claw
0:38.005 aimed_shot Fluffy_Pillow 91.2/150: 61% focus bloodlust, sentinels_sight, focused_lightning(6), mark_of_the_claw
0:39.306 aimed_shot Fluffy_Pillow 61.2/150: 41% focus bloodlust, focused_lightning(8)
0:40.626 Waiting 1.500 sec 26.6/150: 18% focus focused_lightning(9)
0:42.126 marked_shot Fluffy_Pillow 44.1/150: 29% focus focused_lightning(10)
0:43.413 Waiting 0.300 sec 29.2/150: 19% focus focused_lightning(9)
0:43.713 windburst Fluffy_Pillow 32.7/150: 22% focus focused_lightning(9)
0:45.219 Waiting 1.700 sec 30.3/150: 20% focus focused_lightning(7), mark_of_the_claw
0:46.919 aimed_shot Fluffy_Pillow 50.5/150: 34% focus focused_lightning(6), mark_of_the_claw
0:48.608 sidewinders Fluffy_Pillow 20.5/150: 14% focus marking_targets, focused_lightning(4), mark_of_the_claw
0:49.878 barrage Fluffy_Pillow 90.5/150: 60% focus sentinels_sight, focused_lightning(3), mark_of_the_claw
0:52.611 aimed_shot Fluffy_Pillow 62.7/150: 42% focus sentinels_sight
0:54.326 marked_shot Fluffy_Pillow 32.8/150: 22% focus mark_of_the_claw
0:55.594 Waiting 2.500 sec 17.8/150: 12% focus mark_of_the_claw
0:58.094 sidewinders Fluffy_Pillow 47.4/150: 32% focus marking_targets, mark_of_the_claw
0:59.363 aimed_shot Fluffy_Pillow 117.5/150: 78% focus sentinels_sight, mark_of_the_claw
1:01.052 aimed_shot Fluffy_Pillow 87.4/150: 58% focus
1:02.765 Waiting 0.400 sec 57.4/150: 38% focus
1:03.165 marked_shot Fluffy_Pillow 62.1/150: 41% focus
1:04.452 Waiting 0.300 sec 47.1/150: 31% focus
1:04.752 aimed_shot Fluffy_Pillow 50.7/150: 34% focus
1:06.467 windburst Fluffy_Pillow 20.7/150: 14% focus focused_lightning
1:07.754 Waiting 0.500 sec 15.7/150: 10% focus focused_lightning(3)
1:08.254 aimed_shot Fluffy_Pillow 21.6/150: 14% focus lock_and_load(2), marking_targets, focused_lightning(3)
1:09.541 aimed_shot Fluffy_Pillow 36.6/150: 24% focus lock_and_load, marking_targets, focused_lightning(4)
1:10.830 sidewinders Fluffy_Pillow 51.7/150: 34% focus marking_targets, focused_lightning(6)
1:12.117 barrage Fluffy_Pillow 121.7/150: 81% focus sentinels_sight, focused_lightning(7)
1:14.825 aimed_shot Fluffy_Pillow 93.5/150: 62% focus sentinels_sight, focused_lightning(10), mark_of_the_claw
1:16.516 marked_shot Fluffy_Pillow 63.6/150: 42% focus focused_lightning(10), mark_of_the_claw
1:17.784 Waiting 0.200 sec 48.6/150: 32% focus focused_lightning(8), mark_of_the_claw
1:17.984 aimed_shot Fluffy_Pillow 51.0/150: 34% focus focused_lightning(8), mark_of_the_claw
1:19.673 Waiting 1.200 sec 21.0/150: 14% focus focused_lightning(6), mark_of_the_claw
1:20.873 sidewinders Fluffy_Pillow 35.1/150: 23% focus focused_lightning(5)
1:22.160 aimed_shot Fluffy_Pillow 105.2/150: 70% focus sentinels_sight, focused_lightning(4)
1:23.874 aimed_shot Fluffy_Pillow 75.2/150: 50% focus marking_targets, focused_lightning(2)
1:25.588 sidewinders Fluffy_Pillow 45.2/150: 30% focus marking_targets, focused_lightning
1:26.874 aimed_shot Fluffy_Pillow 115.3/150: 77% focus sentinels_sight
1:28.589 windburst Fluffy_Pillow 85.3/150: 57% focus
1:29.877 aimed_shot Fluffy_Pillow 80.4/150: 54% focus mark_of_the_claw
1:31.567 aimed_shot Fluffy_Pillow 50.4/150: 34% focus mark_of_the_claw
1:33.257 Waiting 1.700 sec 20.5/150: 14% focus mark_of_the_claw
1:34.957 marked_shot Fluffy_Pillow 40.6/150: 27% focus mark_of_the_claw
1:36.224 Waiting 2.100 sec 25.6/150: 17% focus mark_of_the_claw
1:38.324 aimed_shot Fluffy_Pillow 50.5/150: 34% focus mark_of_the_claw
1:40.016 Waiting 1.200 sec 20.4/150: 14% focus
1:41.216 sidewinders Fluffy_Pillow 34.6/150: 23% focus mark_of_the_claw
1:42.485 barrage Fluffy_Pillow 104.6/150: 70% focus sentinels_sight, mark_of_the_claw
1:45.243 aimed_shot Fluffy_Pillow 77.3/150: 52% focus sentinels_sight, mark_of_the_claw
1:46.935 sidewinders Fluffy_Pillow 47.3/150: 32% focus marking_targets
1:48.222 aimed_shot Fluffy_Pillow 117.4/150: 78% focus sentinels_sight
1:49.938 windburst Fluffy_Pillow 87.4/150: 58% focus
1:51.226 aimed_shot Fluffy_Pillow 82.5/150: 55% focus
1:52.941 aimed_shot Fluffy_Pillow 52.5/150: 35% focus
1:54.656 Waiting 0.700 sec 22.6/150: 15% focus marking_targets
1:55.356 marked_shot Fluffy_Pillow 30.8/150: 21% focus marking_targets
1:56.644 sidewinders Fluffy_Pillow 15.8/150: 11% focus marking_targets
1:57.931 aimed_shot Fluffy_Pillow 85.9/150: 57% focus sentinels_sight
1:59.646 aimed_shot Fluffy_Pillow 55.9/150: 37% focus marking_targets
2:01.359 Waiting 0.400 sec 25.9/150: 17% focus marking_targets
2:01.759 marked_shot Fluffy_Pillow 30.6/150: 20% focus marking_targets
2:03.047 sidewinders Fluffy_Pillow 15.7/150: 10% focus marking_targets
2:04.335 barrage Fluffy_Pillow 85.7/150: 57% focus sentinels_sight
2:07.096 aimed_shot Fluffy_Pillow 58.0/150: 39% focus sentinels_sight, focused_lightning(3)
2:08.811 Waiting 0.200 sec 28.1/150: 19% focus marking_targets, focused_lightning(5)
2:09.011 marked_shot Fluffy_Pillow 30.4/150: 20% focus marking_targets, focused_lightning(5)
2:10.298 Waiting 0.700 sec 15.4/150: 10% focus marking_targets, focused_lightning(6)
2:10.998 windburst Fluffy_Pillow 23.6/150: 16% focus marking_targets, focused_lightning(7)
2:12.508 Waiting 0.100 sec 21.3/150: 14% focus marking_targets, focused_lightning(9)
2:12.608 aimed_shot Fluffy_Pillow 22.4/150: 15% focus lock_and_load(2), marking_targets, focused_lightning(9)
2:13.895 aimed_shot Fluffy_Pillow 37.5/150: 25% focus lock_and_load, marking_targets, focused_lightning(10)
2:15.182 aimed_shot Fluffy_Pillow 52.5/150: 35% focus lock_and_load(2), marking_targets, focused_lightning(10)
2:16.469 aimed_shot Fluffy_Pillow 67.6/150: 45% focus lock_and_load, marking_targets, focused_lightning(8)
2:17.756 sidewinders Fluffy_Pillow 82.6/150: 55% focus marking_targets, focused_lightning(7)
2:19.045 aimed_shot Fluffy_Pillow 150.0/150: 100% focus sentinels_sight, focused_lightning(6)
2:20.760 aimed_shot Fluffy_Pillow 100.1/150: 67% focus focused_lightning(4)
2:22.474 Waiting 0.300 sec 70.1/150: 47% focus focused_lightning(2)
2:22.774 marked_shot Fluffy_Pillow 73.6/150: 49% focus focused_lightning(2)
2:24.062 aimed_shot Fluffy_Pillow 58.7/150: 39% focus focused_lightning
2:25.778 Waiting 2.700 sec 28.8/150: 19% focus mark_of_the_claw
2:28.478 barrage Fluffy_Pillow 60.8/150: 41% focus mark_of_the_claw
2:31.300 Waiting 1.000 sec 34.3/150: 23% focus mark_of_the_claw
2:32.300 windburst Fluffy_Pillow 46.0/150: 31% focus
2:33.792 sidewinders Fluffy_Pillow 43.4/150: 29% focus focused_lightning
2:35.080 aimed_shot Fluffy_Pillow 113.5/150: 76% focus sentinels_sight, focused_lightning(2)
2:36.795 aimed_shot Fluffy_Pillow 83.5/150: 56% focus focused_lightning(4)
2:38.509 Waiting 2.300 sec 53.6/150: 36% focus focused_lightning(5)
2:40.809 aimed_shot Fluffy_Pillow 80.4/150: 54% focus focused_lightning(8)
2:42.523 sidewinders Fluffy_Pillow 50.5/150: 34% focus marking_targets, focused_lightning(9)
2:43.811 aimed_shot Fluffy_Pillow 120.5/150: 80% focus sentinels_sight, focused_lightning(10)
2:45.524 aimed_shot Fluffy_Pillow 90.6/150: 60% focus focused_lightning(9)
2:47.240 Waiting 0.300 sec 60.6/150: 40% focus focused_lightning(7)
2:47.540 marked_shot Fluffy_Pillow 64.1/150: 43% focus focused_lightning(7)
2:48.828 Waiting 0.100 sec 49.2/150: 33% focus focused_lightning(5)
2:48.928 aimed_shot Fluffy_Pillow 50.3/150: 34% focus focused_lightning(5)
2:50.642 sidewinders Fluffy_Pillow 20.4/150: 14% focus marking_targets, focused_lightning(4)
2:51.930 barrage Fluffy_Pillow 90.4/150: 60% focus sentinels_sight, focused_lightning(2)
2:54.742 windburst Fluffy_Pillow 63.3/150: 42% focus sentinels_sight
2:56.028 aimed_shot Fluffy_Pillow 58.3/150: 39% focus sentinels_sight, mark_of_the_claw
2:57.719 Waiting 3.400 sec 28.4/150: 19% focus mark_of_the_claw
3:01.119 marked_shot Fluffy_Pillow 68.7/150: 46% focus mark_of_the_claw
3:02.387 aimed_shot Fluffy_Pillow 53.7/150: 36% focus
3:04.099 sidewinders Fluffy_Pillow 23.7/150: 16% focus
3:05.387 aimed_shot Fluffy_Pillow 93.8/150: 63% focus sentinels_sight
3:07.100 aimed_shot Fluffy_Pillow 63.8/150: 43% focus mark_of_the_claw
3:08.792 Waiting 1.500 sec 33.8/150: 23% focus mark_of_the_claw
3:10.292 sidewinders Fluffy_Pillow 51.6/150: 34% focus marking_targets, mark_of_the_claw
3:11.558 aimed_shot Fluffy_Pillow 121.6/150: 81% focus sentinels_sight, mark_of_the_claw
3:13.248 barrage Fluffy_Pillow 91.7/150: 61% focus marking_targets
3:16.066 windburst Fluffy_Pillow 64.6/150: 43% focus marking_targets
3:17.352 aimed_shot Fluffy_Pillow 59.6/150: 40% focus marking_targets, mark_of_the_claw
3:19.041 Waiting 0.100 sec 29.7/150: 20% focus marking_targets, mark_of_the_claw
3:19.141 marked_shot Fluffy_Pillow 30.9/150: 21% focus marking_targets, mark_of_the_claw
3:20.409 sidewinders Fluffy_Pillow 15.9/150: 11% focus marking_targets, mark_of_the_claw
3:21.677 aimed_shot Fluffy_Pillow 85.9/150: 57% focus sentinels_sight, mark_of_the_claw
3:23.366 aimed_shot Fluffy_Pillow 56.0/150: 37% focus
3:25.082 Waiting 0.400 sec 26.0/150: 17% focus
3:25.482 marked_shot Fluffy_Pillow 30.7/150: 20% focus
3:26.771 Waiting 2.300 sec 15.8/150: 11% focus
3:29.071 sidewinders Fluffy_Pillow 42.6/150: 28% focus marking_targets
3:30.358 aimed_shot Fluffy_Pillow 112.7/150: 75% focus sentinels_sight
3:32.072 aimed_shot Fluffy_Pillow 82.8/150: 55% focus marking_targets, mark_of_the_claw
3:33.763 Waiting 0.400 sec 52.9/150: 35% focus marking_targets, mark_of_the_claw
3:34.163 marked_shot Fluffy_Pillow 57.6/150: 38% focus marking_targets, mark_of_the_claw
3:35.434 sidewinders Fluffy_Pillow 42.7/150: 28% focus marking_targets, mark_of_the_claw
3:36.702 barrage Fluffy_Pillow 112.7/150: 75% focus sentinels_sight, mark_of_the_claw
3:39.426 windburst Fluffy_Pillow 84.7/150: 56% focus sentinels_sight
3:40.714 aimed_shot Fluffy_Pillow 79.8/150: 53% focus sentinels_sight
3:42.429 Waiting 0.100 sec 49.8/150: 33% focus mark_of_the_claw
3:42.529 aimed_shot Fluffy_Pillow 51.0/150: 34% focus mark_of_the_claw
3:44.221 Waiting 1.500 sec 21.1/150: 14% focus mark_of_the_claw
3:45.721 marked_shot Fluffy_Pillow 38.9/150: 26% focus mark_of_the_claw
3:46.991 Waiting 2.300 sec 23.9/150: 16% focus mark_of_the_claw
3:49.291 aimed_shot Fluffy_Pillow 51.0/150: 34% focus
3:51.005 Waiting 1.500 sec 21.1/150: 14% focus
3:52.505 sidewinders Fluffy_Pillow 38.6/150: 26% focus marking_targets
3:53.794 aimed_shot Fluffy_Pillow 108.7/150: 72% focus sentinels_sight
3:55.509 aimed_shot Fluffy_Pillow 78.7/150: 52% focus
3:57.221 Waiting 0.300 sec 48.7/150: 32% focus
3:57.521 marked_shot Fluffy_Pillow 52.2/150: 35% focus
3:58.810 Waiting 1.100 sec 37.3/150: 25% focus
3:59.910 aimed_shot Fluffy_Pillow 50.2/150: 33% focus
4:01.624 barrage Fluffy_Pillow 70.4/150: 47% focus lock_and_load, marking_targets, mark_of_the_claw
4:04.422 windburst Fluffy_Pillow 43.6/150: 29% focus lock_and_load, marking_targets, mark_of_the_claw
4:05.690 sidewinders Fluffy_Pillow 38.7/150: 26% focus lock_and_load, marking_targets, mark_of_the_claw
4:06.958 aimed_shot Fluffy_Pillow 108.7/150: 72% focus lock_and_load, sentinels_sight, mark_of_the_claw
4:08.228 aimed_shot Fluffy_Pillow 123.8/150: 83% focus mark_of_the_claw
4:09.917 aimed_shot Fluffy_Pillow 93.8/150: 63% focus mark_of_the_claw
4:11.607 marked_shot Fluffy_Pillow 63.8/150: 43% focus mark_of_the_claw
4:12.876 sidewinders Fluffy_Pillow 48.9/150: 33% focus bullseye(9), marking_targets, mark_of_the_claw
4:14.145 aimed_shot Fluffy_Pillow 118.9/150: 79% focus bullseye(10), sentinels_sight, mark_of_the_claw
4:15.836 aimed_shot Fluffy_Pillow 89.0/150: 59% focus bullseye(11), marking_targets, mark_of_the_claw
4:17.526 Waiting 0.400 sec 58.8/150: 39% focus bullseye(13), marking_targets
4:17.926 marked_shot Fluffy_Pillow 63.4/150: 42% focus bullseye(14), marking_targets
4:19.211 sidewinders Fluffy_Pillow 48.4/150: 32% focus bullseye(15), marking_targets
4:20.497 aimed_shot Fluffy_Pillow 118.5/150: 79% focus bullseye(17), marking_targets, sentinels_sight
4:22.210 barrage Fluffy_Pillow 88.5/150: 59% focus bullseye(17), marking_targets, focused_lightning
4:25.005 potion Fluffy_Pillow 61.2/150: 41% focus bullseye(30), marking_targets, focused_lightning(3)
4:25.005 trueshot Fluffy_Pillow 61.2/150: 41% focus bullseye(30), marking_targets, focused_lightning(3), potion_of_deadly_grace
4:25.005 marked_shot Fluffy_Pillow 61.2/150: 41% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(3), potion_of_deadly_grace
4:25.927 windburst Fluffy_Pillow 46.3/150: 31% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(4), potion_of_deadly_grace
4:26.847 sidewinders Fluffy_Pillow 41.3/150: 28% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(5), mark_of_the_claw, potion_of_deadly_grace
4:27.755 aimed_shot Fluffy_Pillow 111.4/150: 74% focus bullseye(30), rapid_killing, trueshot, sentinels_sight, focused_lightning(6), mark_of_the_claw, potion_of_deadly_grace
4:28.965 aimed_shot Fluffy_Pillow 81.5/150: 54% focus bullseye(30), rapid_killing, trueshot, focused_lightning(7), mark_of_the_claw, potion_of_deadly_grace
4:30.173 aimed_shot Fluffy_Pillow 51.5/150: 34% focus bullseye(30), rapid_killing, trueshot, focused_lightning(8), mark_of_the_claw, potion_of_deadly_grace
4:31.380 Waiting 0.600 sec 21.6/150: 14% focus bullseye(30), rapid_killing, trueshot, focused_lightning(10), mark_of_the_claw, potion_of_deadly_grace
4:31.980 marked_shot Fluffy_Pillow 31.5/150: 21% focus bullseye(30), rapid_killing, trueshot, focused_lightning(10), mark_of_the_claw, potion_of_deadly_grace
4:32.889 aimed_shot Fluffy_Pillow 16.6/150: 11% focus bullseye(30), lock_and_load(2), marking_targets, rapid_killing, trueshot, focused_lightning(10), potion_of_deadly_grace
4:33.811 aimed_shot Fluffy_Pillow 31.7/150: 21% focus bullseye(30), lock_and_load, marking_targets, rapid_killing, trueshot, focused_lightning(9), potion_of_deadly_grace
4:34.730 Waiting 0.200 sec 46.8/150: 31% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(8), potion_of_deadly_grace
4:34.930 aimed_shot Fluffy_Pillow 50.0/150: 33% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(8), potion_of_deadly_grace
4:36.156 Waiting 0.300 sec 20.1/150: 13% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(7), potion_of_deadly_grace
4:36.456 sidewinders Fluffy_Pillow 25.0/150: 17% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(6), potion_of_deadly_grace
4:37.570 aimed_shot Fluffy_Pillow 98.2/150: 65% focus bullseye(30), rapid_killing, trueshot, sentinels_sight, focused_lightning(5), potion_of_deadly_grace
4:38.796 aimed_shot Fluffy_Pillow 68.3/150: 46% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(4), potion_of_deadly_grace
4:40.024 Waiting 1.700 sec 38.3/150: 26% focus bullseye(30), marking_targets, focused_lightning(3), potion_of_deadly_grace
4:41.724 marked_shot Fluffy_Pillow 58.2/150: 39% focus bullseye(30), marking_targets, focused_lightning, potion_of_deadly_grace
4:43.012 Waiting 0.600 sec 43.2/150: 29% focus bullseye(30), marking_targets, potion_of_deadly_grace
4:43.612 aimed_shot Fluffy_Pillow 50.2/150: 33% focus bullseye(30), marking_targets, potion_of_deadly_grace
4:45.326 sidewinders Fluffy_Pillow 20.3/150: 14% focus bullseye(30), marking_targets, potion_of_deadly_grace
4:46.614 barrage Fluffy_Pillow 90.3/150: 60% focus bullseye(30), sentinels_sight, potion_of_deadly_grace
4:49.334 windburst Fluffy_Pillow 62.1/150: 41% focus bullseye(30), sentinels_sight, potion_of_deadly_grace
4:50.622 aimed_shot Fluffy_Pillow 57.2/150: 38% focus bullseye(30), marking_targets, sentinels_sight, potion_of_deadly_grace
4:52.337 aimed_shot Fluffy_Pillow 77.2/150: 51% focus bullseye(30), lock_and_load, marking_targets, potion_of_deadly_grace
4:53.624 aimed_shot Fluffy_Pillow 92.3/150: 62% focus bullseye(30), marking_targets, potion_of_deadly_grace
4:55.338 marked_shot Fluffy_Pillow 62.4/150: 42% focus bullseye(30), marking_targets, mark_of_the_claw
4:56.608 sidewinders Fluffy_Pillow 47.5/150: 32% focus bullseye(30), marking_targets, mark_of_the_claw
4:57.877 aimed_shot Fluffy_Pillow 117.5/150: 78% focus bullseye(30), sentinels_sight, mark_of_the_claw
4:59.568 marked_shot Fluffy_Pillow 87.6/150: 58% focus bullseye(30), mark_of_the_claw
5:00.835 aimed_shot Fluffy_Pillow 72.6/150: 48% focus bullseye(30)
5:02.548 sidewinders Fluffy_Pillow 42.6/150: 28% focus bullseye(30), marking_targets
5:03.837 marked_shot Fluffy_Pillow 112.7/150: 75% focus bullseye(30), sentinels_sight

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6231 6231 0
Agility 29075 27710 17363 (13690)
Stamina 41882 41882 25957
Intellect 6005 6005 0
Spirit 2 2 0
Health 2512920 2512920 0
Focus 150 150 0
Crit 24.67% 24.67% 3384
Haste 16.90% 16.90% 5491
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 29075 27710 0
Mastery 22.31% 22.31% 9694
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1448 Sta, +1115 Mastery, +939 Haste }, enchant: mark_of_the_claw
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 880, stats: { 341 Armor, +1930 Sta, +1287 AgiInt, +735 Mastery, +360 Haste }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist War Belt of the Sentinel Army
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 Agi, +626 Haste, +469 Mastery }
Local Legs Singular Chain Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +1012 Mastery, +448 Haste }
Local Feet Black Venom Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +759 Haste, +336 Mastery }
Local Wrists Manacles of the Nightmare Colossus
ilevel: 880, stats: { 199 Armor, +1447 Sta, +965 AgiInt, +481 Haste, +340 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Finger1 Mindrend Band
ilevel: 880, stats: { +1448 Sta, +1292 Mastery, +763 Haste }, enchant: { +200 Mastery }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Trinket2 Stormsinger Fulmination Charge
ilevel: 840, stats: { +1123 AgiInt }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 906, weapon: { 11779 - 11781, 3 }, stats: { +2186 Agi, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Hunter_MM_T19M"
level=110
race=pandaren
role=attack
position=ranged_back
talents=1103021
artifact=55:0:0:0:0:307:1:308:1:309:1:310:1:311:1:312:3:313:3:314:3:315:3:316:3:317:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=/trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806,enchant=mark_of_the_claw
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=manacles_of_the_nightmare_colossus,id=139222,bonus_id=1806
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1806
waist=war_belt_of_the_sentinel_army,id=137081,bonus_id=1806
legs=singular_chain_leggings,id=139215,bonus_id=1806
feet=black_venom_sabatons,id=139219,bonus_id=1806
finger1=mindrend_band,id=138220,bonus_id=1806,enchant=200mastery
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200mastery
trinket1=twisting_wind,id=139323,bonus_id=1806
trinket2=stormsinger_fulmination_charge,id=137367,bonus_id=1727
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,gem_id=139262/139257/138228,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=879.07
# gear_agility=17363
# gear_stamina=25957
# gear_crit_rating=3384
# gear_haste_rating=5491
# gear_mastery_rating=9694
# gear_armor=2758
summon_pet=cat

Hunter_SV_T19M : 334333 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
334332.7 334332.7 181.9 / 0.054% 31293.9 / 9.4% 24808.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.0 12.0 Focus 19.71% 40.5 100.0% 100%
Talents
  • 15: Way of the Mok'Nathal (Survival Hunter)
  • 30: Snake Hunter (Survival Hunter)
  • 60: Improved Traps (Survival Hunter)
  • 90: Dragonsfire Grenade (Survival Hunter)
  • 100: Expert Trapper (Survival Hunter)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hunter_SV_T19M 334333
auto_attack_mh 18894 (23991) 5.7% (7.2%) 104.3 2.88sec 69125 24054 Direct 104.3 37488 74972 54451 45.3%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.30 104.30 0.00 0.00 2.8738 0.0000 5679325.71 8349146.75 31.98 24054.07 24054.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.10 54.75% 37488.20 33078 46472 37487.38 35554 39207 2140690 3147017 31.98
crit 47.20 45.25% 74972.20 66156 92944 74970.52 71475 79380 3538636 5202130 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Talon Strike 5097 1.5% 20.9 26.34sec 73376 0 Direct 20.9 50444 101016 73376 45.3%  

Stats details: talon_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.86 20.86 0.00 0.00 0.0000 0.0000 1530618.48 2250154.15 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.40 54.65% 50444.21 43262 62990 50432.46 0 62990 575087 845432 31.96
crit 9.46 45.35% 101015.51 86524 125979 100955.80 0 125979 955531 1404722 31.96
 
 

Action details: talon_strike

Static Values
  • id:203525
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203525
  • name:Talon Strike
  • school:physical
  • tooltip:
  • description:Deals $m1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Dragonsfire Grenade 19922 6.0% 10.3 30.57sec 581163 585773 Direct 10.2 100410 0 100410 0.0%  
Periodic 80.7 42260 84554 61432 45.3% 26.8%

Stats details: dragonsfire_grenade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.31 10.24 80.75 80.75 0.9921 1.0000 5988944.46 5988944.46 0.00 65832.11 585773.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.24 100.00% 100409.58 88332 128612 100373.06 92970 107876 1028391 1028391 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.1 54.67% 42260.50 36069 52517 42263.39 39481 45604 1865655 1865655 0.00
crit 36.6 45.33% 84554.32 72138 105033 84559.67 78388 90605 3094898 3094898 0.00
 
 

Action details: dragonsfire_grenade

Static Values
  • id:194855
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194855
  • name:Dragonsfire Grenade
  • school:physical
  • tooltip:
  • description:Hurls a dragonsfire grenade at the target that explodes into flames, inflicting ${$194858o1+{$194858s3=0}} Fire damage over {$194858d=8 seconds} and reducing movement speed by {$194858s2=20}%. The volatile flames on the target also scorch nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.225000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Explosive Trap 54050 16.2% 24.8 12.37sec 655654 656697 Direct 24.8 223219 446392 324298 45.3%  
Periodic 243.4 23221 46450 33753 45.3% 80.9%

Stats details: explosive_trap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.79 24.79 243.37 243.37 0.9984 1.0000 16253906.74 16253906.74 0.00 60621.54 656696.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.56 54.71% 223219.44 198380 288841 223166.12 209432 259084 3027417 3027417 0.00
crit 11.23 45.29% 446392.24 396760 577682 446307.47 416102 530071 5012063 5012063 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.0 54.66% 23221.11 19838 28884 23221.16 22367 24048 3089121 3089121 0.00
crit 110.3 45.34% 46450.14 39676 57768 46451.88 44707 48393 5125306 5125306 0.00
 
 

Action details: explosive_trap

Static Values
  • id:13812
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:13812
  • name:Explosive Trap
  • school:fire
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:{$@spelldesc191433=Tosses a fire trap on the ground in front of you that explodes when an enemy approaches, causing {$13812s1=0} Fire damage and burning all enemies within $13812A1 yards for $13812o2 additional Fire damage over {$13812d=10 seconds}. Trap will exist for {$13813d=60 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.350000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Flanking Strike 26197 7.8% 29.6 9.78sec 266064 220549 Direct 29.6 167936 335944 266068 58.4%  

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.60 29.60 0.00 0.00 1.2064 0.0000 7876025.99 11578504.25 31.98 220549.02 220549.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.31 41.59% 167935.77 155199 213392 167862.47 158182 187477 2067633 3039617 31.98
crit 17.29 58.41% 335944.08 310398 426784 335839.74 317855 379196 5808393 8538887 31.98
 
 

Action details: flanking_strike

Static Values
  • id:202800
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains>=3)|!talent.way_of_the_moknathal.enabled
Spelldata
  • id:202800
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:A coordinated attack on the target, where you deal ${$sw1*$<mult>} Physical damage and your pet deals $<damage> Physical damage. If the target is attacking you, your pet's attack will deal {$s3=50}% increased damage and {$s4=400}% increased threat. Otherwise, your attack will deal {$s3=50}% increased damage.{$?s191334=false}[ Flanking strike has double the normal chance to trigger Hunting Companion.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.25
 
Fury of the Eagle 29751 8.9% 6.6 47.90sec 1357559 395697 Periodic 58.9 104465 208687 151727 45.3% 7.0%

Stats details: fury_of_the_eagle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.58 0.00 58.89 58.89 3.4309 0.3552 8934833.82 13135052.05 31.98 395696.80 395696.80
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.2 54.65% 104465.35 27039 157474 104606.55 62552 138504 3362139 4942663 31.98
crit 26.7 45.35% 208686.62 54078 314948 208976.80 114156 278872 5572695 8192389 31.98
 
 

Action details: fury_of_the_eagle

Static Values
  • id:203415
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.mongoose_fury.up&(buff.mongoose_fury.stack=6|action.mongoose_bite.charges=0&cooldown.snake_hunter.remains|buff.mongoose_fury.remains<=gcd.max*2)
Spelldata
  • id:203415
  • name:Fury of the Eagle
  • school:physical
  • tooltip:
  • description:Furiously strikes all enemies in front of you, dealing ${{$203413s1=0}*9} Physical damage. Damage increased by Mongoose Fury.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 

Action details: fury_of_the_eagle_tick

Static Values
  • id:203413
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203413
  • name:Fury of the Eagle
  • school:physical
  • tooltip:
  • description:{$@spelldesc203415=Furiously strikes all enemies in front of you, dealing ${{$203413s1=0}*9} Physical damage. Damage increased by Mongoose Fury.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Lacerate 44373 13.3% 25.2 11.85sec 529146 437041 Direct 25.2 44334 88800 64600 45.6%  
Periodic 288.1 27992 55988 40675 45.3% 95.5%

Stats details: lacerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.23 25.23 288.10 288.10 1.2108 0.9965 13348100.55 14114171.57 5.43 42021.81 437040.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.73 54.42% 44334.07 39275 55519 44327.61 40848 51201 608629 894742 31.98
crit 11.50 45.58% 88800.28 78550 111038 88785.15 81124 104129 1020981 1500939 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 157.6 54.70% 27991.64 24 35056 27991.16 26858 28957 4410986 4410986 0.00
crit 130.5 45.30% 55987.72 50 70111 55987.08 53634 58263 7307505 7307505 0.00
 
 

Action details: lacerate

Static Values
  • id:185855
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.lacerate.ticking&dot.lacerate.remains<=3|target.time_to_die>=5
Spelldata
  • id:185855
  • name:Lacerate
  • school:physical
  • tooltip:Bleeding for {$s1=1} damage every $t1 sec.
  • description:Tears a bleeding wound in the target, dealing ${$o1+{$s2=0}} Physical damage over {$d=12 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.670000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Mongoose Bite 45986 13.7% 44.9 6.61sec 307256 258388 Direct 44.9 211475 422935 307265 45.3%  

Stats details: mongoose_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.91 44.91 0.00 0.00 1.1891 0.0000 13799203.46 20286136.18 31.98 258387.86 258387.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.57 54.70% 211474.73 85866 481499 211655.33 144765 274521 5195500 7637876 31.98
crit 20.34 45.30% 422934.96 171731 962999 423425.32 291621 601421 8603704 12648260 31.98
 
 

Action details: mongoose_bite

Static Values
  • id:190928
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.aspect_of_the_eagle.up&(charges>=2|charges>=1&cooldown.mongoose_bite.remains<=2)|(buff.mongoose_fury.up|cooldown.fury_of_the_eagle.remains<5|charges=3)
Spelldata
  • id:190928
  • name:Mongoose Bite
  • school:physical
  • tooltip:
  • description:Attempts to sever the target's limbs with a brutal attack that deals $sw1 Physical damage and grants you Mongoose Fury. Mongoose Fury increases Mongoose Bite damage by $?a134735[{$190931s2=35}][{$190931s1=50}]% for {$190931d=14 seconds}, stacking up to {$190931u=6} times. Successive attacks do not increase duration.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
On the Trail 8158 2.4% 0.0 0.00sec 0 0 Periodic 300.3 8172 0 8172 0.0% 99.8%

Stats details: on_the_trail

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 300.27 300.27 0.0000 1.0000 2453855.49 2453855.49 0.00 8172.22 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 300.3 100.00% 8172.19 6996 10186 8172.09 7963 8343 2453855 2453855 0.00
 
 

Action details: on_the_trail

Static Values
  • id:204081
  • school:physical
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204081
  • name:On the Trail
  • school:physical
  • tooltip:Deals $m1 damage per $t sec. Melee attacks can extend this effect by 6 sec per melee attack.
  • description:{$@spelldesc203757=Harpoon applies On the Trail, a unique damage over time effect that deals ${$204081m1*12} damage over {$204081d=12 seconds} and your melee autoattacks extend its duration by 6 sec.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.220000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Potion of the Old War 16166 4.8% 23.3 3.78sec 204925 0 Direct 23.3 140879 282007 204922 45.4%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.33 23.33 0.00 0.00 0.0000 0.0000 4780525.84 7027825.82 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.74 54.62% 140879.25 130152 169198 140879.79 130152 162690 1795040 2638879 31.98
crit 10.59 45.38% 282006.65 260305 338396 281994.45 260305 338396 2985486 4388947 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Raptor Strike 28473 8.5% 49.3 6.12sec 173622 143269 Direct 49.3 119611 239184 173622 45.2%  

Stats details: raptor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.31 49.31 0.00 0.00 1.2119 0.0000 8561441.49 12586129.95 31.98 143268.54 143268.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.04 54.83% 119610.73 107722 151016 119574.93 112166 128879 3233963 4754232 31.98
crit 22.27 45.17% 239184.32 215445 302031 239128.73 223325 260910 5327478 7831898 31.98
 
 

Action details: raptor_strike

Static Values
  • id:186270
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.serpent_sting.enabled&active_enemies<=2&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)|talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains<gcd.max|buff.moknathal_tactics.down)
Spelldata
  • id:186270
  • name:Raptor Strike
  • school:physical
  • tooltip:
  • description:A vicious slash dealing $sw1 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
pet - cat 37266 / 37266
Claw 11616 3.5% 100.8 3.00sec 34661 34506 Direct 100.8 22317 44645 34661 55.3%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.75 100.75 0.00 0.00 1.0045 0.0000 3492206.55 5133874.42 31.98 34505.92 34505.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.05 44.72% 22317.23 11016 24675 22326.86 19888 24548 1005434 1478083 31.98
crit 55.70 55.28% 44644.94 22032 49351 44660.36 41661 47660 2486773 3655791 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
Flanking Strike 11792 3.5% 29.6 9.78sec 119719 0 Direct 29.6 71097 142216 119718 68.4%  

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.60 29.60 0.00 0.00 0.0000 0.0000 3543911.83 5209886.08 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.36 31.63% 71096.87 66593 72412 71100.61 0 72412 665746 978709 31.97
crit 20.24 68.37% 142215.79 133187 144824 142220.97 138002 144824 2878166 4231177 31.98
 
 

Action details: flanking_strike

Static Values
  • id:204740
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204740
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.152000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 13858 4.1% 237.2 1.26sec 17560 13881 Direct 237.2 11306 22610 17560 55.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 237.22 237.22 0.00 0.00 1.2650 0.0000 4165597.13 6123822.36 31.98 13880.65 13880.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.99 44.68% 11305.97 10300 11537 11305.81 11006 11511 1198303 1761620 31.98
crit 131.24 55.32% 22610.35 20601 23073 22609.54 22056 23003 2967294 4362203 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Hunter_SV_T19M
Aspect of the Eagle 6.6 49.05sec

Stats details: aspect_of_the_eagle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_eagle

Static Values
  • id:186289
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:48.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:186289
  • name:Aspect of the Eagle
  • school:physical
  • tooltip:Critical Strike chance on abilities increased by {$s1=0}%.
  • description:$?a231555[Grants you and your pet {$s1=0}% increased Critical Strike chance on all abilities, and your][Your] pet's attacks have a{$?s191334=false}[n additional][] {$s2=25}% chance to grant you a charge of Mongoose Bite. Lasts {$d=10 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_SV_T19M
  • harmful:false
  • if_expr:
 
Cleansed Drake's Breath 3.1 63.07sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_SV_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_SV_T19M
  • harmful:false
  • if_expr:
 
Harpoon 1.0 0.00sec

Stats details: harpoon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: harpoon

Static Values
  • id:190925
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190925
  • name:Harpoon
  • school:physical
  • tooltip:
  • description:Hurls a harpoon at an enemy, rooting them in place for {$190927d=3 seconds} and pulling you to them.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Snake Hunter 3.6 95.56sec

Stats details: snake_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: snake_hunter

Static Values
  • id:201078
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:action.mongoose_bite.charges<=1&buff.mongoose_fury.remains>gcd.max*4|action.mongoose_bite.charges=0&buff.aspect_of_the_eagle.up
Spelldata
  • id:201078
  • name:Snake Hunter
  • school:physical
  • tooltip:
  • description:Instantly grants you {$s1=3} charges of Mongoose Bite.
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Eagle 6.6 0.0 49.1sec 49.1sec 21.55% 24.58% 0.0(0.0) 6.4

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_aspect_of_the_eagle
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • aspect_of_the_eagle_1:21.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:186289
  • name:Aspect of the Eagle
  • tooltip:Critical Strike chance on abilities increased by {$s1=0}%.
  • description:$?a231555[Grants you and your pet {$s1=0}% increased Critical Strike chance on all abilities, and your][Your] pet's attacks have a{$?s191334=false}[n additional][] {$s2=25}% chance to grant you a charge of Mongoose Bite. Lasts {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Blood Frenzy 10.8 6.4 28.2sec 17.2sec 45.62% 45.62% 6.4(6.4) 10.3

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 11.26% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cleansed Ancient's Blessing 2.8 0.0 72.7sec 72.7sec 9.06% 9.06% 0.0(0.0) 2.7

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:9.06%

Trigger Attempt Success

  • trigger_pct:95.11%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 2.8 0.0 72.0sec 72.0sec 9.18% 9.18% 0.0(0.0) 2.7

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:9.18%

Trigger Attempt Success

  • trigger_pct:95.77%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 2.8 0.0 73.6sec 73.6sec 9.11% 9.11% 0.0(0.0) 2.7

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.11%

Trigger Attempt Success

  • trigger_pct:95.39%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of the Eagle 6.6 0.0 47.9sec 47.9sec 6.95% 6.95% 27.9(122.1) 6.5

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_fury_of_the_eagle
  • max_stacks:6
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fury_of_the_eagle_1:0.26%
  • fury_of_the_eagle_2:0.31%
  • fury_of_the_eagle_3:0.45%
  • fury_of_the_eagle_4:0.46%
  • fury_of_the_eagle_5:0.33%
  • fury_of_the_eagle_6:5.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203415
  • name:Fury of the Eagle
  • tooltip:
  • description:Furiously strikes all enemies in front of you, dealing ${{$203413s1=0}*9} Physical damage. Damage increased by Mongoose Fury.
  • max_stacks:0
  • duration:4.00
  • cooldown:45.00
  • default_chance:100.00%
Mark of the Claw 11.3 3.1 26.1sec 20.2sec 25.36% 25.36% 3.1(3.1) 11.1

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Mok'Nathal Tactics 6.1 43.2 49.8sec 6.1sec 97.82% 97.82% 27.6(27.6) 5.2

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_moknathal_tactics
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03

Stack Uptimes

  • moknathal_tactics_1:12.78%
  • moknathal_tactics_2:9.16%
  • moknathal_tactics_3:8.82%
  • moknathal_tactics_4:67.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201081
  • name:Mok'Nathal Tactics
  • tooltip:Attack Power increased by {$s1=3}%
  • description:$@spelldesc109306
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Mongoose Fury 9.8 35.1 32.0sec 6.6sec 55.08% 90.52% 2.8(2.8) 9.2

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_mongoose_fury
  • max_stacks:6
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50

Stack Uptimes

  • mongoose_fury_1:10.36%
  • mongoose_fury_2:9.17%
  • mongoose_fury_3:13.96%
  • mongoose_fury_4:9.26%
  • mongoose_fury_5:3.45%
  • mongoose_fury_6:8.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190931
  • name:Mongoose Fury
  • tooltip:Damage dealt by Mongoose Bite increased by {$s1=50}%.
  • description:{$@spelldesc190928=Attempts to sever the target's limbs with a brutal attack that deals $sw1 Physical damage and grants you Mongoose Fury. Mongoose Fury increases Mongoose Bite damage by $?a134735[{$190931s2=35}][{$190931s1=50}]% for {$190931d=14 seconds}, stacking up to {$190931u=6} times. Successive attacks do not increase duration.}
  • max_stacks:6
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 59.2sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:750.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_SV_T19M
flanking_strike Focus 29.6 1480.1 50.0 50.0 5321.3
lacerate Focus 25.2 882.9 35.0 35.0 15118.4
raptor_strike Focus 49.3 1232.8 25.0 25.0 6944.9
pet - cat
claw Focus 100.8 4651.6 46.2 46.2 750.8
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1002.04 3523.28 (100.00%) 3.52 234.55 6.24%
pet - cat
focus_regen Focus 566.80 4581.22 (100.00%) 8.08 112.00 2.39%
Resource RPS-Gain RPS-Loss
Focus 11.71 11.96
Combat End Resource Mean Min Max
Focus 47.39 0.03 120.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 84.7%
Uptimes %
Focus Cap 4.5%
cat-Focus Cap 0.4%

Procs

Count Interval
hunting_companion 4.0 53.3sec

Statistics & Data Analysis

Fight Length
Sample Data Hunter_SV_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Hunter_SV_T19M Damage Per Second
Count 7499
Mean 334332.65
Minimum 307440.70
Maximum 367514.79
Spread ( max - min ) 60074.09
Range [ ( max - min ) / 2 * 100% ] 8.98%
Standard Deviation 8034.7487
5th Percentile 321801.10
95th Percentile 348190.00
( 95th Percentile - 5th Percentile ) 26388.90
Mean Distribution
Standard Deviation 92.7835
95.00% Confidence Intervall ( 334150.80 - 334514.50 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2218
0.1 Scale Factor Error with Delta=300 551097
0.05 Scale Factor Error with Delta=300 2204389
0.01 Scale Factor Error with Delta=300 55109728
Priority Target DPS
Sample Data Hunter_SV_T19M Priority Target Damage Per Second
Count 7499
Mean 334332.65
Minimum 307440.70
Maximum 367514.79
Spread ( max - min ) 60074.09
Range [ ( max - min ) / 2 * 100% ] 8.98%
Standard Deviation 8034.7487
5th Percentile 321801.10
95th Percentile 348190.00
( 95th Percentile - 5th Percentile ) 26388.90
Mean Distribution
Standard Deviation 92.7835
95.00% Confidence Intervall ( 334150.80 - 334514.50 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2218
0.1 Scale Factor Error with Delta=300 551097
0.05 Scale Factor Error with Delta=300 2204389
0.01 Scale Factor Error with Delta=300 55109728
DPS(e)
Sample Data Hunter_SV_T19M Damage Per Second (Effective)
Count 7499
Mean 334332.65
Minimum 307440.70
Maximum 367514.79
Spread ( max - min ) 60074.09
Range [ ( max - min ) / 2 * 100% ] 8.98%
Damage
Sample Data Hunter_SV_T19M Damage
Count 7499
Mean 89206782.04
Minimum 65582193.52
Maximum 112821808.61
Spread ( max - min ) 47239615.09
Range [ ( max - min ) / 2 * 100% ] 26.48%
DTPS
Sample Data Hunter_SV_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hunter_SV_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hunter_SV_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hunter_SV_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hunter_SV_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hunter_SV_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hunter_SV_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hunter_SV_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet
3 0.00 snapshot_stats
4 0.00 potion,name=potion_of_the_old_war
5 0.00 augmentation,type=defiled
6 0.00 harpoon
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_attack
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
8 1.00 potion,name=old_war
0.00 steel_trap
9 24.80 explosive_trap
A 10.31 dragonsfire_grenade
0.00 caltrops
0.00 carve,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies>=3&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)
B 32.08 raptor_strike,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies<=2&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)|talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains<gcd.max|buff.moknathal_tactics.down)
C 6.59 aspect_of_the_eagle
D 6.58 fury_of_the_eagle,if=buff.mongoose_fury.up&(buff.mongoose_fury.stack=6|action.mongoose_bite.charges=0&cooldown.snake_hunter.remains|buff.mongoose_fury.remains<=gcd.max*2)
E 44.91 mongoose_bite,if=buff.aspect_of_the_eagle.up&(charges>=2|charges>=1&cooldown.mongoose_bite.remains<=2)|(buff.mongoose_fury.up|cooldown.fury_of_the_eagle.remains<5|charges=3)
0.00 a_murder_of_crows
F 25.23 lacerate,if=dot.lacerate.ticking&dot.lacerate.remains<=3|target.time_to_die>=5
G 3.55 snake_hunter,if=action.mongoose_bite.charges<=1&buff.mongoose_fury.remains>gcd.max*4|action.mongoose_bite.charges=0&buff.aspect_of_the_eagle.up
H 29.60 flanking_strike,if=talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains>=3)|!talent.way_of_the_moknathal.enabled
0.00 butchery,if=spell_targets.butchery>=2
0.00 carve,if=spell_targets.carve>=4
0.00 spitting_cobra
0.00 throwing_axes
I 17.23 raptor_strike,if=!talent.throwing_axes.enabled&focus>75-cooldown.flanking_strike.remains*focus.regen

Sample Sequence

01245679ABCEEEFGEEEBD9EIFHIIHE9FBHAIHIF9BHEEEFB9CHED8BFA9HIIHFB9HBFEEE9BHAFEBHC9GEEBEDFBE9HIIFHAB9HBF9BHEEEBFCH9DABEFH9IHIF9BHFBEE9AEBFGEEEICD9FBEHIIHI9EFABH9BFHBH9EBEEDAB9CFEHIIIHF9BHBF9BAHEBE9EFGEBEDE9BCEFHEI

Sample Sequence Table

time name target resources buffs
Pre flask Hunter_SV_T19M 120.0/120: 100% focus
Pre food Hunter_SV_T19M 120.0/120: 100% focus
Pre summon_pet Fluffy_Pillow 120.0/120: 100% focus
Pre potion Fluffy_Pillow 120.0/120: 100% focus potion_of_the_old_war
Pre augmentation Hunter_SV_T19M 120.0/120: 100% focus potion_of_the_old_war
0:00.000 harpoon Fluffy_Pillow 120.0/120: 100% focus mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 120.0/120: 100% focus mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:00.000 explosive_trap Fluffy_Pillow 120.0/120: 100% focus bloodlust, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:00.756 dragonsfire_grenade Fluffy_Pillow 120.0/120: 100% focus bloodlust, cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:01.511 raptor_strike Fluffy_Pillow 120.0/120: 100% focus bloodlust, cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:02.431 aspect_of_the_eagle Fluffy_Pillow 110.0/120: 92% focus bloodlust, moknathal_tactics, cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:02.431 mongoose_bite Fluffy_Pillow 110.0/120: 92% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:03.351 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury, cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:04.273 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(2), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:05.193 lacerate Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:06.113 snake_hunter Fluffy_Pillow 100.0/120: 83% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
0:06.113 mongoose_bite Fluffy_Pillow 100.0/120: 83% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
0:07.047 mongoose_bite Fluffy_Pillow 115.1/120: 96% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(4), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
0:07.981 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(5), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
0:08.915 raptor_strike Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(6), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
0:09.847 fury_of_the_eagle Fluffy_Pillow 110.0/120: 92% focus bloodlust, aspect_of_the_eagle, moknathal_tactics(2), mongoose_fury(6), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
0:12.570 explosive_trap Fluffy_Pillow 120.0/120: 100% focus bloodlust, moknathal_tactics(2), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:13.323 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, moknathal_tactics(2), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:14.483 raptor_strike Fluffy_Pillow 120.0/120: 100% focus bloodlust, moknathal_tactics(2), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:15.416 lacerate Fluffy_Pillow 110.1/120: 92% focus bloodlust, moknathal_tactics(3), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:16.349 flanking_strike Fluffy_Pillow 90.7/120: 76% focus bloodlust, moknathal_tactics(3), mongoose_fury(6), cleansed_sisters_blessing, potion_of_the_old_war
0:17.286 raptor_strike Fluffy_Pillow 55.8/120: 46% focus bloodlust, moknathal_tactics(3), mongoose_fury(6), cleansed_sisters_blessing, potion_of_the_old_war
0:18.224 raptor_strike Fluffy_Pillow 45.8/120: 38% focus bloodlust, moknathal_tactics(4), mongoose_fury(6), cleansed_sisters_blessing, potion_of_the_old_war
0:19.161 Waiting 0.900 sec 35.9/120: 30% focus bloodlust, moknathal_tactics(4), mongoose_fury(6), cleansed_sisters_blessing, potion_of_the_old_war
0:20.061 flanking_strike Fluffy_Pillow 50.4/120: 42% focus bloodlust, moknathal_tactics(4), mongoose_fury(6), cleansed_sisters_blessing, potion_of_the_old_war
0:21.022 mongoose_bite Fluffy_Pillow 15.8/120: 13% focus bloodlust, moknathal_tactics(4), mongoose_fury(6), cleansed_sisters_blessing, potion_of_the_old_war
0:21.960 Waiting 2.400 sec 32.0/120: 27% focus bloodlust, moknathal_tactics(4), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:24.360 explosive_trap Fluffy_Pillow 73.5/120: 61% focus bloodlust, moknathal_tactics(4), cleansed_sisters_blessing, blood_frenzy
0:25.324 lacerate Fluffy_Pillow 90.2/120: 75% focus bloodlust, moknathal_tactics(4), cleansed_sisters_blessing, blood_frenzy
0:26.288 raptor_strike Fluffy_Pillow 71.0/120: 59% focus bloodlust, blood_frenzy
0:27.224 flanking_strike Fluffy_Pillow 61.1/120: 51% focus bloodlust, moknathal_tactics, blood_frenzy
0:28.158 Waiting 2.400 sec 26.2/120: 22% focus bloodlust, moknathal_tactics, blood_frenzy
0:30.558 dragonsfire_grenade Fluffy_Pillow 64.9/120: 54% focus bloodlust, moknathal_tactics, blood_frenzy
0:31.551 raptor_strike Fluffy_Pillow 80.3/120: 67% focus bloodlust, moknathal_tactics
0:32.562 flanking_strike Fluffy_Pillow 70.4/120: 59% focus bloodlust, moknathal_tactics(2)
0:33.572 raptor_strike Fluffy_Pillow 35.4/120: 30% focus bloodlust, moknathal_tactics(2)
0:34.583 Waiting 0.700 sec 25.5/120: 21% focus bloodlust, moknathal_tactics(3)
0:35.283 lacerate Fluffy_Pillow 35.9/120: 30% focus bloodlust, moknathal_tactics(3)
0:36.426 explosive_trap Fluffy_Pillow 18.0/120: 15% focus bloodlust, moknathal_tactics(3), cleansed_wisps_blessing
0:37.325 Waiting 3.000 sec 31.4/120: 26% focus bloodlust, moknathal_tactics(3), cleansed_wisps_blessing
0:40.325 raptor_strike Fluffy_Pillow 75.1/120: 63% focus moknathal_tactics(3), cleansed_wisps_blessing, mark_of_the_claw
0:41.619 flanking_strike Fluffy_Pillow 65.1/120: 54% focus moknathal_tactics(4), cleansed_wisps_blessing, mark_of_the_claw
0:42.912 mongoose_bite Fluffy_Pillow 30.2/120: 25% focus moknathal_tactics(4), cleansed_wisps_blessing, mark_of_the_claw
0:44.205 mongoose_bite Fluffy_Pillow 45.2/120: 38% focus moknathal_tactics(4), mongoose_fury, cleansed_wisps_blessing, mark_of_the_claw
0:45.497 mongoose_bite Fluffy_Pillow 60.1/120: 50% focus moknathal_tactics(4), mongoose_fury(2), cleansed_wisps_blessing
0:46.808 lacerate Fluffy_Pillow 75.2/120: 63% focus moknathal_tactics(4), mongoose_fury(3)
0:48.121 raptor_strike Fluffy_Pillow 55.2/120: 46% focus moknathal_tactics(4), mongoose_fury(3)
0:49.433 explosive_trap Fluffy_Pillow 46.4/120: 39% focus moknathal_tactics(4), mongoose_fury(3), cleansed_sisters_blessing
0:50.421 aspect_of_the_eagle Fluffy_Pillow 58.6/120: 49% focus moknathal_tactics(4), mongoose_fury(3), cleansed_sisters_blessing
0:50.431 flanking_strike Fluffy_Pillow 58.7/120: 49% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_sisters_blessing
0:51.650 Waiting 1.000 sec 23.8/120: 20% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_sisters_blessing
0:52.650 mongoose_bite Fluffy_Pillow 36.1/120: 30% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_sisters_blessing
0:54.076 Waiting 0.600 sec 53.8/120: 45% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_sisters_blessing
0:54.676 fury_of_the_eagle Fluffy_Pillow 61.2/120: 51% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_sisters_blessing
0:58.264 potion Fluffy_Pillow 105.4/120: 88% focus aspect_of_the_eagle, mongoose_fury(4)
0:58.264 raptor_strike Fluffy_Pillow 105.4/120: 88% focus aspect_of_the_eagle, mongoose_fury(4), potion_of_the_old_war
0:59.576 lacerate Fluffy_Pillow 95.5/120: 80% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(4), potion_of_the_old_war
1:00.889 dragonsfire_grenade Fluffy_Pillow 75.5/120: 63% focus moknathal_tactics, mongoose_fury(4), potion_of_the_old_war
1:02.002 explosive_trap Fluffy_Pillow 88.6/120: 74% focus moknathal_tactics, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
1:02.979 flanking_strike Fluffy_Pillow 100.7/120: 84% focus moknathal_tactics, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
1:04.192 raptor_strike Fluffy_Pillow 65.8/120: 55% focus moknathal_tactics, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
1:05.404 raptor_strike Fluffy_Pillow 56.0/120: 47% focus moknathal_tactics(2), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
1:06.600 Waiting 1.000 sec 46.0/120: 38% focus moknathal_tactics(3), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
1:07.600 flanking_strike Fluffy_Pillow 58.6/120: 49% focus moknathal_tactics(3), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
1:08.964 Waiting 0.800 sec 25.8/120: 21% focus moknathal_tactics(3), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
1:09.764 lacerate Fluffy_Pillow 35.9/120: 30% focus moknathal_tactics(3), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
1:10.960 Waiting 1.200 sec 15.8/120: 13% focus moknathal_tactics(3), cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
1:12.160 raptor_strike Fluffy_Pillow 30.2/120: 25% focus moknathal_tactics(3), potion_of_the_old_war
1:13.469 Waiting 0.300 sec 20.3/120: 17% focus moknathal_tactics(4), potion_of_the_old_war
1:13.769 explosive_trap Fluffy_Pillow 23.7/120: 20% focus moknathal_tactics(4), potion_of_the_old_war
1:15.146 Waiting 1.000 sec 39.5/120: 33% focus moknathal_tactics(4), potion_of_the_old_war
1:16.146 flanking_strike Fluffy_Pillow 51.0/120: 42% focus moknathal_tactics(4), potion_of_the_old_war
1:17.458 Waiting 1.400 sec 16.0/120: 13% focus moknathal_tactics(4), potion_of_the_old_war
1:18.858 raptor_strike Fluffy_Pillow 32.1/120: 27% focus moknathal_tactics(4), potion_of_the_old_war
1:20.170 Waiting 1.200 sec 22.1/120: 18% focus moknathal_tactics(4), potion_of_the_old_war
1:21.370 lacerate Fluffy_Pillow 35.9/120: 30% focus moknathal_tactics(4), potion_of_the_old_war
1:22.681 mongoose_bite Fluffy_Pillow 15.9/120: 13% focus moknathal_tactics(4), potion_of_the_old_war
1:23.991 mongoose_bite Fluffy_Pillow 30.9/120: 26% focus moknathal_tactics(4), mongoose_fury
1:25.303 mongoose_bite Fluffy_Pillow 46.0/120: 38% focus moknathal_tactics(4), mongoose_fury(2)
1:26.613 explosive_trap Fluffy_Pillow 61.0/120: 51% focus moknathal_tactics(4), mongoose_fury(3)
1:27.756 raptor_strike Fluffy_Pillow 74.1/120: 62% focus mongoose_fury(3)
1:29.067 flanking_strike Fluffy_Pillow 64.2/120: 53% focus moknathal_tactics, mongoose_fury(3)
1:30.379 Waiting 0.300 sec 29.2/120: 24% focus moknathal_tactics, mongoose_fury(3)
1:30.679 dragonsfire_grenade Fluffy_Pillow 32.6/120: 27% focus moknathal_tactics, mongoose_fury(3)
1:32.032 lacerate Fluffy_Pillow 48.2/120: 40% focus moknathal_tactics, mongoose_fury(3)
1:33.342 mongoose_bite Fluffy_Pillow 29.4/120: 25% focus moknathal_tactics, mongoose_fury(3), blood_frenzy
1:34.554 raptor_strike Fluffy_Pillow 44.5/120: 37% focus moknathal_tactics, mongoose_fury(4), blood_frenzy
1:35.766 Waiting 1.300 sec 34.5/120: 29% focus moknathal_tactics(2), mongoose_fury(4), blood_frenzy
1:37.066 flanking_strike Fluffy_Pillow 50.7/120: 42% focus moknathal_tactics(2), mark_of_the_claw, blood_frenzy
1:38.261 aspect_of_the_eagle Fluffy_Pillow 15.7/120: 13% focus moknathal_tactics(2), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy
1:38.431 explosive_trap Fluffy_Pillow 17.9/120: 15% focus aspect_of_the_eagle, moknathal_tactics(2), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy
1:39.566 snake_hunter Fluffy_Pillow 32.1/120: 27% focus aspect_of_the_eagle, moknathal_tactics(2), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy
1:39.566 mongoose_bite Fluffy_Pillow 32.1/120: 27% focus aspect_of_the_eagle, moknathal_tactics(2), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy
1:40.762 mongoose_bite Fluffy_Pillow 47.2/120: 39% focus aspect_of_the_eagle, moknathal_tactics(2), mongoose_fury, cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy
1:41.959 raptor_strike Fluffy_Pillow 62.3/120: 52% focus aspect_of_the_eagle, moknathal_tactics(2), mongoose_fury(2), cleansed_ancients_blessing, mark_of_the_claw, blood_frenzy
1:43.155 mongoose_bite Fluffy_Pillow 52.3/120: 44% focus aspect_of_the_eagle, moknathal_tactics(3), mongoose_fury(2), cleansed_ancients_blessing, blood_frenzy
1:44.368 fury_of_the_eagle Fluffy_Pillow 67.3/120: 56% focus aspect_of_the_eagle, moknathal_tactics(3), mongoose_fury(3), cleansed_ancients_blessing, blood_frenzy
1:47.919 lacerate Fluffy_Pillow 111.4/120: 93% focus aspect_of_the_eagle, moknathal_tactics(3), mongoose_fury(3), blood_frenzy
1:49.132 raptor_strike Fluffy_Pillow 91.5/120: 76% focus moknathal_tactics(3), mongoose_fury(3), blood_frenzy
1:50.345 mongoose_bite Fluffy_Pillow 81.5/120: 68% focus moknathal_tactics(4), mongoose_fury(3), blood_frenzy
1:51.556 explosive_trap Fluffy_Pillow 95.8/120: 80% focus moknathal_tactics(4), mongoose_fury(4)
1:52.700 flanking_strike Fluffy_Pillow 108.9/120: 91% focus moknathal_tactics(4), mongoose_fury(4)
1:54.010 raptor_strike Fluffy_Pillow 73.9/120: 62% focus moknathal_tactics(4), mongoose_fury(4)
1:55.322 raptor_strike Fluffy_Pillow 64.0/120: 53% focus moknathal_tactics(4), mongoose_fury(4)
1:56.633 Waiting 1.100 sec 54.0/120: 45% focus moknathal_tactics(4), mongoose_fury(4)
1:57.733 lacerate Fluffy_Pillow 66.6/120: 56% focus moknathal_tactics(4), mongoose_fury(4)
1:59.231 Waiting 0.200 sec 48.8/120: 41% focus moknathal_tactics(4)
1:59.431 flanking_strike Fluffy_Pillow 51.1/120: 43% focus moknathal_tactics(4)
2:00.744 dragonsfire_grenade Fluffy_Pillow 16.2/120: 13% focus moknathal_tactics(4)
2:02.032 raptor_strike Fluffy_Pillow 30.9/120: 26% focus moknathal_tactics(4)
2:03.344 explosive_trap Fluffy_Pillow 21.0/120: 17% focus moknathal_tactics(4)
2:04.698 Waiting 1.200 sec 36.5/120: 30% focus moknathal_tactics(4)
2:05.898 flanking_strike Fluffy_Pillow 50.3/120: 42% focus moknathal_tactics(4)
2:07.211 Waiting 1.600 sec 15.3/120: 13% focus moknathal_tactics(4)
2:08.811 raptor_strike Fluffy_Pillow 33.7/120: 28% focus moknathal_tactics(4)
2:10.121 Waiting 1.000 sec 23.8/120: 20% focus moknathal_tactics(4), mark_of_the_claw
2:11.121 lacerate Fluffy_Pillow 35.4/120: 30% focus moknathal_tactics(4), mark_of_the_claw
2:12.413 Waiting 2.900 sec 16.7/120: 14% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
2:15.313 explosive_trap Fluffy_Pillow 53.2/120: 44% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
2:16.533 raptor_strike Fluffy_Pillow 68.4/120: 57% focus moknathal_tactics(4), blood_frenzy
2:17.743 flanking_strike Fluffy_Pillow 58.4/120: 49% focus moknathal_tactics(4), blood_frenzy
2:18.956 Waiting 1.400 sec 23.5/120: 20% focus moknathal_tactics(4), blood_frenzy
2:20.356 mongoose_bite Fluffy_Pillow 40.8/120: 34% focus moknathal_tactics(4), blood_frenzy
2:21.568 mongoose_bite Fluffy_Pillow 55.9/120: 47% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
2:22.781 mongoose_bite Fluffy_Pillow 70.9/120: 59% focus moknathal_tactics(4), mongoose_fury(2), blood_frenzy
2:23.994 raptor_strike Fluffy_Pillow 86.0/120: 72% focus moknathal_tactics(4), mongoose_fury(3), blood_frenzy
2:25.208 lacerate Fluffy_Pillow 75.0/120: 63% focus moknathal_tactics(4), mongoose_fury(3)
2:26.521 aspect_of_the_eagle Fluffy_Pillow 55.1/120: 46% focus moknathal_tactics(4), mongoose_fury(3)
2:26.521 flanking_strike Fluffy_Pillow 55.1/120: 46% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3)
2:27.832 explosive_trap Fluffy_Pillow 20.1/120: 17% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3)
2:28.973 Waiting 0.200 sec 33.2/120: 28% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3)
2:29.173 fury_of_the_eagle Fluffy_Pillow 35.5/120: 30% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3)
2:33.270 dragonsfire_grenade Fluffy_Pillow 82.5/120: 69% focus aspect_of_the_eagle, mongoose_fury(3)
2:34.413 raptor_strike Fluffy_Pillow 95.6/120: 80% focus aspect_of_the_eagle, mongoose_fury(3)
2:35.727 mongoose_bite Fluffy_Pillow 85.7/120: 71% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3)
2:37.039 lacerate Fluffy_Pillow 100.9/120: 84% focus moknathal_tactics, mongoose_fury(4), mark_of_the_claw
2:38.332 flanking_strike Fluffy_Pillow 81.0/120: 67% focus moknathal_tactics, mongoose_fury(4), mark_of_the_claw
2:39.624 explosive_trap Fluffy_Pillow 46.0/120: 38% focus moknathal_tactics, mark_of_the_claw
2:40.943 raptor_strike Fluffy_Pillow 61.4/120: 51% focus moknathal_tactics, mark_of_the_claw
2:42.236 Waiting 1.100 sec 51.3/120: 43% focus moknathal_tactics(2)
2:43.336 flanking_strike Fluffy_Pillow 63.9/120: 53% focus moknathal_tactics(2)
2:44.821 raptor_strike Fluffy_Pillow 32.2/120: 27% focus moknathal_tactics(2), blood_frenzy
2:46.034 Waiting 1.100 sec 22.3/120: 19% focus moknathal_tactics(3), blood_frenzy
2:47.134 lacerate Fluffy_Pillow 35.9/120: 30% focus moknathal_tactics(3), blood_frenzy
2:48.345 Waiting 3.300 sec 16.0/120: 13% focus moknathal_tactics(3), blood_frenzy
2:51.645 explosive_trap Fluffy_Pillow 56.9/120: 47% focus moknathal_tactics(3), blood_frenzy
2:52.809 raptor_strike Fluffy_Pillow 71.4/120: 59% focus moknathal_tactics(3), blood_frenzy
2:54.022 flanking_strike Fluffy_Pillow 61.0/120: 51% focus moknathal_tactics(4)
2:55.336 Waiting 1.600 sec 26.0/120: 22% focus moknathal_tactics(4)
2:56.936 lacerate Fluffy_Pillow 44.4/120: 37% focus moknathal_tactics(4)
2:58.444 Waiting 1.100 sec 26.7/120: 22% focus moknathal_tactics(4)
2:59.544 raptor_strike Fluffy_Pillow 39.3/120: 33% focus moknathal_tactics(4), cleansed_wisps_blessing
3:00.855 Waiting 0.700 sec 29.3/120: 24% focus moknathal_tactics(4), cleansed_wisps_blessing
3:01.555 mongoose_bite Fluffy_Pillow 37.4/120: 31% focus moknathal_tactics(4), cleansed_wisps_blessing
3:02.867 mongoose_bite Fluffy_Pillow 52.6/120: 44% focus moknathal_tactics(4), mongoose_fury, cleansed_wisps_blessing, mark_of_the_claw
3:04.158 explosive_trap Fluffy_Pillow 68.8/120: 57% focus moknathal_tactics(4), mongoose_fury(2), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy
3:05.110 dragonsfire_grenade Fluffy_Pillow 80.8/120: 67% focus moknathal_tactics(4), mongoose_fury(2), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy
3:06.062 mongoose_bite Fluffy_Pillow 92.8/120: 77% focus moknathal_tactics(4), mongoose_fury(2), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy
3:07.259 raptor_strike Fluffy_Pillow 107.8/120: 90% focus moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy
3:08.456 lacerate Fluffy_Pillow 97.8/120: 81% focus moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, blood_frenzy
3:09.669 snake_hunter Fluffy_Pillow 77.9/120: 65% focus moknathal_tactics(4), mongoose_fury(3), blood_frenzy
3:09.669 mongoose_bite Fluffy_Pillow 77.9/120: 65% focus moknathal_tactics(4), mongoose_fury(3), blood_frenzy
3:10.883 mongoose_bite Fluffy_Pillow 92.9/120: 77% focus moknathal_tactics(4), mongoose_fury(4), blood_frenzy
3:12.095 mongoose_bite Fluffy_Pillow 108.0/120: 90% focus moknathal_tactics(4), mongoose_fury(5), blood_frenzy
3:13.306 raptor_strike Fluffy_Pillow 120.0/120: 100% focus moknathal_tactics(4), mongoose_fury(6)
3:14.617 aspect_of_the_eagle Fluffy_Pillow 110.0/120: 92% focus moknathal_tactics(4), mongoose_fury(6)
3:14.617 fury_of_the_eagle Fluffy_Pillow 110.0/120: 92% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6)
3:18.328 explosive_trap Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6)
3:19.471 lacerate Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6)
3:20.780 raptor_strike Fluffy_Pillow 100.0/120: 83% focus aspect_of_the_eagle, moknathal_tactics(4)
3:22.092 mongoose_bite Fluffy_Pillow 90.1/120: 75% focus aspect_of_the_eagle, moknathal_tactics(4)
3:23.405 flanking_strike Fluffy_Pillow 105.1/120: 88% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury
3:24.716 raptor_strike Fluffy_Pillow 70.2/120: 58% focus moknathal_tactics(4), mongoose_fury
3:26.028 raptor_strike Fluffy_Pillow 60.2/120: 50% focus moknathal_tactics(4), mongoose_fury
3:27.339 Waiting 1.100 sec 50.2/120: 42% focus moknathal_tactics(4), mongoose_fury
3:28.439 flanking_strike Fluffy_Pillow 62.9/120: 52% focus moknathal_tactics(4), mongoose_fury
3:29.947 raptor_strike Fluffy_Pillow 30.2/120: 25% focus moknathal_tactics(4), mongoose_fury
3:31.260 explosive_trap Fluffy_Pillow 20.2/120: 17% focus moknathal_tactics(4), mongoose_fury, mark_of_the_claw
3:32.370 mongoose_bite Fluffy_Pillow 33.1/120: 28% focus moknathal_tactics(4), mongoose_fury, mark_of_the_claw
3:33.663 lacerate Fluffy_Pillow 48.2/120: 40% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw
3:34.955 dragonsfire_grenade Fluffy_Pillow 28.2/120: 24% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw
3:36.221 Waiting 0.500 sec 43.0/120: 36% focus moknathal_tactics(4), mark_of_the_claw
3:36.721 raptor_strike Fluffy_Pillow 48.8/120: 41% focus moknathal_tactics(4), mark_of_the_claw
3:38.014 Waiting 1.000 sec 38.7/120: 32% focus moknathal_tactics(4)
3:39.014 flanking_strike Fluffy_Pillow 50.2/120: 42% focus moknathal_tactics(4)
3:40.327 Waiting 2.700 sec 16.6/120: 14% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
3:43.027 explosive_trap Fluffy_Pillow 50.6/120: 42% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
3:44.213 raptor_strike Fluffy_Pillow 65.5/120: 55% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
3:45.411 lacerate Fluffy_Pillow 55.6/120: 46% focus moknathal_tactics(4), blood_frenzy
3:46.623 Waiting 1.200 sec 35.6/120: 30% focus moknathal_tactics(4), blood_frenzy
3:47.823 flanking_strike Fluffy_Pillow 50.5/120: 42% focus moknathal_tactics(4), blood_frenzy
3:49.035 Waiting 1.900 sec 15.6/120: 13% focus moknathal_tactics(4), blood_frenzy
3:50.935 raptor_strike Fluffy_Pillow 37.5/120: 31% focus moknathal_tactics(4)
3:52.247 Waiting 2.000 sec 27.5/120: 23% focus moknathal_tactics(4)
3:54.247 flanking_strike Fluffy_Pillow 50.5/120: 42% focus moknathal_tactics(4)
3:55.558 explosive_trap Fluffy_Pillow 15.5/120: 13% focus moknathal_tactics(4)
3:56.702 mongoose_bite Fluffy_Pillow 28.6/120: 24% focus moknathal_tactics(4)
3:58.012 raptor_strike Fluffy_Pillow 43.7/120: 36% focus moknathal_tactics(4), mongoose_fury
3:59.321 mongoose_bite Fluffy_Pillow 33.7/120: 28% focus moknathal_tactics(4), mongoose_fury
4:00.633 mongoose_bite Fluffy_Pillow 48.7/120: 41% focus moknathal_tactics(4), mongoose_fury(2)
4:01.946 fury_of_the_eagle Fluffy_Pillow 63.8/120: 53% focus moknathal_tactics(4), mongoose_fury(3)
4:05.739 dragonsfire_grenade Fluffy_Pillow 109.5/120: 91% focus moknathal_tactics(4), mongoose_fury(3), blood_frenzy
4:06.688 raptor_strike Fluffy_Pillow 120.0/120: 100% focus mongoose_fury(3), cleansed_sisters_blessing, blood_frenzy
4:07.820 explosive_trap Fluffy_Pillow 110.1/120: 92% focus moknathal_tactics, mongoose_fury(3), cleansed_sisters_blessing, blood_frenzy
4:08.672 aspect_of_the_eagle Fluffy_Pillow 120.0/120: 100% focus moknathal_tactics, mongoose_fury(3), cleansed_sisters_blessing, blood_frenzy
4:08.672 lacerate Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), cleansed_sisters_blessing, blood_frenzy
4:09.803 mongoose_bite Fluffy_Pillow 100.0/120: 83% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), cleansed_sisters_blessing, blood_frenzy
4:10.933 flanking_strike Fluffy_Pillow 115.1/120: 96% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(4), cleansed_sisters_blessing, blood_frenzy
4:12.064 raptor_strike Fluffy_Pillow 80.1/120: 67% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(4), cleansed_sisters_blessing, blood_frenzy
4:13.196 raptor_strike Fluffy_Pillow 70.2/120: 58% focus aspect_of_the_eagle, moknathal_tactics(2), mongoose_fury(4), cleansed_sisters_blessing, blood_frenzy
4:14.326 raptor_strike Fluffy_Pillow 59.3/120: 49% focus aspect_of_the_eagle, moknathal_tactics(3), mongoose_fury(4), cleansed_sisters_blessing
4:15.545 Waiting 0.100 sec 49.3/120: 41% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_sisters_blessing
4:15.645 flanking_strike Fluffy_Pillow 50.6/120: 42% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_sisters_blessing
4:16.863 Waiting 1.800 sec 15.1/120: 13% focus aspect_of_the_eagle, moknathal_tactics(4)
4:18.663 lacerate Fluffy_Pillow 35.8/120: 30% focus aspect_of_the_eagle, moknathal_tactics(4)
4:19.983 explosive_trap Fluffy_Pillow 15.9/120: 13% focus moknathal_tactics(4)
4:21.126 raptor_strike Fluffy_Pillow 29.0/120: 24% focus moknathal_tactics(4)
4:22.436 Waiting 2.700 sec 19.0/120: 16% focus moknathal_tactics(4)
4:25.136 flanking_strike Fluffy_Pillow 50.0/120: 42% focus moknathal_tactics(4)
4:26.449 Waiting 1.400 sec 15.1/120: 13% focus moknathal_tactics(4)
4:27.849 raptor_strike Fluffy_Pillow 31.1/120: 26% focus moknathal_tactics(4)
4:29.161 Waiting 1.200 sec 21.3/120: 18% focus moknathal_tactics(4), mark_of_the_claw
4:30.361 lacerate Fluffy_Pillow 35.2/120: 29% focus moknathal_tactics(4), mark_of_the_claw
4:31.653 Waiting 0.100 sec 15.3/120: 13% focus moknathal_tactics(4), mark_of_the_claw
4:31.753 explosive_trap Fluffy_Pillow 16.4/120: 14% focus moknathal_tactics(4), mark_of_the_claw
4:33.096 Waiting 1.500 sec 32.0/120: 27% focus moknathal_tactics(4), mark_of_the_claw
4:34.596 raptor_strike Fluffy_Pillow 49.5/120: 41% focus moknathal_tactics(4), cleansed_ancients_blessing, mark_of_the_claw
4:35.888 dragonsfire_grenade Fluffy_Pillow 39.3/120: 33% focus moknathal_tactics(4), cleansed_ancients_blessing
4:37.014 flanking_strike Fluffy_Pillow 52.4/120: 44% focus moknathal_tactics(4), cleansed_ancients_blessing, mark_of_the_claw
4:38.304 Waiting 1.800 sec 17.5/120: 15% focus moknathal_tactics(4), cleansed_ancients_blessing, mark_of_the_claw
4:40.104 mongoose_bite Fluffy_Pillow 38.4/120: 32% focus moknathal_tactics(4), cleansed_ancients_blessing, mark_of_the_claw
4:41.397 raptor_strike Fluffy_Pillow 53.5/120: 45% focus moknathal_tactics(4), mongoose_fury, cleansed_ancients_blessing, mark_of_the_claw
4:42.689 mongoose_bite Fluffy_Pillow 43.4/120: 36% focus moknathal_tactics(4), mongoose_fury, cleansed_ancients_blessing
4:43.998 explosive_trap Fluffy_Pillow 58.4/120: 49% focus moknathal_tactics(4), mongoose_fury(2)
4:45.140 mongoose_bite Fluffy_Pillow 71.5/120: 60% focus moknathal_tactics(4), mongoose_fury(2)
4:46.450 lacerate Fluffy_Pillow 86.5/120: 72% focus moknathal_tactics(4), mongoose_fury(3)
4:47.761 snake_hunter Fluffy_Pillow 66.5/120: 55% focus moknathal_tactics(4), mongoose_fury(3)
4:47.761 mongoose_bite Fluffy_Pillow 66.5/120: 55% focus moknathal_tactics(4), mongoose_fury(3)
4:49.071 raptor_strike Fluffy_Pillow 81.6/120: 68% focus moknathal_tactics(4), mongoose_fury(4)
4:50.382 mongoose_bite Fluffy_Pillow 71.6/120: 60% focus moknathal_tactics(4), mongoose_fury(4)
4:51.695 fury_of_the_eagle Fluffy_Pillow 86.6/120: 72% focus moknathal_tactics(4), mongoose_fury(5)
4:55.385 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus moknathal_tactics(4), mongoose_fury(5), blood_frenzy
4:56.597 explosive_trap Fluffy_Pillow 120.0/120: 100% focus moknathal_tactics(4), mongoose_fury(6), mark_of_the_claw, blood_frenzy
4:57.549 raptor_strike Fluffy_Pillow 120.0/120: 100% focus mongoose_fury(6), mark_of_the_claw, blood_frenzy
4:58.744 aspect_of_the_eagle Fluffy_Pillow 110.0/120: 92% focus moknathal_tactics, mongoose_fury(6), mark_of_the_claw, blood_frenzy
4:58.744 mongoose_bite Fluffy_Pillow 110.0/120: 92% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(6), mark_of_the_claw, blood_frenzy
4:59.939 lacerate Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, moknathal_tactics, mark_of_the_claw, blood_frenzy
5:01.135 flanking_strike Fluffy_Pillow 100.0/120: 83% focus aspect_of_the_eagle, moknathal_tactics, mark_of_the_claw, blood_frenzy
5:02.332 mongoose_bite Fluffy_Pillow 64.5/120: 54% focus aspect_of_the_eagle, moknathal_tactics
5:03.644 raptor_strike Fluffy_Pillow 79.6/120: 66% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6231 6231 0
Agility 27896 26531 16240 (11258)
Stamina 41883 41883 25958
Intellect 6005 6005 0
Spirit 2 2 0
Health 2512980 2512980 0
Focus 120 120 0
Crit 44.15% 44.15% 10204
Haste 14.69% 14.69% 4775
Damage / Heal Versatility 4.28% 4.28% 1710
Attack Power 27896 26531 0
Mastery 9.25% 8.18% 2923
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_claw
Local Shoulders Matted Fur Pauldrons
ilevel: 880, stats: { 341 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist Laughing Sister's Pouch-Chain
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 AgiInt, +783 Crit, +312 Haste }
Local Legs Disjointed Linkage Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +886 Haste, +574 Crit }
Local Feet Malignant Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +783 Crit, +312 Haste }
Local Wrists Call of the Wild
ilevel: 880, stats: { 199 Armor, +1448 Sta, +965 Agi, +469 Crit, +352 Haste }
Local Hands Gauntlets of Malevolent Intent
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +665 Haste, +430 Vers }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Agi }
Local Main Hand Talonclaw
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Agi, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Animal Instincts (Survival Hunter) Throwing Axes (Survival Hunter) Way of the Mok'Nathal (Survival Hunter)
30 A Murder of Crows (Survival Hunter) Mortal Wounds (Survival Hunter) Snake Hunter (Survival Hunter)
45 Posthaste Farstrider Trailblazer
60 Caltrops (Survival Hunter) Improved Traps (Survival Hunter) Steel Trap (Survival Hunter)
75 Sticky Bomb (Survival Hunter) Ranger's Net (Survival Hunter) Camouflage (Survival Hunter)
90 Butchery (Survival Hunter) Dragonsfire Grenade (Survival Hunter) Serpent Sting (Survival Hunter)
100 Spitting Cobra (Survival Hunter) Expert Trapper (Survival Hunter) Aspect of the Beast

Profile

hunter="Hunter_SV_T19M"
level=110
race=pandaren
role=attack
position=ranged_back
talents=3302022
artifact=34:0:0:0:0:1068:1:1070:3:1071:3:1072:3:1073:3:1074:3:1075:3:1076:3:1077:3:1078:3:1079:1:1080:1:1081:1:1082:1:1083:1:1084:1:1338:1
spec=survival

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=potion_of_the_old_war
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/harpoon

# Executed every time the actor is available.
actions=auto_attack
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=old_war
actions+=/steel_trap
actions+=/explosive_trap
actions+=/dragonsfire_grenade
actions+=/caltrops
actions+=/carve,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies>=3&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)
actions+=/raptor_strike,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies<=2&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)|talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains<gcd.max|buff.moknathal_tactics.down)
actions+=/aspect_of_the_eagle
actions+=/fury_of_the_eagle,if=buff.mongoose_fury.up&(buff.mongoose_fury.stack=6|action.mongoose_bite.charges=0&cooldown.snake_hunter.remains|buff.mongoose_fury.remains<=gcd.max*2)
actions+=/mongoose_bite,if=buff.aspect_of_the_eagle.up&(charges>=2|charges>=1&cooldown.mongoose_bite.remains<=2)|(buff.mongoose_fury.up|cooldown.fury_of_the_eagle.remains<5|charges=3)
actions+=/a_murder_of_crows
actions+=/lacerate,if=dot.lacerate.ticking&dot.lacerate.remains<=3|target.time_to_die>=5
actions+=/snake_hunter,if=action.mongoose_bite.charges<=1&buff.mongoose_fury.remains>gcd.max*4|action.mongoose_bite.charges=0&buff.aspect_of_the_eagle.up
actions+=/flanking_strike,if=talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains>=3)|!talent.way_of_the_moknathal.enabled
actions+=/butchery,if=spell_targets.butchery>=2
actions+=/carve,if=spell_targets.carve>=4
actions+=/spitting_cobra
actions+=/throwing_axes
actions+=/raptor_strike,if=!talent.throwing_axes.enabled&focus>75-cooldown.flanking_strike.remains*focus.regen

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_claw
shoulders=matted_fur_pauldrons,id=139217,bonus_id=1806
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=call_of_the_wild,id=137101,bonus_id=1806
hands=gauntlets_of_malevolent_intent,id=139213,bonus_id=1806
waist=laughing_sisters_pouchchain,id=139211,bonus_id=1806
legs=disjointed_linkage_leggings,id=139216,bonus_id=1806
feet=malignant_sabatons,id=138211,bonus_id=1806
finger1=grubby_silver_ring,id=139236,bonus_id=1806,enchant=200vers
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=200vers
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=natures_call,id=139334,bonus_id=1806
main_hand=talonclaw,id=128808,gem_id=139262/139257/139255,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=881.73
# gear_agility=16240
# gear_stamina=25958
# gear_crit_rating=10204
# gear_haste_rating=4775
# gear_mastery_rating=2923
# gear_versatility_rating=1710
# gear_armor=2758
summon_pet=cat

Mage_Arcane_T19M : 441511 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
441511.2 441511.2 411.6 / 0.093% 70491.2 / 16.0% 8.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
48086.3 48086.3 Mana 0.02% 44.3 100.0% 100%
Talents
  • 15: Arcane Familiar (Arcane Mage)
  • 45: Rune of Power
  • 60: Supernova (Arcane Mage)
  • 90: Nether Tempest (Arcane Mage)
  • 100: Quickening (Arcane Mage)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mage_Arcane_T19M 441511
Aegwynn's Ascendance 3819 0.9% 3.3 98.46sec 345134 0 Direct 3.3 345138 0 345138 0.0%  

Stats details: aegwynns_ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.32 3.32 0.00 0.00 0.0000 0.0000 1145768.66 1145768.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.32 100.00% 345137.74 98031 375378 345382.32 256944 368839 1145769 1145769 0.00
 
 

Action details: aegwynns_ascendance

Static Values
  • id:187677
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187677
  • name:Aegwynn's Ascendance
  • school:arcane
  • tooltip:
  • description:An emanation of mana-fueled Arcane damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:324719.91
  • base_dd_max:324719.91
 
Arcane Barrage 10854 2.5% 9.8 27.23sec 333645 332786 Direct 9.8 262385 525269 335207 27.7%  

Stats details: arcane_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.80 9.75 0.00 0.00 1.0026 0.0000 3268290.90 3268290.90 0.00 332785.96 332785.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.05 72.30% 262385.20 250308 488100 262456.09 250308 344173 1849580 1849580 0.00
crit 2.70 27.70% 525268.58 500616 976201 500110.04 0 976201 1418711 1418711 0.00
 
 

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:5500.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:mana.pct<100&cooldown.arcane_power.remains>5
Spelldata
  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=1 + 130.0%} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge$?a231564[ Hits {$36032s3=0} additional $Ltarget:targets; within {$s3=10} yds per Arcane Charge for {$s2=50}% damage.][] |cFFFFFFFFConsumes all Arcane Charges.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Arcane Blast 155202 35.2% 96.5 3.11sec 482535 309187 Direct 97.5 374072 750011 477581 27.5%  

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.50 97.50 0.00 0.00 1.5607 0.0000 46566288.46 46566288.46 0.00 309186.63 309186.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.66 72.47% 374071.62 89411 696106 374290.35 316404 444514 26430715 26430715 0.00
crit 26.85 27.53% 750010.73 178821 1392213 750595.09 488271 1064081 20135574 20135574 0.00
 
 

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 192.4%} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Mana cost increased by {$36032s2=125}% per Arcane Charge. |cFFFFFFFFGenerates 1 Arcane Charge|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.924000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Arcane Explosion 2217 0.5% 2.5 69.66sec 262968 240093 Direct 2.5 205345 410755 262969 28.1%  

Stats details: arcane_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.53 2.53 0.00 0.00 1.0955 0.0000 665539.05 665539.05 0.00 240093.45 240093.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.82 71.95% 205345.34 144410 281600 181452.44 0 281600 373922 373922 0.00
crit 0.71 28.05% 410754.98 288821 563201 216495.74 0 563201 291617 291617 0.00
 
 

Action details: arcane_explosion

Static Values
  • id:1449
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1
Spelldata
  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s1=1 + 75.0%} Arcane damage to all enemies within $A1 yards. Damage increased by {$36032s1=60}% per Arcane Charge. Mana cost increased by {$36032s2=125}% per Arcane Charge. |cFFFFFFFFGenerates 1 Arcane Charge if any targets are hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Arcane Missiles 121134 27.5% 46.0 6.30sec 790204 501713 Periodic 274.8 103892 207691 132391 27.5% 20.3%

Stats details: arcane_missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.04 0.00 275.63 274.82 1.5750 0.2212 36382241.60 36382241.60 0.00 501713.30 501713.30
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.4 72.54% 103891.54 51393 160287 103946.36 92597 123232 20711825 20711825 0.00
crit 75.5 27.46% 207690.58 102787 320575 207783.52 176124 244672 15670417 15670417 0.00
 
 

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.arcane_missiles.react=3
Spelldata
  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing a total of ${5*{$7268s1=1 + 44.3%}} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Each damaging spell cast has a {$79684s1=15}% chance to activate Arcane Missiles. Chance doubled for Arcane Blast. Limit {$79683s1=3} charges. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing a total of ${5*{$7268s1=1 + 44.3%}} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Each damaging spell cast has a {$79684s1=15}% chance to activate Arcane Missiles. Chance doubled for Arcane Blast. Limit {$79683s1=3} charges. |cFFFFFFFFGenerates 1 Arcane Charge.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.443000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 21501 4.8% 39.4 5.93sec 161486 0 Direct 39.4 126750 253220 161489 27.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.37 39.37 0.00 0.00 0.0000 0.0000 6357477.53 6357477.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.56 72.53% 126749.59 84248 164284 126715.69 106714 144314 3619395 3619395 0.00
crit 10.81 27.47% 253219.55 168496 328567 253104.90 168496 328567 2738082 2738082 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of Aluneth 9844 2.2% 5.2 62.25sec 563274 402487 Periodic 31.0 74463 148505 94831 27.5% 10.3%

Stats details: mark_of_aluneth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.23 0.00 31.04 31.04 1.3996 1.0000 2943384.53 2943384.53 0.00 76748.57 402486.60
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.5 72.49% 74463.00 52609 102588 74880.14 60036 89961 1675356 1675356 0.00
crit 8.5 27.51% 148505.05 105218 205175 149354.84 105218 205175 1268029 1268029 0.00
 
 

Action details: mark_of_aluneth

Static Values
  • id:224968
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.arcane_power.remains>20
Spelldata
  • id:224968
  • name:Mark of Aluneth
  • school:arcane
  • tooltip:Deals continuous Arcane damage, and then detonates for massive damage to nearby enemies.
  • description:Creates a rune around the target, inflicting ${{$211088s1=0 + 120.0%}*6} Arcane damage over {$d=6 seconds}, and then detonating for Arcane damage equal to {$s1=15}% of your maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mark of Aluneth (_explosion) 9113 2.1% 5.2 62.19sec 520993 0 Direct 5.2 407876 814487 521003 27.8%  

Stats details: mark_of_aluneth_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.23 5.23 0.00 0.00 0.0000 0.0000 2722447.11 2722447.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.77 72.18% 407876.44 262874 512604 409246.15 0 512604 1538372 1538372 0.00
crit 1.45 27.82% 814487.34 525748 1025208 661374.55 0 1025208 1184075 1184075 0.00
 
 

Action details: mark_of_aluneth_explosion

Static Values
  • id:210726
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210726
  • name:Mark of Aluneth
  • school:physical
  • tooltip:
  • description:Creates a runic prison at the target's location, slowing enemy movement speed by ${{$211056s1=70}/-1}%, inflicting ${{$211088s1=0 + 120.0%}*6} Arcane damage over {$d=6 seconds}, and then detonating for Arcane damage equal to {$s1=15}% of your maximum mana.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:235274.82
  • base_dd_max:235274.82
 
Mark of the Hidden Satyr 10430 2.4% 21.3 14.08sec 147309 0 Direct 21.3 115882 231331 147310 27.2%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.25 21.25 0.00 0.00 0.0000 0.0000 3130860.66 3130860.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.47 72.78% 115882.21 94426 184131 115924.47 94426 151377 1792434 1792434 0.00
crit 5.79 27.22% 231331.01 188852 368262 230868.41 0 368262 1338427 1338427 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Nether Tempest 21286 (42586) 4.8% (9.7%) 25.8 11.62sec 495198 484509 Periodic 422.3 11873 23747 15136 27.5% 94.2%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.83 0.00 422.30 422.30 1.0221 0.6706 6392079.86 6392079.86 0.00 41311.39 484508.93
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 306.2 72.52% 11873.24 12 18781 11878.25 11389 12443 3636070 3636070 0.00
crit 116.1 27.48% 23747.21 24 37563 23759.14 21866 26112 2756010 2756010 0.00
 
 

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:16500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.nether_tempest.remains<=2|!ticking
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals $w1 Arcane damage and an additional $w1 Arcane damage to all enemies within $114954A1 yards every $t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over {$114923d=12 seconds} to the target and ${$114954m1*12/$t1} to all enemies within 10 yards. Limit 1 target. Damage increased by {$36032s1=60}% per Arcane Charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.055000
  • base_td:1.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Nether Tempest (_aoe) 21300 4.8% 422.3 0.70sec 15148 0 Periodic 420.5 11937 23876 15214 27.5% 0.0%

Stats details: nether_tempest_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 422.29 0.00 0.00 420.47 0.0000 0.0000 6397017.76 6397017.76 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 305.0 72.55% 11936.54 9632 18781 11941.62 11511 12534 3641154 3641154 0.00
crit 115.4 27.45% 23875.91 19263 37563 23884.34 21623 26077 2755864 2755864 0.00
 
 

Action details: nether_tempest_aoe

Static Values
  • id:114954
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:1.2500
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114954
  • name:Nether Tempest
  • school:arcane
  • tooltip:
  • description:{$@spelldesc114923=Places a Nether Tempest on the target which deals $114923o1 Arcane damage over {$114923d=12 seconds} to the target and ${$114954m1*12/$t1} to all enemies within 10 yards. Limit 1 target. Damage increased by {$36032s1=60}% per Arcane Charge.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.055000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Plague Swarm 16939 3.8% 17.0 17.49sec 300124 0 Periodic 72.1 55355 110755 70546 27.4% 47.0%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.95 0.00 72.13 72.13 0.0000 1.9595 5088292.05 5088292.05 0.00 36000.88 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.4 72.58% 55355.28 23 90679 55403.80 46034 67821 2897916 2897916 0.00
crit 19.8 27.42% 110755.12 47 181359 110863.67 80245 154620 2190376 2190376 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Supernova 7631 1.7% 9.4 31.09sec 243333 240179 Direct 9.4 190585 382149 243335 27.5%  

Stats details: supernova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.44 9.44 0.00 0.00 1.0132 0.0000 2297790.12 2297790.12 0.00 240178.75 240178.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.84 72.46% 190584.80 166597 324865 190412.23 166597 249896 1304058 1304058 0.00
crit 2.60 27.54% 382148.90 333195 649730 362250.16 0 649730 993732 993732 0.00
 
 

Action details: supernova

Static Values
  • id:157980
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:mana.pct<100
Spelldata
  • id:157980
  • name:Supernova
  • school:arcane
  • tooltip:
  • description:Pulses arcane energy around the target enemy or ally, dealing {$s2=1 + 190.0%} Arcane damage to all enemies within $A2 yards, and knocking them upward. A primary enemy target will take {$s1=100}% increased damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.900000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 7354 1.7% 12.6 23.00sec 174891 0 Direct 86.8 19971 39904 25435 27.4%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.63 86.82 0.00 0.00 0.0000 0.0000 2208308.79 2208308.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.02 72.59% 19971.27 16335 31853 19976.44 16335 25284 1258671 1258671 0.00
crit 23.80 27.41% 39903.50 32670 63706 39885.83 32670 54534 949637 949637 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Touch of the Magi 12308 2.8% 8.3 34.14sec 442259 0 Direct 8.3 442702 0 442702 0.0%  

Stats details: touch_of_the_magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.32 0.00 0.00 0.0000 0.0000 3684743.58 3684743.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.32 100.00% 442701.64 1926 2170328 444964.42 169071 1121299 3684744 3684744 0.00
 
 

Action details: touch_of_the_magi

Static Values
  • id:210833
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating {$s1=20}% of the damage you deal to the target for {$210824d=6 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:492249.95
  • base_dd_max:492249.95
 
pet - arcane_familiar 10577 / 10577
Arcane Assault 10577 2.4% 148.3 2.04sec 21417 0 Direct 147.7 16869 33739 21504 27.5%  

Stats details: arcane_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.31 147.71 0.00 0.00 0.0000 0.0000 3176355.32 3176355.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.13 72.53% 16868.99 14614 21920 16872.73 16159 17553 1807162 1807162 0.00
crit 40.58 27.47% 33738.93 29227 43841 33743.75 30087 37622 1369193 1369193 0.00
 
 

Action details: arcane_assault

Static Values
  • id:205235
  • school:arcane
  • resource:none
  • range:45.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205235
  • name:Arcane Assault
  • school:arcane
  • tooltip:
  • description:{$@spelldesc225119=Launches bolts of arcane energy at the enemy target, causing {$s1=1 + 35.0%} Arcane damage. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Mage_Arcane_T19M
Arcane Power 3.6 93.16sec

Stats details: arcane_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.61 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. Mana costs of your damaging spells reduced by $w2%.
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage and your spells cost {$s2=30}% less mana.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Arcane_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.24sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Evocation 3.3 98.02sec

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.32 0.00 13.20 0.00 3.7216 0.8729 0.00 0.00 0.00 0.00 0.00
 
 

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana every $t1 sec.
  • description:Returns ${4*$m1}% of your total mana over {$d=6 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Arcane_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Arcane_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.7 35.30sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.73 0.00 0.00 0.00 1.0134 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct>45&buff.arcane_power.down
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 
(summon_) Arcane Familiar 1.0 0.00sec

Stats details: summon_arcane_familiar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_arcane_familiar

Static Values
  • id:205022
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205022
  • name:Arcane Familiar
  • school:arcane
  • tooltip:
  • description:Summon a Familiar that attacks your enemies and increases your maximum mana by {$210126s1=10}%. Lasts {$d=3600 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcane Charge 10.7 135.4 28.4sec 2.1sec 90.72% 89.34% 103.7(103.7) 0.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_charge_1:6.56%
  • arcane_charge_2:6.26%
  • arcane_charge_3:6.12%
  • arcane_charge_4:71.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Missiles! 26.6 21.3 11.3sec 6.3sec 47.42% 47.42% 0.9(0.9) 0.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_arcane_missiles
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_missiles_1:32.26%
  • arcane_missiles_2:12.89%
  • arcane_missiles_3:2.26%

Trigger Attempt Success

  • trigger_pct:33.14%

Spelldata details

  • id:79683
  • name:Arcane Missiles!
  • tooltip:Arcane Missiles activated.
  • description:Your offensive spells have a chance to activate Arcane Missiles. This effect can accumulate up to {$79683s1=3} charges and lasts {$79683d=20 seconds}.
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 93.2sec 93.2sec 15.39% 100.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • duration:13.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_power_1:15.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. Mana costs of your damaging spells reduced by $w2%.
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage and your spells cost {$s2=30}% less mana.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 10.94% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 17.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 194.8sec 0.0sec 19.61% 19.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Quickening 11.3 134.8 26.9sec 2.1sec 90.44% 90.44% 0.0(0.0) 0.6

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_quickening
  • max_stacks:50
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • quickening_1:6.99%
  • quickening_2:6.73%
  • quickening_3:6.34%
  • quickening_4:5.96%
  • quickening_5:8.59%
  • quickening_6:7.65%
  • quickening_7:5.73%
  • quickening_8:4.05%
  • quickening_9:3.65%
  • quickening_10:3.11%
  • quickening_11:2.75%
  • quickening_12:2.60%
  • quickening_13:2.47%
  • quickening_14:2.36%
  • quickening_15:2.47%
  • quickening_16:2.29%
  • quickening_17:2.13%
  • quickening_18:2.04%
  • quickening_19:1.98%
  • quickening_20:2.01%
  • quickening_21:1.75%
  • quickening_22:1.63%
  • quickening_23:1.20%
  • quickening_24:0.91%
  • quickening_25:0.69%
  • quickening_26:0.52%
  • quickening_27:0.38%
  • quickening_28:0.30%
  • quickening_29:0.24%
  • quickening_30:0.19%
  • quickening_31:0.15%
  • quickening_32:0.13%
  • quickening_33:0.12%
  • quickening_34:0.12%
  • quickening_35:0.09%
  • quickening_36:0.08%
  • quickening_37:0.05%
  • quickening_38:0.04%
  • quickening_39:0.02%
  • quickening_40:0.01%
  • quickening_41:0.01%
  • quickening_42:0.01%
  • quickening_43:0.00%
  • quickening_44:0.00%
  • quickening_45:0.00%
  • quickening_46:0.00%
  • quickening_47:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198924
  • name:Quickening
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc198923=Arcane Blast, Arcane Missiles, and Arcane Explosion also grant {$198924s1=2}% Haste for {$198924d=6 seconds}, stacking up to {$198924u=50} times. This effect is cleared when you cast Arcane Barrage.}
  • max_stacks:50
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Rune of Power 8.7 0.0 35.3sec 35.3sec 28.68% 28.68% 0.0(0.0) 8.5

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mage Armor

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_mage_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:1250.00

Stack Uptimes

  • mage_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:6117
  • name:Mage Armor
  • tooltip:Mastery increased by $6117w1. Duration of all harmful Magic effects reduced by $w2%.
  • description:Increases your Mastery by {$6117s1=1250}. The duration of all harmful Magic effects used against you is reduced by {$s2=25}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Arcane_T19M
arcane_barrage Mana 9.8 53629.5 5474.9 5474.8 60.9
arcane_blast Mana 97.5 13682978.8 140334.3 141787.5 3.4
arcane_explosion Mana 2.5 318427.8 125831.1 125817.5 2.1
nether_tempest Mana 25.8 407938.9 15795.7 15795.5 31.4
Resource Gains Type Count Total Average Overflow
arcane_blast None 97.50 0.00 (0.00%) 0.00 97.50 100.00%
arcane_explosion None 2.53 0.00 (0.00%) 0.00 2.53 100.00%
evocation Mana 13.20 4583002.22 (34.40%) 347246.94 592301.50 11.44%
mp5_regen Mana 1151.13 6282872.92 (47.15%) 5458.03 150058.22 2.33%
Mystic Kilt of the Rune Master Mana 9.80 2458275.28 (18.45%) 250959.81 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 44301.40 48086.29
Combat End Resource Mean Min Max
Mana 380207.32 22328.50 1378784.00

Benefits & Uptimes

Benefits %
Arcane Barrage Arcane Charge 4 100.0%
Arcane Blast Arcane Charge 0 10.7%
Arcane Blast Arcane Charge 1 10.6%
Arcane Blast Arcane Charge 2 10.5%
Arcane Blast Arcane Charge 3 10.2%
Arcane Blast Arcane Charge 4 58.1%
Arcane Missiles Arcane Charge 2 0.0%
Arcane Missiles Arcane Charge 3 0.7%
Arcane Missiles Arcane Charge 4 99.3%
Nether Tempest Arcane Charge 0 8.3%
Nether Tempest Arcane Charge 1 5.4%
Nether Tempest Arcane Charge 2 4.5%
Nether Tempest Arcane Charge 3 3.7%
Nether Tempest Arcane Charge 4 78.1%
Arcane Missiles! from Arcane Blast 81.4%
Arcane Missiles! from Arcane Explosion 1.1%
Arcane Missiles! from Nether Tempest 9.5%
Arcane Missiles! from Supernova 4.0%
Arcane Missiles! from Arcane Barrage 4.1%
Uptimes %
Mana Cap 1.7%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Mage_Arcane_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Mage_Arcane_T19M Damage Per Second
Count 7499
Mean 441511.16
Minimum 391096.89
Maximum 519040.04
Spread ( max - min ) 127943.15
Range [ ( max - min ) / 2 * 100% ] 14.49%
Standard Deviation 18185.0461
5th Percentile 412933.03
95th Percentile 473476.72
( 95th Percentile - 5th Percentile ) 60543.69
Mean Distribution
Standard Deviation 209.9968
95.00% Confidence Intervall ( 441099.57 - 441922.74 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6516
0.1 Scale Factor Error with Delta=300 2823010
0.05 Scale Factor Error with Delta=300 11292041
0.01 Scale Factor Error with Delta=300 282301041
Priority Target DPS
Sample Data Mage_Arcane_T19M Priority Target Damage Per Second
Count 7499
Mean 441511.16
Minimum 391096.89
Maximum 519040.04
Spread ( max - min ) 127943.15
Range [ ( max - min ) / 2 * 100% ] 14.49%
Standard Deviation 18185.0461
5th Percentile 412933.03
95th Percentile 473476.72
( 95th Percentile - 5th Percentile ) 60543.69
Mean Distribution
Standard Deviation 209.9968
95.00% Confidence Intervall ( 441099.57 - 441922.74 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6516
0.1 Scale Factor Error with Delta=300 2823010
0.05 Scale Factor Error with Delta=300 11292041
0.01 Scale Factor Error with Delta=300 282301041
DPS(e)
Sample Data Mage_Arcane_T19M Damage Per Second (Effective)
Count 7499
Mean 441511.16
Minimum 391096.89
Maximum 519040.04
Spread ( max - min ) 127943.15
Range [ ( max - min ) / 2 * 100% ] 14.49%
Damage
Sample Data Mage_Arcane_T19M Damage
Count 7499
Mean 129250530.66
Minimum 93794734.20
Maximum 167348350.56
Spread ( max - min ) 73553616.36
Range [ ( max - min ) / 2 * 100% ] 28.45%
DTPS
Sample Data Mage_Arcane_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mage_Arcane_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mage_Arcane_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mage_Arcane_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mage_Arcane_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mage_Arcane_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Mage_Arcane_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mage_Arcane_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 summon_arcane_familiar
4 0.00 snapshot_stats
5 0.00 mirror_image
6 0.00 potion,name=deadly_grace
7 0.00 arcane_blast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.arcane_power.down
8 3.28 stop_burn_phase,if=prev_gcd.evocation&burn_phase_duration>gcd.max
9 3.25 mark_of_aluneth,if=cooldown.arcane_power.remains>20
A 0.00 call_action_list,name=build,if=buff.arcane_charge.stack<4
B 0.00 call_action_list,name=init_burn,if=buff.arcane_power.down&buff.arcane_charge.stack=4&(cooldown.mark_of_aluneth.remains=0|cooldown.mark_of_aluneth.remains>20)&(!talent.rune_of_power.enabled|(cooldown.arcane_power.remains<=action.rune_of_power.cast_time|action.rune_of_power.recharge_time<cooldown.arcane_power.remains))|target.time_to_die<45
C 0.00 call_action_list,name=burn,if=burn_phase
D 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&!burn_phase
E 0.00 call_action_list,name=conserve
actions.build
# count action,conditions
0.00 charged_up,if=buff.arcane_charge.stack<=1
F 0.32 arcane_missiles,if=buff.arcane_missiles.react=3
0.00 arcane_orb
0.00 arcane_explosion,if=active_enemies>1
G 41.30 arcane_blast
actions.burn
# count action,conditions
H 0.00 call_action_list,name=cooldowns
I 1.57 arcane_missiles,if=buff.arcane_missiles.react=3
J 1.11 arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
0.00 presence_of_mind,if=buff.arcane_power.remains>2*gcd
K 6.34 nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
L 1.66 arcane_blast,if=active_enemies<=1&mana.pct%10*execute_time>target.time_to_die
0.00 arcane_explosion,if=active_enemies>1&mana.pct%10*execute_time>target.time_to_die
M 10.50 arcane_missiles,if=buff.arcane_missiles.react>1
0.00 arcane_explosion,if=active_enemies>1&buff.arcane_power.remains>cast_time
N 21.00 arcane_blast,if=buff.presence_of_mind.up|buff.arcane_power.remains>cast_time
O 4.62 supernova,if=mana.pct<100
P 10.19 arcane_missiles,if=mana.pct>10&(talent.overpowered.enabled|buff.arcane_power.down)
0.00 arcane_explosion,if=active_enemies>1
Q 17.39 arcane_blast
R 3.32 evocation,interrupt_if=mana.pct>99
actions.conserve
# count action,conditions
S 1.71 arcane_missiles,if=buff.arcane_missiles.react=3
T 0.50 arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
U 1.11 arcane_blast,if=mana.pct>99
V 10.58 nether_tempest,if=(refreshable|!ticking)
0.00 arcane_blast,if=buff.rhonins_assaulting_armwraps.up&equipped.132413
W 17.04 arcane_missiles
X 4.82 supernova,if=mana.pct<100
0.00 frost_nova,if=equipped.132452
0.00 arcane_explosion,if=mana.pct>=82&equipped.132451&active_enemies>1
Y 5.84 arcane_blast,if=mana.pct>=82&equipped.132451
Z 9.41 arcane_barrage,if=mana.pct<100&cooldown.arcane_power.remains>5
0.00 arcane_explosion,if=active_enemies>1
a 1.19 arcane_blast
actions.cooldowns
# count action,conditions
b 0.11 rune_of_power,if=mana.pct>45&buff.arcane_power.down
c 3.61 arcane_power
0.00 blood_fury
d 2.00 berserking
0.00 arcane_torrent
e 1.00 potion,name=deadly_grace,if=buff.arcane_power.up&(buff.berserking.up|buff.blood_fury.up)
actions.init_burn
# count action,conditions
f 2.00 mark_of_aluneth
0.00 frost_nova,if=equipped.132452
g 8.43 nether_tempest,if=dot.nether_tempest.remains<10&(prev_gcd.mark_of_aluneth|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<gcd.max))
h 8.64 rune_of_power
i 4.27 start_burn_phase,if=((cooldown.evocation.remains-(2*burn_phase_duration))%2<burn_phase_duration)|cooldown.arcane_power.remains=0|target.time_to_die<55
actions.rop_phase
# count action,conditions
j 0.18 arcane_missiles,if=buff.arcane_missiles.react=3
k 0.92 arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
l 0.47 nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
m 4.54 arcane_missiles,if=buff.arcane_charge.stack=4
0.00 arcane_explosion,if=active_enemies>1
n 7.57 arcane_blast,if=mana.pct>45
o 0.39 arcane_barrage

Sample Sequence

012367GGGfghicdNNNNNNNMKNNNghMOPQR8nmnVWZGGGGWWYVWWXZGGGGVWYZ9GGGGghmnnnmlnWXZGGGGghicIMNNMKMNQOMPQKPQPQ9ghQR8nmnnVWXZGGGGWVZGGGGWVhnnmnmnmVWXZGGGGfgicdeIMNNNNNKMMghOJPQQWZGGGGKPQR8TVWWXUWWVYWY9WZGGGGVSghiMOPQQPQPKPcNghNNNNMMOQPKLLM

Sample Sequence Table

time name target resources buffs
Pre flask Mage_Arcane_T19M 1425908.0/1425908: 100% mana
Pre food Mage_Arcane_T19M 1425908.0/1425908: 100% mana
Pre augmentation Mage_Arcane_T19M 1425908.0/1425908: 100% mana
Pre summon_arcane_familiar Fluffy_Pillow 1568498.8/1568499: 100% mana
Pre potion Fluffy_Pillow 1568498.8/1568499: 100% mana potion_of_deadly_grace
0:00.000 arcane_blast Fluffy_Pillow 1535498.8/1568499: 98% mana quickening, potion_of_deadly_grace
0:00.000 arcane_blast Fluffy_Pillow 1535498.8/1568499: 98% mana quickening, potion_of_deadly_grace
0:01.844 arcane_blast Fluffy_Pillow 1494355.7/1568499: 95% mana bloodlust, quickening(2), potion_of_deadly_grace
0:03.236 arcane_blast Fluffy_Pillow 1408628.7/1568499: 90% mana bloodlust, quickening(3), potion_of_deadly_grace
0:04.600 mark_of_aluneth Fluffy_Pillow 1281052.8/1568499: 82% mana bloodlust, quickening(4), potion_of_deadly_grace
0:05.792 nether_tempest Fluffy_Pillow 1306548.0/1568499: 83% mana bloodlust, quickening(4), potion_of_deadly_grace
0:06.687 rune_of_power Fluffy_Pillow 1309190.8/1568499: 83% mana bloodlust, quickening(4), potion_of_deadly_grace
0:07.582 start_burn_phase Fluffy_Pillow 1328333.6/1568499: 85% mana bloodlust, quickening(4), rune_of_power, potion_of_deadly_grace
0:07.582 arcane_power Fluffy_Pillow 1328333.6/1568499: 85% mana bloodlust, quickening(4), rune_of_power, potion_of_deadly_grace
0:07.582 berserking Fluffy_Pillow 1328333.6/1568499: 85% mana bloodlust, arcane_power, quickening(4), rune_of_power, potion_of_deadly_grace
0:07.582 arcane_blast Fluffy_Pillow 1328333.6/1568499: 85% mana bloodlust, berserking, arcane_power, quickening(4), rune_of_power, potion_of_deadly_grace
0:08.748 arcane_blast Fluffy_Pillow 1214672.8/1568499: 77% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(5), rune_of_power, potion_of_deadly_grace
0:09.894 arcane_blast Fluffy_Pillow 1100584.1/1568499: 70% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(6), rune_of_power, potion_of_deadly_grace
0:11.019 arcane_blast Fluffy_Pillow 986046.3/1568499: 63% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(7), rune_of_power, potion_of_deadly_grace
0:12.124 arcane_blast Fluffy_Pillow 871080.8/1568499: 56% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(8), rune_of_power, potion_of_deadly_grace
0:13.210 arcane_blast Fluffy_Pillow 755708.8/1568499: 48% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(9), rune_of_power, potion_of_deadly_grace
0:14.278 arcane_blast Fluffy_Pillow 639951.8/1568499: 41% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(10), rune_of_power, potion_of_deadly_grace
0:15.329 arcane_missiles Fluffy_Pillow 523831.3/1568499: 33% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(11), rune_of_power, potion_of_deadly_grace
0:16.534 nether_tempest Fluffy_Pillow 549604.6/1568499: 35% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(12), rune_of_power, potion_of_deadly_grace
0:17.287 arcane_blast Fluffy_Pillow 554160.2/1568499: 35% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(12), rune_of_power, potion_of_deadly_grace
0:18.303 arcane_blast Fluffy_Pillow 437291.0/1568499: 28% mana bloodlust, arcane_missiles, arcane_power, quickening(13), potion_of_deadly_grace
0:19.452 arcane_blast Fluffy_Pillow 323266.6/1568499: 21% mana bloodlust, arcane_missiles(2), arcane_power, quickening(14), potion_of_deadly_grace
0:20.584 nether_tempest Fluffy_Pillow 208878.5/1568499: 13% mana bloodlust, arcane_missiles(2), quickening(15), potion_of_deadly_grace
0:21.338 rune_of_power Fluffy_Pillow 208505.5/1568499: 13% mana bloodlust, arcane_missiles(2), quickening(15), potion_of_deadly_grace
0:22.092 arcane_missiles Fluffy_Pillow 224632.5/1568499: 14% mana bloodlust, arcane_missiles(2), quickening(15), rune_of_power, potion_of_deadly_grace
0:23.351 supernova Fluffy_Pillow 251560.8/1568499: 16% mana bloodlust, arcane_missiles, quickening(16), rune_of_power, potion_of_deadly_grace
0:24.104 arcane_missiles Fluffy_Pillow 267666.4/1568499: 17% mana bloodlust, arcane_missiles, quickening(16), rune_of_power, potion_of_deadly_grace
0:25.350 arcane_blast Fluffy_Pillow 294316.6/1568499: 19% mana bloodlust, quickening(17), rune_of_power, potion_of_deadly_grace
0:26.432 evocation Fluffy_Pillow 119459.1/1568499: 8% mana bloodlust, quickening(18), rune_of_power, potion_of_deadly_grace
0:29.553 stop_burn_phase Fluffy_Pillow 1568498.8/1568499: 100% mana bloodlust, quickening(18), rune_of_power
0:29.553 arcane_blast Fluffy_Pillow 1568498.8/1568499: 100% mana bloodlust, quickening(18), rune_of_power
0:30.620 arcane_missiles Fluffy_Pillow 1370627.1/1568499: 87% mana bloodlust, arcane_missiles, quickening(19), rune_of_power
0:31.812 arcane_blast Fluffy_Pillow 1396122.4/1568499: 89% mana bloodlust, quickening(20), rune_of_power
0:32.845 nether_tempest Fluffy_Pillow 1220216.8/1568499: 78% mana bloodlust, arcane_missiles, quickening(21)
0:33.599 arcane_missiles Fluffy_Pillow 1219843.8/1568499: 78% mana bloodlust, arcane_missiles, quickening(21)
0:34.570 arcane_barrage Fluffy_Pillow 1240612.2/1568499: 79% mana bloodlust, quickening(22)
0:35.324 arcane_blast Fluffy_Pillow 1502199.0/1568499: 96% mana bloodlust
0:36.770 arcane_blast Fluffy_Pillow 1500127.0/1568499: 96% mana bloodlust, arcane_charge, quickening
0:38.190 arcane_blast Fluffy_Pillow 1456248.8/1568499: 93% mana bloodlust, arcane_charge(2), arcane_missiles, quickening(2)
0:39.582 arcane_blast Fluffy_Pillow 1370521.8/1568499: 87% mana bloodlust, arcane_charge(3), arcane_missiles, quickening(3)
0:40.947 arcane_missiles Fluffy_Pillow 1242967.2/1568499: 79% mana arcane_charge(4), arcane_missiles(2), quickening(4)
0:42.773 arcane_missiles Fluffy_Pillow 1282022.8/1568499: 82% mana arcane_charge(4), arcane_missiles, quickening(5)
0:44.411 arcane_blast Fluffy_Pillow 1317057.4/1568499: 84% mana arcane_charge(4), quickening(6)
0:46.091 nether_tempest Fluffy_Pillow 1154990.3/1568499: 74% mana arcane_charge(4), arcane_missiles, quickening(7)
0:47.192 arcane_missiles Fluffy_Pillow 1162039.2/1568499: 74% mana arcane_charge(4), arcane_missiles(2), quickening(7)
0:48.891 arcane_missiles Fluffy_Pillow 1198378.4/1568499: 76% mana arcane_charge(4), arcane_missiles, quickening(8)
0:50.658 supernova Fluffy_Pillow 1236172.1/1568499: 79% mana arcane_charge(4), quickening(9)
0:51.724 arcane_barrage Fluffy_Pillow 1258972.4/1568499: 80% mana arcane_charge(4), quickening(9)
0:52.787 arcane_blast Fluffy_Pillow 1527168.3/1568499: 97% mana arcane_missiles
0:54.667 arcane_blast Fluffy_Pillow 1534378.9/1568499: 98% mana arcane_charge, arcane_missiles, quickening
0:56.510 arcane_blast Fluffy_Pillow 1494334.4/1568499: 95% mana arcane_charge(2), arcane_missiles, quickening(2)
0:58.318 arcane_blast Fluffy_Pillow 1417505.0/1568499: 90% mana arcane_charge(3), arcane_missiles, quickening(3)
1:00.094 nether_tempest Fluffy_Pillow 1298741.2/1568499: 83% mana arcane_charge(4), arcane_missiles, quickening(4)
1:01.257 arcane_missiles Fluffy_Pillow 1307116.1/1568499: 83% mana arcane_charge(4), arcane_missiles, quickening(4)
1:03.084 arcane_blast Fluffy_Pillow 1346193.1/1568499: 86% mana arcane_charge(4), quickening(5)
1:04.796 arcane_barrage Fluffy_Pillow 1184810.5/1568499: 76% mana arcane_charge(4), quickening(6)
1:05.919 mark_of_aluneth Fluffy_Pillow 1454289.7/1568499: 93% mana
1:07.592 arcane_blast Fluffy_Pillow 1490072.8/1568499: 95% mana
1:09.473 arcane_blast Fluffy_Pillow 1497304.8/1568499: 95% mana arcane_charge, quickening
1:11.316 arcane_blast Fluffy_Pillow 1462474.1/1568499: 93% mana arcane_charge(2), quickening(2)
1:13.125 arcane_blast Fluffy_Pillow 1385666.1/1568499: 88% mana arcane_charge(3), quickening(3)
1:14.899 nether_tempest Fluffy_Pillow 1266859.5/1568499: 81% mana arcane_charge(4), arcane_missiles, quickening(4)
1:16.061 rune_of_power Fluffy_Pillow 1275213.1/1568499: 81% mana arcane_charge(4), arcane_missiles, quickening(4)
1:17.224 arcane_missiles Fluffy_Pillow 1300088.0/1568499: 83% mana arcane_charge(4), arcane_missiles, quickening(4), rune_of_power
1:18.955 arcane_blast Fluffy_Pillow 1337111.7/1568499: 85% mana arcane_charge(4), quickening(5), rune_of_power
1:20.664 arcane_blast Fluffy_Pillow 1175664.9/1568499: 75% mana arcane_charge(4), quickening(6), rune_of_power
1:22.345 arcane_blast Fluffy_Pillow 1013619.2/1568499: 65% mana arcane_charge(4), quickening(7), rune_of_power
1:23.997 arcane_missiles Fluffy_Pillow 850953.2/1568499: 54% mana arcane_charge(4), arcane_missiles, quickening(8), rune_of_power
1:25.692 nether_tempest Fluffy_Pillow 887206.9/1568499: 57% mana arcane_charge(4), quickening(9), rune_of_power
1:26.756 arcane_blast Fluffy_Pillow 893464.4/1568499: 57% mana arcane_charge(4), quickening(9), rune_of_power
1:28.351 arcane_missiles Fluffy_Pillow 729579.2/1568499: 47% mana arcane_charge(4), arcane_missiles, quickening(10)
1:29.984 supernova Fluffy_Pillow 764506.8/1568499: 49% mana arcane_charge(4), quickening(11)
1:31.013 arcane_barrage Fluffy_Pillow 786515.7/1568499: 50% mana arcane_charge(4), quickening(11)
1:32.042 arcane_blast Fluffy_Pillow 1053984.4/1568499: 67% mana
1:33.922 arcane_blast Fluffy_Pillow 1061195.0/1568499: 68% mana arcane_charge, arcane_missiles, quickening
1:35.765 arcane_blast Fluffy_Pillow 1026364.2/1568499: 65% mana arcane_charge(2), arcane_missiles(2), quickening(2)
1:37.574 arcane_blast Fluffy_Pillow 949556.3/1568499: 61% mana arcane_charge(3), arcane_missiles(3), quickening(3)
1:39.348 nether_tempest Fluffy_Pillow 830749.7/1568499: 53% mana arcane_charge(4), arcane_missiles(3), quickening(4)
1:40.511 rune_of_power Fluffy_Pillow 839124.6/1568499: 53% mana arcane_charge(4), arcane_missiles(3), quickening(4)
1:41.673 start_burn_phase Fluffy_Pillow 863978.2/1568499: 55% mana arcane_charge(4), arcane_missiles(3), quickening(4), rune_of_power
1:41.673 arcane_power Fluffy_Pillow 863978.2/1568499: 55% mana arcane_charge(4), arcane_missiles(3), quickening(4), rune_of_power
1:41.673 arcane_missiles Fluffy_Pillow 863978.2/1568499: 55% mana arcane_charge(4), arcane_missiles(3), arcane_power, quickening(4), rune_of_power
1:43.551 arcane_missiles Fluffy_Pillow 904146.0/1568499: 58% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(5), rune_of_power
1:45.237 arcane_blast Fluffy_Pillow 940207.3/1568499: 60% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(6), rune_of_power
1:46.918 arcane_blast Fluffy_Pillow 837561.5/1568499: 53% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(7), rune_of_power
1:48.570 arcane_missiles Fluffy_Pillow 734295.5/1568499: 47% mana arcane_charge(4), arcane_missiles(3), arcane_power, quickening(8), rune_of_power
1:50.263 nether_tempest Fluffy_Pillow 770506.5/1568499: 49% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(9), rune_of_power
1:51.327 arcane_missiles Fluffy_Pillow 781714.0/1568499: 50% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(9), rune_of_power
1:52.906 arcane_blast Fluffy_Pillow 815486.6/1568499: 52% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(10)
1:54.474 arcane_blast Fluffy_Pillow 710423.9/1568499: 45% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(11)
1:56.016 supernova Fluffy_Pillow 545405.2/1568499: 35% mana arcane_charge(4), arcane_missiles(2), quickening(12)
1:57.029 arcane_missiles Fluffy_Pillow 567071.9/1568499: 36% mana arcane_charge(4), arcane_missiles(2), quickening(12)
1:58.693 arcane_missiles Fluffy_Pillow 602662.5/1568499: 38% mana arcane_charge(4), arcane_missiles, quickening(13)
2:00.151 arcane_blast Fluffy_Pillow 633847.1/1568499: 40% mana arcane_charge(4), quickening(14)
2:01.621 nether_tempest Fluffy_Pillow 467288.4/1568499: 30% mana arcane_charge(4), arcane_missiles, quickening(15)
2:02.589 arcane_missiles Fluffy_Pillow 471492.6/1568499: 30% mana arcane_charge(4), arcane_missiles, quickening(15)
2:04.075 arcane_blast Fluffy_Pillow 503276.1/1568499: 32% mana arcane_charge(4), quickening(16)
2:05.501 arcane_missiles Fluffy_Pillow 335776.3/1568499: 21% mana arcane_charge(4), arcane_missiles, quickening(17)
2:07.001 arcane_blast Fluffy_Pillow 367859.2/1568499: 23% mana arcane_charge(4), quickening(18)
2:08.384 mark_of_aluneth Fluffy_Pillow 199439.6/1568499: 13% mana arcane_charge(4), quickening(19)
2:09.596 nether_tempest Fluffy_Pillow 225362.7/1568499: 14% mana arcane_charge(4), quickening(19)
2:10.505 rune_of_power Fluffy_Pillow 228304.9/1568499: 15% mana arcane_charge(4), quickening(19)
2:11.415 arcane_blast Fluffy_Pillow 247768.6/1568499: 16% mana arcane_charge(4), quickening(19), rune_of_power
2:12.777 evocation Fluffy_Pillow 78899.9/1568499: 5% mana arcane_charge(4), quickening(20), rune_of_power
2:16.618 stop_burn_phase Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), quickening(20), rune_of_power
2:16.618 arcane_blast Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), quickening(20), rune_of_power
2:17.963 arcane_missiles Fluffy_Pillow 1370605.7/1568499: 87% mana arcane_charge(4), arcane_missiles, quickening(21), rune_of_power
2:19.354 arcane_blast Fluffy_Pillow 1400357.3/1568499: 89% mana arcane_charge(4), quickening(22), rune_of_power
2:20.660 arcane_blast Fluffy_Pillow 1230290.9/1568499: 78% mana arcane_charge(4), quickening(23), rune_of_power
2:21.950 nether_tempest Fluffy_Pillow 1059882.2/1568499: 68% mana arcane_charge(4), quickening(24)
2:22.800 arcane_missiles Fluffy_Pillow 1061562.5/1568499: 68% mana arcane_charge(4), arcane_missiles, quickening(24)
2:24.190 supernova Fluffy_Pillow 1091292.7/1568499: 70% mana arcane_charge(4), quickening(25)
2:25.027 arcane_barrage Fluffy_Pillow 1109195.0/1568499: 71% mana arcane_charge(4), quickening(25)
2:25.866 arcane_blast Fluffy_Pillow 1372599.8/1568499: 88% mana
2:27.746 arcane_blast Fluffy_Pillow 1379810.4/1568499: 88% mana arcane_charge, quickening
2:29.589 arcane_blast Fluffy_Pillow 1344979.6/1568499: 86% mana arcane_charge(2), quickening(2)
2:31.396 arcane_blast Fluffy_Pillow 1268128.9/1568499: 81% mana arcane_charge(3), arcane_missiles, quickening(3)
2:33.170 arcane_missiles Fluffy_Pillow 1149322.3/1568499: 73% mana arcane_charge(4), arcane_missiles, quickening(4)
2:34.926 nether_tempest Fluffy_Pillow 1186880.7/1568499: 76% mana arcane_charge(4), quickening(5)
2:36.068 arcane_barrage Fluffy_Pillow 1194806.5/1568499: 76% mana arcane_charge(4), quickening(5)
2:37.209 arcane_blast Fluffy_Pillow 1464670.7/1568499: 93% mana
2:39.090 arcane_blast Fluffy_Pillow 1471902.7/1568499: 94% mana arcane_charge, quickening
2:40.936 arcane_blast Fluffy_Pillow 1437136.1/1568499: 92% mana arcane_charge(2), quickening(2)
2:42.745 arcane_blast Fluffy_Pillow 1360328.1/1568499: 87% mana arcane_charge(3), quickening(3)
2:44.519 arcane_missiles Fluffy_Pillow 1241521.6/1568499: 79% mana arcane_charge(4), arcane_missiles, quickening(4)
2:46.343 nether_tempest Fluffy_Pillow 1280534.4/1568499: 82% mana arcane_charge(4), quickening(5)
2:47.485 rune_of_power Fluffy_Pillow 1288460.2/1568499: 82% mana arcane_charge(4), quickening(5)
2:48.719 arcane_blast Fluffy_Pillow 1314853.8/1568499: 84% mana arcane_charge(4), quickening(5), rune_of_power
2:50.429 arcane_blast Fluffy_Pillow 1153428.3/1568499: 74% mana arcane_charge(4), quickening(6), rune_of_power
2:52.108 arcane_missiles Fluffy_Pillow 991339.8/1568499: 63% mana arcane_charge(4), arcane_missiles, quickening(7), rune_of_power
2:53.807 arcane_blast Fluffy_Pillow 1027679.1/1568499: 66% mana arcane_charge(4), quickening(8), rune_of_power
2:55.428 arcane_missiles Fluffy_Pillow 864350.0/1568499: 55% mana arcane_charge(4), arcane_missiles, quickening(9), rune_of_power
2:57.124 arcane_blast Fluffy_Pillow 900625.1/1568499: 57% mana arcane_charge(4), quickening(10), rune_of_power
2:58.692 arcane_missiles Fluffy_Pillow 736162.5/1568499: 47% mana arcane_charge(4), arcane_missiles, quickening(11), rune_of_power
3:00.305 nether_tempest Fluffy_Pillow 770662.3/1568499: 49% mana arcane_charge(4), quickening(12)
3:01.318 arcane_missiles Fluffy_Pillow 775829.0/1568499: 49% mana arcane_charge(4), arcane_missiles, quickening(12)
3:02.926 supernova Fluffy_Pillow 810221.9/1568499: 52% mana arcane_charge(4), quickening(13)
3:03.922 arcane_barrage Fluffy_Pillow 831524.9/1568499: 53% mana arcane_charge(4), quickening(13)
3:04.917 arcane_blast Fluffy_Pillow 1098266.4/1568499: 70% mana
3:06.797 arcane_blast Fluffy_Pillow 1105477.0/1568499: 70% mana arcane_charge, arcane_missiles, quickening
3:08.641 arcane_blast Fluffy_Pillow 1070667.7/1568499: 68% mana arcane_charge(2), arcane_missiles(2), quickening(2)
3:10.448 arcane_blast Fluffy_Pillow 993816.9/1568499: 63% mana arcane_charge(3), arcane_missiles(3), quickening(3)
3:12.222 mark_of_aluneth Fluffy_Pillow 875010.3/1568499: 56% mana arcane_charge(4), arcane_missiles(3), quickening(4)
3:13.770 nether_tempest Fluffy_Pillow 908119.9/1568499: 58% mana arcane_charge(4), arcane_missiles(3), quickening(4)
3:14.933 start_burn_phase Fluffy_Pillow 916494.8/1568499: 58% mana arcane_charge(4), arcane_missiles(3), quickening(4)
3:14.933 arcane_power Fluffy_Pillow 916494.8/1568499: 58% mana arcane_charge(4), arcane_missiles(3), quickening(4)
3:14.933 berserking Fluffy_Pillow 916494.8/1568499: 58% mana arcane_charge(4), arcane_missiles(3), arcane_power, quickening(4)
3:14.933 potion Fluffy_Pillow 916494.8/1568499: 58% mana berserking, arcane_charge(4), arcane_missiles(3), arcane_power, quickening(4)
3:14.933 arcane_missiles Fluffy_Pillow 916494.8/1568499: 58% mana berserking, arcane_charge(4), arcane_missiles(3), arcane_power, quickening(4), potion_of_deadly_grace
3:16.526 arcane_missiles Fluffy_Pillow 950566.9/1568499: 61% mana berserking, arcane_charge(4), arcane_missiles(2), arcane_power, quickening(5), potion_of_deadly_grace
3:17.982 arcane_blast Fluffy_Pillow 981708.8/1568499: 63% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(6), potion_of_deadly_grace
3:19.443 arcane_blast Fluffy_Pillow 874357.5/1568499: 56% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(7), potion_of_deadly_grace
3:20.878 arcane_blast Fluffy_Pillow 766450.2/1568499: 49% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(8), potion_of_deadly_grace
3:22.289 arcane_blast Fluffy_Pillow 658029.5/1568499: 42% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(9), potion_of_deadly_grace
3:23.675 arcane_blast Fluffy_Pillow 549074.2/1568499: 35% mana berserking, arcane_charge(4), arcane_missiles(2), arcane_power, quickening(10), potion_of_deadly_grace
3:25.041 nether_tempest Fluffy_Pillow 439691.0/1568499: 28% mana arcane_charge(4), arcane_missiles(3), arcane_power, quickening(11), potion_of_deadly_grace
3:26.071 arcane_missiles Fluffy_Pillow 450171.3/1568499: 29% mana arcane_charge(4), arcane_missiles(3), arcane_power, quickening(11), potion_of_deadly_grace
3:27.593 arcane_missiles Fluffy_Pillow 482724.8/1568499: 31% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(12), potion_of_deadly_grace
3:29.165 nether_tempest Fluffy_Pillow 516347.7/1568499: 33% mana arcane_charge(4), arcane_missiles, quickening(13), potion_of_deadly_grace
3:30.163 rune_of_power Fluffy_Pillow 521193.5/1568499: 33% mana arcane_charge(4), arcane_missiles, quickening(13), potion_of_deadly_grace
3:31.160 supernova Fluffy_Pillow 542518.0/1568499: 35% mana arcane_charge(4), arcane_missiles, quickening(13), rune_of_power, potion_of_deadly_grace
3:32.156 arcane_explosion Fluffy_Pillow 563821.1/1568499: 36% mana arcane_charge(4), arcane_missiles, quickening(13), rune_of_power, potion_of_deadly_grace
3:33.153 arcane_missiles Fluffy_Pillow 453145.5/1568499: 29% mana arcane_charge(4), arcane_missiles, quickening(14), rune_of_power, potion_of_deadly_grace
3:34.658 arcane_blast Fluffy_Pillow 485335.4/1568499: 31% mana arcane_charge(4), quickening(15), rune_of_power, potion_of_deadly_grace
3:36.103 arcane_blast Fluffy_Pillow 318241.9/1568499: 20% mana arcane_charge(4), quickening(16), rune_of_power, potion_of_deadly_grace
3:37.528 arcane_missiles Fluffy_Pillow 150720.7/1568499: 10% mana arcane_charge(4), arcane_missiles, quickening(17), rune_of_power, potion_of_deadly_grace
3:39.007 arcane_barrage Fluffy_Pillow 182354.5/1568499: 12% mana arcane_charge(4), quickening(18), rune_of_power, potion_of_deadly_grace
3:39.929 arcane_blast Fluffy_Pillow 447534.6/1568499: 29% mana rune_of_power, potion_of_deadly_grace
3:41.809 arcane_blast Fluffy_Pillow 454745.2/1568499: 29% mana arcane_charge, quickening, potion_of_deadly_grace
3:43.652 arcane_blast Fluffy_Pillow 419914.4/1568499: 27% mana arcane_charge(2), quickening(2), potion_of_deadly_grace
3:45.462 arcane_blast Fluffy_Pillow 343127.8/1568499: 22% mana arcane_charge(3), quickening(3)
3:47.236 nether_tempest Fluffy_Pillow 224321.2/1568499: 14% mana arcane_charge(4), quickening(4)
3:48.398 arcane_missiles Fluffy_Pillow 232674.8/1568499: 15% mana arcane_charge(4), arcane_missiles, quickening(4)
3:50.229 arcane_blast Fluffy_Pillow 271837.4/1568499: 17% mana arcane_charge(4), quickening(5)
3:51.941 evocation Fluffy_Pillow 110454.7/1568499: 7% mana arcane_charge(4), arcane_missiles, quickening(6)
3:56.678 stop_burn_phase Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), arcane_missiles, quickening(6)
3:56.678 arcane_explosion Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), arcane_missiles, quickening(6)
3:57.801 nether_tempest Fluffy_Pillow 1460518.2/1568499: 93% mana arcane_charge(4), arcane_missiles(2), quickening(7)
3:58.902 arcane_missiles Fluffy_Pillow 1467567.1/1568499: 94% mana arcane_charge(4), arcane_missiles(2), quickening(7)
4:00.598 arcane_missiles Fluffy_Pillow 1503842.2/1568499: 96% mana arcane_charge(4), arcane_missiles, quickening(8)
4:02.307 supernova Fluffy_Pillow 1540395.3/1568499: 98% mana arcane_charge(4), quickening(9)
4:03.371 arcane_blast Fluffy_Pillow 1563152.8/1568499: 100% mana arcane_charge(4), arcane_missiles, quickening(9)
4:04.967 arcane_missiles Fluffy_Pillow 1370627.1/1568499: 87% mana arcane_charge(4), arcane_missiles(2), quickening(10)
4:06.636 arcane_missiles Fluffy_Pillow 1406324.7/1568499: 90% mana arcane_charge(4), arcane_missiles, quickening(11)
4:08.209 nether_tempest Fluffy_Pillow 1439969.0/1568499: 92% mana arcane_charge(4), quickening(12)
4:09.221 arcane_blast Fluffy_Pillow 1445114.3/1568499: 92% mana arcane_charge(4), quickening(12)
4:10.738 arcane_missiles Fluffy_Pillow 1279560.9/1568499: 82% mana arcane_charge(4), arcane_missiles, quickening(13)
4:12.258 arcane_blast Fluffy_Pillow 1312071.6/1568499: 84% mana arcane_charge(4), quickening(14)
4:13.727 mark_of_aluneth Fluffy_Pillow 1145491.4/1568499: 73% mana arcane_charge(4), arcane_missiles, quickening(15)
4:15.052 arcane_missiles Fluffy_Pillow 1173831.4/1568499: 75% mana arcane_charge(4), arcane_missiles, quickening(15)
4:16.657 arcane_barrage Fluffy_Pillow 1208160.1/1568499: 77% mana arcane_charge(4), quickening(16)
4:17.608 arcane_blast Fluffy_Pillow 1473960.5/1568499: 94% mana
4:19.488 arcane_blast Fluffy_Pillow 1481171.1/1568499: 94% mana arcane_charge, arcane_missiles, quickening
4:21.330 arcane_blast Fluffy_Pillow 1446318.9/1568499: 92% mana arcane_charge(2), arcane_missiles(2), quickening(2)
4:23.139 arcane_blast Fluffy_Pillow 1369510.9/1568499: 87% mana arcane_charge(3), arcane_missiles(2), quickening(3)
4:24.914 nether_tempest Fluffy_Pillow 1250725.7/1568499: 80% mana arcane_charge(4), arcane_missiles(3), quickening(4)
4:26.075 arcane_missiles Fluffy_Pillow 1259057.9/1568499: 80% mana arcane_charge(4), arcane_missiles(3), quickening(4)
4:27.754 nether_tempest Fluffy_Pillow 1294969.4/1568499: 83% mana arcane_charge(4), arcane_missiles(2), quickening(5)
4:28.895 rune_of_power Fluffy_Pillow 1302873.8/1568499: 83% mana arcane_charge(4), arcane_missiles(2), quickening(5)
4:30.036 start_burn_phase Fluffy_Pillow 1327278.3/1568499: 85% mana arcane_charge(4), arcane_missiles(2), quickening(5), rune_of_power
4:30.036 arcane_missiles Fluffy_Pillow 1327278.3/1568499: 85% mana arcane_charge(4), arcane_missiles(2), quickening(5), rune_of_power
4:31.754 supernova Fluffy_Pillow 1364023.9/1568499: 87% mana arcane_charge(4), arcane_missiles, quickening(6), rune_of_power
4:32.876 arcane_missiles Fluffy_Pillow 1388021.9/1568499: 88% mana arcane_charge(4), arcane_missiles, quickening(6), rune_of_power
4:34.649 arcane_blast Fluffy_Pillow 1425944.0/1568499: 91% mana arcane_charge(4), quickening(7), rune_of_power
4:36.300 arcane_blast Fluffy_Pillow 1263256.6/1568499: 81% mana arcane_charge(4), quickening(8), rune_of_power
4:37.923 arcane_missiles Fluffy_Pillow 1099970.3/1568499: 70% mana arcane_charge(4), arcane_missiles, quickening(9), rune_of_power
4:39.548 arcane_blast Fluffy_Pillow 1134726.8/1568499: 72% mana arcane_charge(4), quickening(10), rune_of_power
4:41.116 arcane_missiles Fluffy_Pillow 970264.2/1568499: 62% mana arcane_charge(4), arcane_missiles, quickening(11)
4:42.697 nether_tempest Fluffy_Pillow 1004079.6/1568499: 64% mana arcane_charge(4), quickening(12)
4:43.709 arcane_missiles Fluffy_Pillow 1009224.9/1568499: 64% mana arcane_charge(4), arcane_missiles, quickening(12)
4:45.290 arcane_power Fluffy_Pillow 1043040.3/1568499: 66% mana arcane_charge(4), quickening(13)
4:45.290 arcane_blast Fluffy_Pillow 1043040.3/1568499: 66% mana arcane_charge(4), arcane_power, quickening(13)
4:46.783 nether_tempest Fluffy_Pillow 936373.5/1568499: 60% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(14)
4:47.763 rune_of_power Fluffy_Pillow 945784.3/1568499: 60% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(14)
4:48.745 arcane_blast Fluffy_Pillow 966787.9/1568499: 62% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(14), rune_of_power
4:50.215 arcane_blast Fluffy_Pillow 859629.2/1568499: 55% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(15), rune_of_power
4:51.662 arcane_blast Fluffy_Pillow 751978.6/1568499: 48% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(16), rune_of_power
4:53.088 arcane_blast Fluffy_Pillow 643878.7/1568499: 41% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(17), rune_of_power
4:54.494 arcane_missiles Fluffy_Pillow 535351.1/1568499: 34% mana arcane_charge(4), arcane_missiles(3), arcane_power, quickening(18), rune_of_power
4:55.996 arcane_missiles Fluffy_Pillow 567476.8/1568499: 36% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(19), rune_of_power
4:57.382 supernova Fluffy_Pillow 597121.5/1568499: 38% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(20), rune_of_power
4:58.280 arcane_blast Fluffy_Pillow 616328.4/1568499: 39% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(20), rune_of_power
4:59.625 arcane_missiles Fluffy_Pillow 447096.1/1568499: 29% mana arcane_charge(4), arcane_missiles(2), quickening(21)
5:01.110 nether_tempest Fluffy_Pillow 478858.2/1568499: 31% mana arcane_charge(4), arcane_missiles, quickening(22)
5:01.983 arcane_blast Fluffy_Pillow 481030.5/1568499: 31% mana arcane_charge(4), arcane_missiles(2), quickening(22)
5:03.288 arcane_blast Fluffy_Pillow 310942.6/1568499: 20% mana arcane_charge(4), arcane_missiles(2), quickening(23)
5:04.577 arcane_missiles Fluffy_Pillow 140512.6/1568499: 9% mana arcane_charge(4), arcane_missiles(2), quickening(24)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4876 4551 0
Agility 6579 6254 0
Stamina 42382 42382 26343
Intellect 39238 37532 28421 (2596)
Spirit 1 1 0
Health 2542920 2542920 0
Mana 1568499 1378784 0
Spell Power 39238 37532 0
Melee Crit 23.46% 22.39% 6085
Spell Crit 27.46% 26.39% 6085
Haste 19.89% 19.89% 6465
Damage / Heal Versatility 6.41% 6.41% 2564
ManaReg per Second 21389 20682 0
Mastery 29.63% 25.34% 4591
Armor 1824 1824 1824
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Pendant of Liquid Horror
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Ancient Dreamwoven Mantle
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +641 Mastery, +454 Crit }
Local Chest Robes of Celestial Adornment
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +855 Haste, +605 Crit }
Local Waist Cinch of Light
ilevel: 880, stats: { 163 Armor, +1930 Sta, +1287 Int, +783 Mastery, +312 Haste }
Local Legs Mystic Kilt of the Rune Master
ilevel: 895, stats: { 267 Armor, +2959 Sta, +1973 Int, +993 Haste, +552 Mastery }
Local Feet Treads of the Drowned
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +759 Haste, +336 Mastery }
Local Wrists Helhound Hair Bracers
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +499 Mastery, +323 Vers }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Mastery }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Mastery }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Mantle of the Victorious Dead
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Vers, +340 Haste }, enchant: { +200 Int }
Local Main Hand Aluneth
ilevel: 906, weapon: { 5654 - 8482, 3.6 }, stats: { +2186 Int, +3279 Sta, +806 Haste, +806 Mastery, +11923 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Arcane Familiar (Arcane Mage) Presence of Mind (Arcane Mage) Words of Power (Arcane Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Supernova (Arcane Mage) Charged Up (Arcane Mage) Resonance (Arcane Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Nether Tempest (Arcane Mage) Unstable Magic Erosion (Arcane Mage)
100 Overpowered Quickening (Arcane Mage) Arcane Orb (Arcane Mage)

Profile

mage="Mage_Arcane_T19M"
level=110
race=troll
role=spell
position=back
talents=1021012
artifact=4:0:0:0:0:72:3:73:1:74:3:75:3:77:3:78:1:79:3:80:1:81:3:82:3:83:3:84:3:86:1:87:1:290:1:1169:1:1339:1
spec=arcane

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/summon_arcane_familiar
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/arcane_blast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.arcane_power.down
actions+=/stop_burn_phase,if=prev_gcd.evocation&burn_phase_duration>gcd.max
actions+=/mark_of_aluneth,if=cooldown.arcane_power.remains>20
actions+=/call_action_list,name=build,if=buff.arcane_charge.stack<4
actions+=/call_action_list,name=init_burn,if=buff.arcane_power.down&buff.arcane_charge.stack=4&(cooldown.mark_of_aluneth.remains=0|cooldown.mark_of_aluneth.remains>20)&(!talent.rune_of_power.enabled|(cooldown.arcane_power.remains<=action.rune_of_power.cast_time|action.rune_of_power.recharge_time<cooldown.arcane_power.remains))|target.time_to_die<45
actions+=/call_action_list,name=burn,if=burn_phase
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&!burn_phase
actions+=/call_action_list,name=conserve

actions.build=charged_up,if=buff.arcane_charge.stack<=1
actions.build+=/arcane_missiles,if=buff.arcane_missiles.react=3
actions.build+=/arcane_orb
actions.build+=/arcane_explosion,if=active_enemies>1
actions.build+=/arcane_blast

actions.burn=call_action_list,name=cooldowns
actions.burn+=/arcane_missiles,if=buff.arcane_missiles.react=3
actions.burn+=/arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
actions.burn+=/presence_of_mind,if=buff.arcane_power.remains>2*gcd
actions.burn+=/nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
actions.burn+=/arcane_blast,if=active_enemies<=1&mana.pct%10*execute_time>target.time_to_die
actions.burn+=/arcane_explosion,if=active_enemies>1&mana.pct%10*execute_time>target.time_to_die
actions.burn+=/arcane_missiles,if=buff.arcane_missiles.react>1
actions.burn+=/arcane_explosion,if=active_enemies>1&buff.arcane_power.remains>cast_time
actions.burn+=/arcane_blast,if=buff.presence_of_mind.up|buff.arcane_power.remains>cast_time
actions.burn+=/supernova,if=mana.pct<100
actions.burn+=/arcane_missiles,if=mana.pct>10&(talent.overpowered.enabled|buff.arcane_power.down)
actions.burn+=/arcane_explosion,if=active_enemies>1
actions.burn+=/arcane_blast
actions.burn+=/evocation,interrupt_if=mana.pct>99

actions.conserve=arcane_missiles,if=buff.arcane_missiles.react=3
actions.conserve+=/arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
actions.conserve+=/arcane_blast,if=mana.pct>99
actions.conserve+=/nether_tempest,if=(refreshable|!ticking)
actions.conserve+=/arcane_blast,if=buff.rhonins_assaulting_armwraps.up&equipped.132413
actions.conserve+=/arcane_missiles
actions.conserve+=/supernova,if=mana.pct<100
actions.conserve+=/frost_nova,if=equipped.132452
actions.conserve+=/arcane_explosion,if=mana.pct>=82&equipped.132451&active_enemies>1
actions.conserve+=/arcane_blast,if=mana.pct>=82&equipped.132451
actions.conserve+=/arcane_barrage,if=mana.pct<100&cooldown.arcane_power.remains>5
actions.conserve+=/arcane_explosion,if=active_enemies>1
actions.conserve+=/arcane_blast

actions.cooldowns=rune_of_power,if=mana.pct>45&buff.arcane_power.down
actions.cooldowns+=/arcane_power
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=deadly_grace,if=buff.arcane_power.up&(buff.berserking.up|buff.blood_fury.up)

actions.init_burn=mark_of_aluneth
actions.init_burn+=/frost_nova,if=equipped.132452
actions.init_burn+=/nether_tempest,if=dot.nether_tempest.remains<10&(prev_gcd.mark_of_aluneth|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<gcd.max))
actions.init_burn+=/rune_of_power
actions.init_burn+=/start_burn_phase,if=((cooldown.evocation.remains-(2*burn_phase_duration))%2<burn_phase_duration)|cooldown.arcane_power.remains=0|target.time_to_die<55

actions.rop_phase=arcane_missiles,if=buff.arcane_missiles.react=3
actions.rop_phase+=/arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
actions.rop_phase+=/nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
actions.rop_phase+=/arcane_missiles,if=buff.arcane_charge.stack=4
actions.rop_phase+=/arcane_explosion,if=active_enemies>1
actions.rop_phase+=/arcane_blast,if=mana.pct>45
actions.rop_phase+=/arcane_barrage

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=pendant_of_liquid_horror,id=141696,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=ancient_dreamwoven_mantle,id=139191,bonus_id=1806
back=mantle_of_the_victorious_dead,id=142540,bonus_id=1502/3467,enchant=binding_of_intellect
chest=robes_of_celestial_adornment,id=142410,bonus_id=1502/3467
wrists=helhound_hair_bracers,id=142415,bonus_id=1502/3467
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=cinch_of_light,id=142411,bonus_id=1502/3467
legs=mystic_kilt_of_the_rune_master,id=132451
feet=treads_of_the_drowned,id=142414,bonus_id=1502/3467
finger1=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_mastery
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=binding_of_mastery
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=aluneth,id=127857,gem_id=137380/137272/137380,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=882.73
# gear_stamina=26343
# gear_intellect=28421
# gear_crit_rating=6085
# gear_haste_rating=6465
# gear_mastery_rating=4591
# gear_versatility_rating=2564
# gear_armor=1824

Mage_Fire_T19M : 433806 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
433806.2 433806.2 416.9 / 0.096% 71814.0 / 16.6% 24.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
17454.8 17454.8 Mana 0.00% 49.6 100.0% 100%
Talents
  • 15: Pyromaniac (Fire Mage)
  • 45: Rune of Power
  • 60: Flame On (Fire Mage)
  • 90: Unstable Magic
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mage_Fire_T19M 433806
Blast Furnace (blast_furance) 4589 1.1% 36.4 8.33sec 37884 0 Periodic 222.8 3043 7892 6185 64.8% 73.0%

Stats details: blast_furance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.37 0.00 222.78 222.78 0.0000 0.9850 1377916.50 1377916.50 0.00 6279.44 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.4 35.20% 3042.72 3 4198 3043.42 2818 3416 238612 238612 0.00
crit 144.4 64.80% 7891.95 6 10810 7897.61 7369 8688 1139305 1139305 0.00
 
 

Action details: blast_furance

Static Values
  • id:194522
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:194522
  • name:Blast Furnace
  • school:fire
  • tooltip:Deals {$s1=1} Fire damage every $t1 sec.
  • description:Deals {$s1=1} Fire damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Deadly Grace 21781 4.9% 29.9 3.72sec 215112 0 Direct 29.9 94317 256679 215112 74.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.95 29.95 0.00 0.00 0.0000 0.0000 6441728.61 6441728.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.67 25.60% 94317.02 82172 123258 94387.68 82172 123258 723114 723114 0.00
crit 22.28 74.40% 256678.99 164343 308144 256830.12 218371 296366 5718615 5718615 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Fire Blast 26406 6.1% 36.4 8.33sec 217948 0 Direct 36.4 0 217948 217948 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.37 36.37 0.00 0.00 0.0000 0.0000 7927158.95 7927158.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.37 100.00% 217947.98 142921 267977 217973.52 203778 233972 7927159 7927159 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum ${{$231567s1=1}+1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 36394 8.4% 75.6 3.68sec 144865 92369 Direct 75.5 79202 175930 145071 68.1%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.57 75.46 0.00 0.00 1.5683 0.0000 10947462.33 10947462.33 0.00 92368.84 92368.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.07 31.90% 79202.20 76234 114352 79191.87 76234 89688 1906622 1906622 0.00
crit 51.39 68.10% 175930.20 157043 294455 175942.53 164320 192036 9040841 9040841 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 87980 20.3% 224.1 1.35sec 117930 0 Periodic 299.5 88257 0 88257 0.0% 99.6%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.14 0.00 299.50 299.50 0.0000 1.0000 26432503.88 26432503.88 0.00 88256.62 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 299.5 100.00% 88256.52 2462 372498 88359.20 74954 104213 26432504 26432504 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Maddening Whispers 20809 4.8% 2.3 160.15sec 2737954 0 Direct 2.3 730373 2738422 2737955 100.0%  

Stats details: maddening_whispers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 2.29 0.00 0.00 0.0000 0.0000 6272577.03 6272577.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.02% 730373.40 730373 730373 389.58 0 730373 390 390 0.00
crit 2.29 99.98% 2738421.96 1825933 2738900 2738514.70 2282417 2738900 6272187 6272187 0.00
 
 

Action details: maddening_whispers

Static Values
  • id:222050
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222050
  • name:Maddening Whispers
  • school:shadow
  • tooltip:Deals {$222046s1=36653} Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70372.42
  • base_dd_max:70372.42
 
Mark of the Hidden Satyr 11192 2.6% 17.2 17.33sec 195940 0 Direct 17.2 97496 249520 195935 64.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.16 17.16 0.00 0.00 0.0000 0.0000 3362210.01 3362210.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.05 35.24% 97496.29 90176 135264 97363.05 0 135264 589630 589630 0.00
crit 11.11 64.76% 249520.07 185762 348304 249445.26 185762 341338 2772580 2772580 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Phoenix Reborn 3579 0.8% 24.9 11.73sec 43139 0 Direct 24.9 21653 55069 43139 64.3%  

Stats details: phoenix_reborn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.94 24.94 0.00 0.00 0.0000 0.0000 1075808.61 1075808.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.90 35.70% 21652.66 19982 29974 21651.85 0 29974 192766 192766 0.00
crit 16.04 64.30% 55069.29 41164 77182 55136.93 42536 71580 883042 883042 0.00
 
 

Action details: phoenix_reborn

Static Values
  • id:215773
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215773
  • name:Phoenix Reborn
  • school:fire
  • tooltip:
  • description:Targets affected by your Ignite have a chance to erupt in flame, taking $215775m1 additional Fire damage and reducing the remaining cooldown on Phoenix's Flame by {$s1=10} sec.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 19721 4.5% 13.6 22.88sec 433686 361168 Direct 13.6 0 435234 435234 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.64 13.59 0.00 0.00 1.2008 0.0000 5914119.59 5914119.59 0.00 361167.61 361167.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 13.59 100.00% 435233.93 246986 463098 435446.63 404439 463098 5914120 5914120 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Plague Swarm 19060 4.4% 13.7 21.53sec 419357 0 Periodic 60.2 48534 120957 95195 64.4% 39.5%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.66 0.00 60.18 60.18 0.0000 1.9738 5728283.41 5728283.41 0.00 48227.62 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.4 35.57% 48534.45 68 68034 48544.66 41031 59312 1039002 1039002 0.00
crit 38.8 64.43% 120957.12 57 170086 120899.39 95857 146535 4689281 4689281 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Pyroblast 174128 40.1% 97.3 3.08sec 537517 340963 Direct 98.0 272393 622380 533308 74.5%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.28 98.05 0.00 0.00 1.5765 0.0000 52288774.22 52288774.22 0.00 340963.34 340963.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.95 25.45% 272392.53 159286 955713 272320.30 166871 432347 6797240 6797240 0.00
crit 73.09 74.55% 622379.98 328128 2460962 622043.52 502267 754847 45491535 45491535 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.760000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 191 0.0% 0.7 142.90sec 76551 72243 Direct 0.7 0 76551 76551 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.74 0.74 0.00 0.00 1.0607 0.0000 56349.41 56349.41 0.00 72242.83 72242.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.74 100.00% 76551.49 41166 77187 41993.26 0 77187 56349 56349 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
sorcerous_arcane_blast 1074 0.3% 0.4 318.58sec 737060 0 Direct 0.4 671842 1412008 737041 8.8%  

Stats details: sorcerous_arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.45 0.45 0.00 0.00 0.0000 0.0000 329067.51 329067.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.41 91.19% 671842.43 671842 671842 250585.85 0 671842 273521 273521 0.00
crit 0.04 8.81% 1412007.83 1343685 1679606 55170.10 0 1679606 55546 55546 0.00
 
 

Action details: sorcerous_arcane_blast

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:431550.00
  • base_dd_max:431550.00
 
sorcerous_fireball 1311 0.3% 0.5 318.36sec 864820 0 Direct 0.5 383910 805646 425185 9.8%  
Periodic 3.7 54554 0 54554 0.0% 0.8%

Stats details: sorcerous_fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.46 0.46 3.73 3.73 0.0000 0.6093 400638.15 400638.15 0.00 176182.13 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.42 90.21% 383909.96 383910 383910 147082.72 0 383910 160445 160445 0.00
crit 0.05 9.79% 805646.35 767820 959775 36102.59 0 959775 36528 36528 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.7 100.00% 54553.93 26673 57586 22805.09 0 57586 203666 203666 0.00
 
 

Action details: sorcerous_fireball

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:246600.00
  • base_dd_max:246600.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:36990.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
sorcerous_frostbolt 1050 0.2% 0.5 319.14sec 702959 0 Direct 0.5 633451 1320540 702939 10.1%  

Stats details: sorcerous_frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.46 0.46 0.00 0.00 0.0000 0.0000 322466.96 322466.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.41 89.88% 633451.44 633451 633451 240236.82 0 633451 261186 261186 0.00
crit 0.05 10.12% 1320539.95 1055752 1583629 60183.10 0 1583629 61281 61281 0.00
 
 

Action details: sorcerous_frostbolt

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:406890.00
  • base_dd_max:406890.00
 
Unstable Magic (_explosion) 4542 1.0% 18.8 14.29sec 72557 0 Direct 18.8 72556 0 72556 0.0%  

Stats details: unstable_magic_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.83 18.83 0.00 0.00 0.0000 0.0000 1366226.76 1366226.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.83 100.00% 72555.92 38117 147228 72636.06 46842 95992 1366227 1366227 0.00
 
 

Action details: unstable_magic_explosion

Static Values
  • id:157976
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157976
  • name:Unstable Magic
  • school:none
  • tooltip:
  • description:{$?s137021=false}[Arcane Blast]?s137019[Fireball][Frostbolt] has a {$?s137020=false}[{$s2=20}%]?s137021[{$s1=15}%][{$s3=25}%] chance to explode on impact, dealing {$s4=50}% additional damage to the target and all other enemies within $157977A1 yds.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:78521.41
  • base_dd_max:78521.41
 
Simple Action Stats Execute Interval
Mage_Fire_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Fire_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 238.39sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Combustion 4.3 79.59sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
 
Flame On 4.6 76.35sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Fire_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Fire_T19M
  • harmful:false
  • if_expr:
 
Phoenix's Flames (_splash) 13.6 22.91sec

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.7 37.76sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.72 0.00 0.00 0.00 1.2866 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 238.4sec 238.4sec 6.51% 22.47% 0.0(0.0) 1.9

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 34.07% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.3 0.0 79.6sec 79.6sec 14.19% 90.70% 85.1(85.1) 4.2

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 19.0 5.1 14.4sec 11.3sec 28.53% 30.16% 0.0(0.0) 0.9

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:24.14%
  • enhanced_pyrotechnics_2:3.93%
  • enhanced_pyrotechnics_3:0.45%
  • enhanced_pyrotechnics_4:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 86.7 0.0 3.5sec 3.5sec 40.21% 47.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:40.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 77.9 0.0 3.9sec 3.9sec 23.32% 86.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:23.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Kael'thas's Ultimate Ability (kaelthas_ultimate_ability) 13.1 3.8 22.8sec 17.4sec 32.07% 32.07% 3.8(3.8) 0.1

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_kaelthas_ultimate_ability
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • kaelthas_ultimate_ability_1:32.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209455
  • name:Kael'thas's Ultimate Ability
  • tooltip:Increases the damage of your next non-instant Pyroblast by {$s1=300}%.
  • description:{$@spelldesc209450=After consuming Hot Streak, there is a {$s1=20}% chance that your next non-instant Pyroblast cast within {$209455d=15 seconds} deals {$209455s1=300}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maddening Whispers 2.4 0.0 158.5sec 158.5sec 4.96% 4.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.78%
  • maddening_whispers_2:0.59%
  • maddening_whispers_3:0.47%
  • maddening_whispers_4:0.45%
  • maddening_whispers_5:0.47%
  • maddening_whispers_6:0.45%
  • maddening_whispers_7:0.47%
  • maddening_whispers_8:0.45%
  • maddening_whispers_9:0.50%
  • maddening_whispers_10:0.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222046
  • name:Maddening Whispers
  • tooltip:Your damaging spells transfer a Maddening Whisper to the target. When all Whispers have been applied, each deals $s~1 Shadow damage.
  • description:Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.
  • max_stacks:10
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 77.4sec 0.0sec 19.61% 19.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 36.9 138.3 8.1sec 1.7sec 73.33% 100.00% 63.0(63.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:19.38%
  • pyretic_incantation_2:10.84%
  • pyretic_incantation_3:4.64%
  • pyretic_incantation_4:8.07%
  • pyretic_incantation_5:30.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.7 0.0 37.7sec 37.7sec 28.33% 28.33% 0.0(0.0) 7.9

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=10}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Fire_T19M
combustion Mana 4.3 476383.1 110000.0 109997.8 0.0
fire_blast Mana 36.4 400094.4 11000.0 11000.1 19.8
fireball Mana 75.6 1662523.7 22000.0 21999.8 6.6
pyroblast Mana 98.3 2702658.6 27500.0 27782.7 19.3
scorch Mana 0.7 8094.9 11000.0 10997.1 7.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 391.96 4951397.87 (100.00%) 12632.30 342.57 0.01%
Resource RPS-Gain RPS-Loss
Mana 16462.73 17454.78
Combat End Resource Mean Min Max
Mana 801823.22 446407.50 1085304.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.0%

Procs

Count Interval
Heating Up generated 86.7 3.5sec
Heating Up removed 8.3 30.2sec
IB conversions of HU 33.9 8.9sec
Total Hot Streak procs 77.9 3.9sec
Hot Streak spells used 224.2 1.3sec
Hot Streak spell crits 175.2 1.7sec
Wasted Hot Streak spell crits 10.6 25.3sec
Direct Ignite applications 1.0 0.0sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Mage_Fire_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Mage_Fire_T19M Damage Per Second
Count 7499
Mean 433806.25
Minimum 366197.69
Maximum 504663.20
Spread ( max - min ) 138465.51
Range [ ( max - min ) / 2 * 100% ] 15.96%
Standard Deviation 18419.0423
5th Percentile 404694.30
95th Percentile 465228.45
( 95th Percentile - 5th Percentile ) 60534.15
Mean Distribution
Standard Deviation 212.6990
95.00% Confidence Intervall ( 433389.37 - 434223.13 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 69
0.1% Error 6925
0.1 Scale Factor Error with Delta=300 2896128
0.05 Scale Factor Error with Delta=300 11584512
0.01 Scale Factor Error with Delta=300 289612804
Priority Target DPS
Sample Data Mage_Fire_T19M Priority Target Damage Per Second
Count 7499
Mean 433806.25
Minimum 366197.69
Maximum 504663.20
Spread ( max - min ) 138465.51
Range [ ( max - min ) / 2 * 100% ] 15.96%
Standard Deviation 18419.0423
5th Percentile 404694.30
95th Percentile 465228.45
( 95th Percentile - 5th Percentile ) 60534.15
Mean Distribution
Standard Deviation 212.6990
95.00% Confidence Intervall ( 433389.37 - 434223.13 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 69
0.1% Error 6925
0.1 Scale Factor Error with Delta=300 2896128
0.05 Scale Factor Error with Delta=300 11584512
0.01 Scale Factor Error with Delta=300 289612804
DPS(e)
Sample Data Mage_Fire_T19M Damage Per Second (Effective)
Count 7499
Mean 433806.25
Minimum 366197.69
Maximum 504663.20
Spread ( max - min ) 138465.51
Range [ ( max - min ) / 2 * 100% ] 15.96%
Damage
Sample Data Mage_Fire_T19M Damage
Count 7499
Mean 130243291.92
Minimum 92443321.06
Maximum 171669918.15
Spread ( max - min ) 79226597.09
Range [ ( max - min ) / 2 * 100% ] 30.41%
DTPS
Sample Data Mage_Fire_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mage_Fire_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mage_Fire_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mage_Fire_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mage_Fire_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mage_Fire_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Mage_Fire_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mage_Fire_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.combustion.down
7 4.61 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
8 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
9 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
A 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
B 4.59 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
0.00 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
C 4.17 rune_of_power,if=buff.combustion.down
D 0.00 call_action_list,name=active_talents
E 4.33 combustion
F 1.00 potion,name=deadly_grace
0.00 blood_fury
G 1.97 berserking
0.00 arcane_torrent
H 1.37 use_item,slot=neck
I 2.37 use_item,slot=trinket2
J 28.90 pyroblast,if=buff.hot_streak.up
K 17.55 fire_blast,if=buff.heating_up.up
L 8.68 phoenixs_flames
M 0.77 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase
# count action,conditions
0.00 rune_of_power
N 13.84 pyroblast,if=buff.hot_streak.up
O 0.00 call_action_list,name=active_talents
P 3.23 pyroblast,if=buff.kaelthas_ultimate_ability.react
Q 6.99 fire_blast,if=!prev_off_gcd.fire_blast
R 4.95 phoenixs_flames,if=!prev_gcd.phoenixs_flames
0.00 scorch,if=target.health.pct<=25&equipped.132454
S 7.55 fireball
actions.single_target
# count action,conditions
0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
0.00 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
T 38.07 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
U 13.41 pyroblast,if=buff.kaelthas_ultimate_ability.react
V 0.00 call_action_list,name=active_talents
W 0.01 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
X 11.83 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
Y 0.01 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
Z 68.27 fireball

Sample Sequence

01256CEGHILKJJKBJJKJKJLJJLJ7PQNSSSSQSTUUZZZZXTZZTUUXZTUZZXTUUXZTZZTZZTZTZZCEFLKJKBJKJKJJLJUZTZZTZTXZTUXZTU7PQNPQNZZTUXZTZTZTUZZZZTZTZCEIJKJKBJKJKJLJLTUZZZTZTXZTUZ7QNQRNRNSSSZTUUXZTZTUZZXTUUZZTZTCEGJKJKBJKJKJLJLJUZZZZXTZTZTZTXZ7NQRNRSSNNUZ7NQBRNQSQNP

Sample Sequence Table

time name target resources buffs
Pre flask Mage_Fire_T19M 1100000.0/1100000: 100% mana
Pre food Mage_Fire_T19M 1100000.0/1100000: 100% mana
Pre augmentation Mage_Fire_T19M 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:01.322 combustion Fluffy_Pillow 1094313.0/1100000: 99% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:01.322 berserking Fluffy_Pillow 984313.0/1100000: 89% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:01.322 use_item_sorcerous_shadowruby_pendant Fluffy_Pillow 984313.0/1100000: 89% mana bloodlust, berserking, combustion, rune_of_power, potion_of_deadly_grace
0:01.322 use_item_wriggling_sinew Fluffy_Pillow 984313.0/1100000: 89% mana bloodlust, berserking, combustion, rune_of_power, potion_of_deadly_grace
0:01.322 phoenixs_flames Fluffy_Pillow 984313.0/1100000: 89% mana bloodlust, berserking, combustion, rune_of_power, maddening_whispers(10), potion_of_deadly_grace
0:02.207 fire_blast Fluffy_Pillow 998915.5/1100000: 91% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation, rune_of_power, maddening_whispers(9), potion_of_deadly_grace
0:02.207 pyroblast Fluffy_Pillow 987915.5/1100000: 90% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(2), rune_of_power, maddening_whispers(8), potion_of_deadly_grace
0:03.092 pyroblast Fluffy_Pillow 975018.0/1100000: 89% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(3), rune_of_power, maddening_whispers(7), potion_of_deadly_grace
0:03.977 fire_blast Fluffy_Pillow 962120.5/1100000: 87% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(4), rune_of_power, maddening_whispers(6), potion_of_deadly_grace
0:03.977 flame_on Fluffy_Pillow 951120.5/1100000: 86% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(5), potion_of_deadly_grace
0:03.977 pyroblast Fluffy_Pillow 951120.5/1100000: 86% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(5), potion_of_deadly_grace
0:04.863 pyroblast Fluffy_Pillow 938239.5/1100000: 85% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(4), potion_of_deadly_grace
0:05.746 fire_blast Fluffy_Pillow 925309.0/1100000: 84% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(3), potion_of_deadly_grace
0:05.746 pyroblast Fluffy_Pillow 914309.0/1100000: 83% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(2), potion_of_deadly_grace
0:06.630 fire_blast Fluffy_Pillow 901395.0/1100000: 82% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers, potion_of_deadly_grace
0:06.630 pyroblast Fluffy_Pillow 890395.0/1100000: 81% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:07.516 phoenixs_flames Fluffy_Pillow 877514.0/1100000: 80% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:08.403 pyroblast Fluffy_Pillow 892149.5/1100000: 81% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:09.288 pyroblast Fluffy_Pillow 879252.0/1100000: 80% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:10.175 phoenixs_flames Fluffy_Pillow 866387.5/1100000: 79% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:11.060 pyroblast Fluffy_Pillow 880990.0/1100000: 80% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:12.038 rune_of_power Fluffy_Pillow 869627.0/1100000: 79% mana bloodlust, heating_up, pyretic_incantation(5), kaelthas_ultimate_ability, potion_of_deadly_grace
0:13.056 pyroblast Fluffy_Pillow 886424.0/1100000: 81% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:16.099 fire_blast Fluffy_Pillow 909133.5/1100000: 83% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:16.099 pyroblast Fluffy_Pillow 898133.5/1100000: 82% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:17.115 fireball Fluffy_Pillow 887397.5/1100000: 81% mana bloodlust, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:18.365 fireball Fluffy_Pillow 886022.5/1100000: 81% mana bloodlust, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:19.616 fireball Fluffy_Pillow 884664.0/1100000: 80% mana bloodlust, enhanced_pyrotechnics, rune_of_power, potion_of_deadly_grace
0:20.866 fireball Fluffy_Pillow 883289.0/1100000: 80% mana bloodlust, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:22.117 fire_blast Fluffy_Pillow 881930.5/1100000: 80% mana bloodlust, enhanced_pyrotechnics, rune_of_power, potion_of_deadly_grace
0:22.117 fireball Fluffy_Pillow 870930.5/1100000: 79% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:23.366 pyroblast Fluffy_Pillow 869539.0/1100000: 79% mana bloodlust, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
0:24.385 pyroblast Fluffy_Pillow 858852.5/1100000: 78% mana bloodlust, hot_streak, kaelthas_ultimate_ability, potion_of_deadly_grace
0:25.404 pyroblast Fluffy_Pillow 848166.0/1100000: 77% mana bloodlust, heating_up, pyretic_incantation, kaelthas_ultimate_ability, potion_of_deadly_grace
0:28.451 fireball Fluffy_Pillow 870941.5/1100000: 79% mana bloodlust, heating_up, pyretic_incantation
0:29.701 fireball Fluffy_Pillow 869566.5/1100000: 79% mana bloodlust
0:30.954 fireball Fluffy_Pillow 868241.0/1100000: 79% mana bloodlust, enhanced_pyrotechnics
0:32.205 fireball Fluffy_Pillow 866882.5/1100000: 79% mana bloodlust, enhanced_pyrotechnics(2)
0:33.457 fire_blast Fluffy_Pillow 865540.5/1100000: 79% mana bloodlust, heating_up, pyretic_incantation
0:33.457 pyroblast Fluffy_Pillow 854540.5/1100000: 78% mana bloodlust, hot_streak, pyretic_incantation(2)
0:34.474 fireball Fluffy_Pillow 843821.0/1100000: 77% mana bloodlust, heating_up
0:35.724 fireball Fluffy_Pillow 842446.0/1100000: 77% mana bloodlust, heating_up
0:36.977 pyroblast Fluffy_Pillow 841120.5/1100000: 76% mana bloodlust, hot_streak, pyretic_incantation
0:37.995 pyroblast Fluffy_Pillow 830417.5/1100000: 75% mana bloodlust, hot_streak, pyretic_incantation(3), kaelthas_ultimate_ability
0:39.014 pyroblast Fluffy_Pillow 819731.0/1100000: 75% mana bloodlust, heating_up, pyretic_incantation(4), kaelthas_ultimate_ability
0:42.060 fire_blast Fluffy_Pillow 842490.0/1100000: 77% mana heating_up, pyretic_incantation(4)
0:42.060 fireball Fluffy_Pillow 831490.0/1100000: 76% mana hot_streak, pyretic_incantation(5)
0:43.684 pyroblast Fluffy_Pillow 836286.0/1100000: 76% mana hot_streak, pyretic_incantation(5)
0:45.004 pyroblast Fluffy_Pillow 830566.0/1100000: 76% mana heating_up, kaelthas_ultimate_ability
0:48.961 fireball Fluffy_Pillow 868356.5/1100000: 79% mana heating_up
0:50.584 fireball Fluffy_Pillow 873136.0/1100000: 79% mana
0:52.208 fire_blast Fluffy_Pillow 877932.0/1100000: 80% mana heating_up, pyretic_incantation
0:52.208 pyroblast Fluffy_Pillow 866932.0/1100000: 79% mana hot_streak, pyretic_incantation(2)
0:53.530 pyroblast Fluffy_Pillow 861245.0/1100000: 78% mana hot_streak, pyretic_incantation(4), kaelthas_ultimate_ability
0:54.852 pyroblast Fluffy_Pillow 855558.0/1100000: 78% mana heating_up, pyretic_incantation(5), kaelthas_ultimate_ability
0:58.810 fire_blast Fluffy_Pillow 893365.0/1100000: 81% mana heating_up, pyretic_incantation(5)
0:58.810 fireball Fluffy_Pillow 882365.0/1100000: 80% mana hot_streak, pyretic_incantation(5)
1:00.435 pyroblast Fluffy_Pillow 887177.5/1100000: 81% mana hot_streak
1:01.756 fireball Fluffy_Pillow 881474.0/1100000: 80% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:03.380 fireball Fluffy_Pillow 886270.0/1100000: 81% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:05.004 pyroblast Fluffy_Pillow 891066.0/1100000: 81% mana hot_streak, pyretic_incantation(2)
1:06.326 fireball Fluffy_Pillow 885379.0/1100000: 80% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:07.951 fireball Fluffy_Pillow 890191.5/1100000: 81% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:09.574 pyroblast Fluffy_Pillow 894971.0/1100000: 81% mana hot_streak, pyretic_incantation(2)
1:10.896 fireball Fluffy_Pillow 889284.0/1100000: 81% mana hot_streak, pyretic_incantation(4)
1:12.521 pyroblast Fluffy_Pillow 894096.5/1100000: 81% mana hot_streak, pyretic_incantation(4)
1:13.842 fireball Fluffy_Pillow 888393.0/1100000: 81% mana enhanced_pyrotechnics
1:15.466 fireball Fluffy_Pillow 893189.0/1100000: 81% mana enhanced_pyrotechnics
1:17.091 rune_of_power Fluffy_Pillow 898001.5/1100000: 82% mana heating_up, pyretic_incantation
1:18.412 combustion Fluffy_Pillow 919798.0/1100000: 84% mana enhanced_pyrotechnics, rune_of_power
1:18.412 potion Fluffy_Pillow 809798.0/1100000: 74% mana combustion, enhanced_pyrotechnics, rune_of_power
1:18.412 phoenixs_flames Fluffy_Pillow 809798.0/1100000: 74% mana combustion, enhanced_pyrotechnics, rune_of_power, potion_of_deadly_grace
1:19.734 fire_blast Fluffy_Pillow 831611.0/1100000: 76% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
1:19.734 pyroblast Fluffy_Pillow 820611.0/1100000: 75% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
1:21.056 fire_blast Fluffy_Pillow 814924.0/1100000: 74% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
1:21.056 flame_on Fluffy_Pillow 803924.0/1100000: 73% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
1:21.056 pyroblast Fluffy_Pillow 803924.0/1100000: 73% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
1:22.376 fire_blast Fluffy_Pillow 798204.0/1100000: 73% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:22.376 pyroblast Fluffy_Pillow 787204.0/1100000: 72% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:23.697 fire_blast Fluffy_Pillow 781500.5/1100000: 71% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:23.697 pyroblast Fluffy_Pillow 770500.5/1100000: 70% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:25.018 pyroblast Fluffy_Pillow 764797.0/1100000: 70% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:26.338 phoenixs_flames Fluffy_Pillow 759077.0/1100000: 69% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
1:27.660 pyroblast Fluffy_Pillow 780890.0/1100000: 71% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
1:28.982 pyroblast Fluffy_Pillow 775203.0/1100000: 70% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5), kaelthas_ultimate_ability, potion_of_deadly_grace
1:32.939 fireball Fluffy_Pillow 812993.5/1100000: 74% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:34.565 pyroblast Fluffy_Pillow 817822.5/1100000: 74% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:35.886 fireball Fluffy_Pillow 812119.0/1100000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
1:37.508 fireball Fluffy_Pillow 816882.0/1100000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
1:39.131 pyroblast Fluffy_Pillow 821661.5/1100000: 75% mana hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:40.453 fireball Fluffy_Pillow 815974.5/1100000: 74% mana hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:42.076 pyroblast Fluffy_Pillow 820754.0/1100000: 75% mana hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:43.397 fire_blast Fluffy_Pillow 815050.5/1100000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
1:43.397 fireball Fluffy_Pillow 804050.5/1100000: 73% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:45.021 pyroblast Fluffy_Pillow 808846.5/1100000: 74% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:46.342 pyroblast Fluffy_Pillow 803143.0/1100000: 73% mana heating_up, kaelthas_ultimate_ability, potion_of_deadly_grace
1:50.298 fire_blast Fluffy_Pillow 840917.0/1100000: 76% mana heating_up
1:50.298 fireball Fluffy_Pillow 829917.0/1100000: 75% mana hot_streak, pyretic_incantation
1:51.924 pyroblast Fluffy_Pillow 834746.0/1100000: 76% mana hot_streak
1:53.246 pyroblast Fluffy_Pillow 829059.0/1100000: 75% mana hot_streak, pyretic_incantation(2), kaelthas_ultimate_ability
1:54.569 rune_of_power Fluffy_Pillow 823388.5/1100000: 75% mana heating_up, pyretic_incantation(3), kaelthas_ultimate_ability
1:55.892 pyroblast Fluffy_Pillow 845218.0/1100000: 77% mana heating_up, pyretic_incantation(3), rune_of_power, kaelthas_ultimate_ability
1:59.851 fire_blast Fluffy_Pillow 883041.5/1100000: 80% mana heating_up, pyretic_incantation(3), rune_of_power
1:59.851 pyroblast Fluffy_Pillow 872041.5/1100000: 79% mana hot_streak, pyretic_incantation(4), rune_of_power
2:01.172 pyroblast Fluffy_Pillow 866338.0/1100000: 79% mana heating_up, rune_of_power, kaelthas_ultimate_ability
2:05.129 fire_blast Fluffy_Pillow 904128.5/1100000: 82% mana heating_up, rune_of_power
2:05.129 pyroblast Fluffy_Pillow 893128.5/1100000: 81% mana hot_streak, pyretic_incantation, rune_of_power
2:06.448 fireball Fluffy_Pillow 887392.0/1100000: 81% mana heating_up, pyretic_incantation
2:08.072 fireball Fluffy_Pillow 892188.0/1100000: 81% mana heating_up, pyretic_incantation
2:09.697 pyroblast Fluffy_Pillow 897000.5/1100000: 82% mana hot_streak, pyretic_incantation(2)
2:11.020 pyroblast Fluffy_Pillow 891330.0/1100000: 81% mana heating_up, kaelthas_ultimate_ability
2:14.978 fire_blast Fluffy_Pillow 929137.0/1100000: 84% mana heating_up
2:15.092 fireball Fluffy_Pillow 920018.0/1100000: 84% mana hot_streak, pyretic_incantation
2:16.717 pyroblast Fluffy_Pillow 924830.5/1100000: 84% mana hot_streak
2:18.038 fireball Fluffy_Pillow 919127.0/1100000: 84% mana hot_streak, pyretic_incantation(2)
2:19.662 pyroblast Fluffy_Pillow 923923.0/1100000: 84% mana hot_streak, pyretic_incantation(2)
2:20.983 fireball Fluffy_Pillow 918219.5/1100000: 83% mana hot_streak, pyretic_incantation(4)
2:22.606 pyroblast Fluffy_Pillow 922999.0/1100000: 84% mana hot_streak, pyretic_incantation(4)
2:23.929 pyroblast Fluffy_Pillow 917328.5/1100000: 83% mana enhanced_pyrotechnics, kaelthas_ultimate_ability
2:27.886 fireball Fluffy_Pillow 955119.0/1100000: 87% mana enhanced_pyrotechnics
2:29.511 fireball Fluffy_Pillow 959931.5/1100000: 87% mana enhanced_pyrotechnics
2:31.136 fireball Fluffy_Pillow 964744.0/1100000: 88% mana enhanced_pyrotechnics(2)
2:32.759 fireball Fluffy_Pillow 969523.5/1100000: 88% mana heating_up, pyretic_incantation
2:34.384 pyroblast Fluffy_Pillow 974336.0/1100000: 89% mana hot_streak, pyretic_incantation(2)
2:35.707 fireball Fluffy_Pillow 968665.5/1100000: 88% mana hot_streak, pyretic_incantation(4)
2:37.332 pyroblast Fluffy_Pillow 973478.0/1100000: 88% mana hot_streak, pyretic_incantation(4)
2:38.654 fireball Fluffy_Pillow 967791.0/1100000: 88% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:40.279 rune_of_power Fluffy_Pillow 972603.5/1100000: 88% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:41.599 combustion Fluffy_Pillow 994383.5/1100000: 90% mana hot_streak, pyretic_incantation(2), rune_of_power
2:41.599 use_item_wriggling_sinew Fluffy_Pillow 884383.5/1100000: 80% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power
2:41.599 pyroblast Fluffy_Pillow 884383.5/1100000: 80% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power, maddening_whispers(10)
2:42.922 fire_blast Fluffy_Pillow 878713.0/1100000: 80% mana combustion, heating_up, pyretic_incantation(3), rune_of_power, maddening_whispers(9)
2:42.922 pyroblast Fluffy_Pillow 867713.0/1100000: 79% mana combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(8)
2:44.245 fire_blast Fluffy_Pillow 862042.5/1100000: 78% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(7)
2:44.245 flame_on Fluffy_Pillow 851042.5/1100000: 77% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(6)
2:44.245 pyroblast Fluffy_Pillow 851042.5/1100000: 77% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(6)
2:45.568 fire_blast Fluffy_Pillow 845372.0/1100000: 77% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(5)
2:45.568 pyroblast Fluffy_Pillow 834372.0/1100000: 76% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(4)
2:46.890 fire_blast Fluffy_Pillow 828685.0/1100000: 75% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(3)
2:46.890 pyroblast Fluffy_Pillow 817685.0/1100000: 74% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(2)
2:48.211 phoenixs_flames Fluffy_Pillow 811981.5/1100000: 74% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers
2:49.532 pyroblast Fluffy_Pillow 833778.0/1100000: 76% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
2:50.853 phoenixs_flames Fluffy_Pillow 828074.5/1100000: 75% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
2:52.175 pyroblast Fluffy_Pillow 849887.5/1100000: 77% mana hot_streak, pyretic_incantation(5), kaelthas_ultimate_ability
2:53.496 pyroblast Fluffy_Pillow 844184.0/1100000: 77% mana heating_up, pyretic_incantation(5), kaelthas_ultimate_ability
2:57.452 fireball Fluffy_Pillow 881958.0/1100000: 80% mana heating_up, pyretic_incantation(5)
2:59.077 fireball Fluffy_Pillow 886770.5/1100000: 81% mana
3:00.701 fireball Fluffy_Pillow 891566.5/1100000: 81% mana heating_up, pyretic_incantation
3:02.325 pyroblast Fluffy_Pillow 896362.5/1100000: 81% mana hot_streak, pyretic_incantation(2)
3:03.646 fireball Fluffy_Pillow 890659.0/1100000: 81% mana hot_streak, pyretic_incantation(4)
3:05.271 pyroblast Fluffy_Pillow 895471.5/1100000: 81% mana hot_streak, pyretic_incantation(4)
3:06.595 fire_blast Fluffy_Pillow 889817.5/1100000: 81% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:06.595 fireball Fluffy_Pillow 878817.5/1100000: 80% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:08.220 pyroblast Fluffy_Pillow 883630.0/1100000: 80% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:09.542 pyroblast Fluffy_Pillow 877943.0/1100000: 80% mana enhanced_pyrotechnics(2), kaelthas_ultimate_ability
3:13.500 fireball Fluffy_Pillow 915750.0/1100000: 83% mana enhanced_pyrotechnics(2)
3:15.124 rune_of_power Fluffy_Pillow 920546.0/1100000: 84% mana enhanced_pyrotechnics(2)
3:16.445 fire_blast Fluffy_Pillow 942342.5/1100000: 86% mana heating_up, pyretic_incantation, rune_of_power
3:16.445 pyroblast Fluffy_Pillow 931342.5/1100000: 85% mana hot_streak, pyretic_incantation(2), rune_of_power
3:17.768 fire_blast Fluffy_Pillow 925672.0/1100000: 84% mana rune_of_power
3:17.768 phoenixs_flames Fluffy_Pillow 914672.0/1100000: 83% mana heating_up, pyretic_incantation, rune_of_power
3:19.090 pyroblast Fluffy_Pillow 936485.0/1100000: 85% mana hot_streak, pyretic_incantation(2), rune_of_power
3:20.413 phoenixs_flames Fluffy_Pillow 930814.5/1100000: 85% mana heating_up, pyretic_incantation(3), rune_of_power
3:21.733 pyroblast Fluffy_Pillow 952594.5/1100000: 87% mana hot_streak, pyretic_incantation(4), rune_of_power
3:23.055 fireball Fluffy_Pillow 946907.5/1100000: 86% mana heating_up, pyretic_incantation(5), rune_of_power
3:24.680 fireball Fluffy_Pillow 951720.0/1100000: 87% mana heating_up, pyretic_incantation(5), rune_of_power
3:26.304 fireball Fluffy_Pillow 956516.0/1100000: 87% mana enhanced_pyrotechnics, rune_of_power
3:27.930 fireball Fluffy_Pillow 961345.0/1100000: 87% mana heating_up, pyretic_incantation
3:29.556 pyroblast Fluffy_Pillow 966174.0/1100000: 88% mana hot_streak, pyretic_incantation(2)
3:30.876 pyroblast Fluffy_Pillow 960454.0/1100000: 87% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation, kaelthas_ultimate_ability
3:32.198 pyroblast Fluffy_Pillow 954767.0/1100000: 87% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(2), kaelthas_ultimate_ability
3:36.155 fire_blast Fluffy_Pillow 992557.5/1100000: 90% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(2)
3:36.155 fireball Fluffy_Pillow 981557.5/1100000: 89% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(3)
3:37.780 pyroblast Fluffy_Pillow 986370.0/1100000: 90% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(4)
3:39.103 fireball Fluffy_Pillow 980699.5/1100000: 89% mana hot_streak, pyretic_incantation(5)
3:40.728 pyroblast Fluffy_Pillow 985512.0/1100000: 90% mana hot_streak, pyretic_incantation(5)
3:42.050 pyroblast Fluffy_Pillow 979825.0/1100000: 89% mana enhanced_pyrotechnics, kaelthas_ultimate_ability
3:46.008 fireball Fluffy_Pillow 1017632.0/1100000: 93% mana enhanced_pyrotechnics
3:47.634 fireball Fluffy_Pillow 1022461.0/1100000: 93% mana enhanced_pyrotechnics
3:49.260 fire_blast Fluffy_Pillow 1027290.0/1100000: 93% mana heating_up, pyretic_incantation
3:49.260 pyroblast Fluffy_Pillow 1016290.0/1100000: 92% mana hot_streak, pyretic_incantation(2)
3:50.582 pyroblast Fluffy_Pillow 1010603.0/1100000: 92% mana hot_streak, pyretic_incantation(4), kaelthas_ultimate_ability
3:51.905 pyroblast Fluffy_Pillow 1004932.5/1100000: 91% mana kaelthas_ultimate_ability
3:55.863 fireball Fluffy_Pillow 1042739.5/1100000: 95% mana
3:57.487 fireball Fluffy_Pillow 1047535.5/1100000: 95% mana heating_up, pyretic_incantation
3:59.110 pyroblast Fluffy_Pillow 1052315.0/1100000: 96% mana hot_streak, pyretic_incantation(2)
4:00.433 fireball Fluffy_Pillow 1046644.5/1100000: 95% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
4:02.058 pyroblast Fluffy_Pillow 1051457.0/1100000: 96% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
4:03.379 rune_of_power Fluffy_Pillow 1045753.5/1100000: 95% mana hot_streak, pyretic_incantation(3)
4:04.701 combustion Fluffy_Pillow 1067566.5/1100000: 97% mana hot_streak, pyretic_incantation(3), rune_of_power
4:04.701 berserking Fluffy_Pillow 957566.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(3), rune_of_power
4:04.701 pyroblast Fluffy_Pillow 957566.5/1100000: 87% mana berserking, combustion, hot_streak, pyretic_incantation(3), rune_of_power
4:05.851 fire_blast Fluffy_Pillow 949041.5/1100000: 86% mana berserking, combustion, heating_up, pyretic_incantation(4), rune_of_power, kaelthas_ultimate_ability
4:05.851 pyroblast Fluffy_Pillow 938041.5/1100000: 85% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:07.002 fire_blast Fluffy_Pillow 929533.0/1100000: 85% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:07.002 flame_on Fluffy_Pillow 918533.0/1100000: 84% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:07.002 pyroblast Fluffy_Pillow 918533.0/1100000: 84% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:08.153 fire_blast Fluffy_Pillow 910024.5/1100000: 83% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:08.153 pyroblast Fluffy_Pillow 899024.5/1100000: 82% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:09.305 fire_blast Fluffy_Pillow 890532.5/1100000: 81% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:09.305 pyroblast Fluffy_Pillow 879532.5/1100000: 80% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:10.456 phoenixs_flames Fluffy_Pillow 871024.0/1100000: 79% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:11.607 pyroblast Fluffy_Pillow 890015.5/1100000: 81% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:12.758 phoenixs_flames Fluffy_Pillow 881507.0/1100000: 80% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:13.909 pyroblast Fluffy_Pillow 900498.5/1100000: 82% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:15.113 pyroblast Fluffy_Pillow 892864.5/1100000: 81% mana heating_up, pyretic_incantation(5), kaelthas_ultimate_ability
4:19.070 fireball Fluffy_Pillow 930655.0/1100000: 85% mana heating_up, pyretic_incantation(5)
4:20.696 fireball Fluffy_Pillow 935484.0/1100000: 85% mana
4:22.319 fireball Fluffy_Pillow 940263.5/1100000: 85% mana heating_up, pyretic_incantation
4:23.943 fireball Fluffy_Pillow 945059.5/1100000: 86% mana enhanced_pyrotechnics
4:25.567 fire_blast Fluffy_Pillow 949855.5/1100000: 86% mana heating_up, pyretic_incantation
4:25.567 pyroblast Fluffy_Pillow 938855.5/1100000: 85% mana hot_streak, pyretic_incantation(2)
4:26.889 fireball Fluffy_Pillow 933168.5/1100000: 85% mana hot_streak, pyretic_incantation(4)
4:28.514 pyroblast Fluffy_Pillow 937981.0/1100000: 85% mana hot_streak, pyretic_incantation(4)
4:29.836 fireball Fluffy_Pillow 932294.0/1100000: 85% mana hot_streak, pyretic_incantation(5)
4:31.460 pyroblast Fluffy_Pillow 937090.0/1100000: 85% mana hot_streak, pyretic_incantation(5)
4:32.783 fireball Fluffy_Pillow 931419.5/1100000: 85% mana hot_streak, pyretic_incantation(5)
4:34.408 pyroblast Fluffy_Pillow 936232.0/1100000: 85% mana hot_streak, pyretic_incantation(5)
4:35.729 fire_blast Fluffy_Pillow 930528.5/1100000: 85% mana heating_up
4:35.729 fireball Fluffy_Pillow 919528.5/1100000: 84% mana hot_streak, pyretic_incantation
4:37.354 rune_of_power Fluffy_Pillow 924341.0/1100000: 84% mana hot_streak, pyretic_incantation
4:38.678 pyroblast Fluffy_Pillow 946187.0/1100000: 86% mana enhanced_pyrotechnics, hot_streak, rune_of_power
4:39.999 fire_blast Fluffy_Pillow 940483.5/1100000: 85% mana enhanced_pyrotechnics, rune_of_power
4:39.999 phoenixs_flames Fluffy_Pillow 929483.5/1100000: 84% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
4:41.320 pyroblast Fluffy_Pillow 951280.0/1100000: 86% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
4:42.640 phoenixs_flames Fluffy_Pillow 945560.0/1100000: 86% mana enhanced_pyrotechnics, rune_of_power
4:43.960 fireball Fluffy_Pillow 967340.0/1100000: 88% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
4:45.585 fireball Fluffy_Pillow 972152.5/1100000: 88% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
4:47.209 pyroblast Fluffy_Pillow 976948.5/1100000: 89% mana hot_streak, pyretic_incantation(2), rune_of_power
4:48.531 pyroblast Fluffy_Pillow 971261.5/1100000: 88% mana hot_streak, pyretic_incantation(4), rune_of_power, kaelthas_ultimate_ability
4:49.853 pyroblast Fluffy_Pillow 965574.5/1100000: 88% mana kaelthas_ultimate_ability
4:53.811 fireball Fluffy_Pillow 1003381.5/1100000: 91% mana
4:55.436 rune_of_power Fluffy_Pillow 1008194.0/1100000: 92% mana heating_up, pyretic_incantation
4:56.757 pyroblast Fluffy_Pillow 1029990.5/1100000: 94% mana hot_streak, pyretic_incantation(2), rune_of_power
4:58.076 fire_blast Fluffy_Pillow 1024254.0/1100000: 93% mana rune_of_power
4:58.076 flame_on Fluffy_Pillow 1013254.0/1100000: 92% mana heating_up, pyretic_incantation, rune_of_power
4:58.076 phoenixs_flames Fluffy_Pillow 1013254.0/1100000: 92% mana heating_up, pyretic_incantation, rune_of_power
4:59.532 pyroblast Fluffy_Pillow 1037278.0/1100000: 94% mana hot_streak, pyretic_incantation(2), rune_of_power
5:00.854 fire_blast Fluffy_Pillow 1031591.0/1100000: 94% mana rune_of_power
5:00.854 fireball Fluffy_Pillow 1020591.0/1100000: 93% mana heating_up, pyretic_incantation, rune_of_power
5:02.479 fire_blast Fluffy_Pillow 1025403.5/1100000: 93% mana heating_up, pyretic_incantation, rune_of_power
5:02.479 pyroblast Fluffy_Pillow 1014403.5/1100000: 92% mana hot_streak, pyretic_incantation(2), rune_of_power
5:03.802 pyroblast Fluffy_Pillow 1008733.0/1100000: 92% mana heating_up, rune_of_power, kaelthas_ultimate_ability

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4876 4551 0
Agility 6579 6254 0
Stamina 41665 41665 25791
Intellect 37385 35678 26656 (965)
Spirit 1 1 0
Health 2499900 2499900 0
Mana 1100000 1100000 0
Spell Power 37385 35678 0
Crit 38.15% 37.07% 11226
Haste 13.81% 13.81% 4488
Damage / Heal Versatility 3.79% 3.79% 1515
ManaReg per Second 16500 16500 0
Mastery 12.42% 12.42% 2995
Armor 1817 1817 1817
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Sorcerous Shadowruby Pendant of the Fireflash
ilevel: 850, stats: { +1094 Sta, +1101 Crit, +734 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Maddening Robe of Secrets
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +981 Mastery, +479 Crit }
Local Waist Pliable Spider Silk Cinch
ilevel: 880, stats: { 163 Armor, +1930 Sta, +1287 Int, +689 Mastery, +406 Crit }
Local Legs Leggings of the Lower Planes
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +1012 Crit, +448 Haste }
Local Feet Crimson Wool-Lined Slippers
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +689 Crit, +406 Mastery }
Local Wrists Marquee Bindings of the Sun King
ilevel: 895, stats: { 134 Armor, +1665 Sta, +1110 Int, +559 Crit, +310 Haste }
Local Hands Oiled Rigger's Handwraps
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Crit, +383 Vers }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Wriggling Sinew
ilevel: 880, stats: { +1043 Crit }
Local Back Windwhipped Sailcloth
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +569 Crit, +252 Vers }, enchant: { +200 Int }
Local Main Hand Felo'melorn
ilevel: 906, weapon: { 2776 - 5157, 2.6 }, stats: { +937 Int, +1405 Sta, +345 Haste, +345 Mastery, +11921 Int }
Local Off Hand Heart of the Phoenix
ilevel: 906, stats: { +1230 Int, +1844 Sta, +627 Haste, +278 Crit }

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Mage_Fire_T19M"
level=110
race=troll
role=spell
position=back
talents=1022021
artifact=54:133022:140813:133022:0:748:1:749:6:750:3:751:3:752:3:753:3:754:3:755:3:756:3:757:3:758:1:759:1:760:1:761:1:762:1:763:1:1340:1
spec=fire

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/use_item,slot=neck
actions.combustion_phase+=/use_item,slot=trinket2
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=sorcerous_shadowruby_pendant,id=130233,bonus_id=1758/689/601/669,gem_id=130219,enchant_id=5439
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=windwhipped_sailcloth,id=142412,bonus_id=1502,enchant=binding_of_intellect
chest=maddening_robe_of_secrets,id=139193,bonus_id=1806
wrists=marquee_bindings_of_the_sun_king,id=132406
hands=oiled_riggers_handwraps,id=142429,bonus_id=1502
waist=pliable_spider_silk_cinch,id=138217,bonus_id=1806
legs=leggings_of_the_lower_planes,id=142413,bonus_id=1502
feet=crimson_woollined_slippers,id=139195,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=binding_of_crit
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_crit
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=wriggling_sinew,id=139326,bonus_id=1806
main_hand=felomelorn,id=128820,ilevel=906
off_hand=heart_of_the_phoenix,id=133959,ilevel=906

# Gear Summary
# gear_ilvl=882.31
# gear_stamina=25791
# gear_intellect=26656
# gear_crit_rating=11226
# gear_haste_rating=4488
# gear_mastery_rating=2995
# gear_versatility_rating=1515
# gear_armor=1817

Mage_Frost_T19M : 466501 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
466501.5 466501.5 391.0 / 0.084% 68066.3 / 14.6% 25.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
16176.0 16176.0 Mana 0.00% 66.9 100.0% 100%
Talents
  • 15: Bone Chilling (Frost Mage)
  • 30: Shimmer
  • 45: Rune of Power
  • 60: Frozen Touch (Frost Mage)
  • 75: Ice Floes
  • 90: Frost Bomb (Frost Mage)
  • 100: Thermal Void (Frost Mage)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mage_Frost_T19M 466501
Blizzard 14146 3.0% 13.4 6.83sec 313038 351802 Periodic 106.8 26427 52181 39162 49.4% 15.8%

Stats details: blizzard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.36 0.00 106.82 106.82 0.8899 0.4439 4183283.15 4183283.15 0.00 70531.32 351802.47
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.0 50.55% 26426.54 1229 36382 26426.15 23382 29261 1427041 1427041 0.00
crit 52.8 49.45% 52181.16 2458 72764 52180.44 45216 59140 2756242 2756242 0.00
 
 

Action details: blizzard

Static Values
  • id:190356
  • school:frost
  • resource:mana
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.potion_of_deadly_grace.up&!prev_off_gcd.water_jet
Spelldata
  • id:190356
  • name:Blizzard
  • school:frost
  • tooltip:
  • description:Ice shards pelt the target area, dealing ${$190357m1*8} Frost damage over $10d and reducing movement speed by {$205708s1=50}% for {$205708d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: blizzard_shard

Static Values
  • id:190357
  • school:frost
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190357
  • name:Blizzard
  • school:frost
  • tooltip:
  • description:{$@spelldesc190356=Ice shards pelt the target area, dealing ${$190357m1*8} Frost damage over $10d and reducing movement speed by {$205708s1=50}% for {$205708d=15 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.495000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Deadly Grace 22892 4.8% 46.5 1.89sec 145651 0 Direct 46.5 110852 221346 145650 31.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.48 46.48 0.00 0.00 0.0000 0.0000 6770389.43 6770389.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.84 68.51% 110852.17 81867 147360 110852.87 94488 134262 3529951 3529951 0.00
crit 14.64 31.49% 221346.28 163734 294721 221449.68 163734 294721 3240439 3240439 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Ebonbolt 12454 2.7% 6.5 48.50sec 575107 344003 Direct 6.5 438269 876229 576561 31.6%  

Stats details: ebonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.51 6.49 0.00 0.00 1.6718 0.0000 3742069.23 3742069.23 0.00 344003.42 344003.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.44 68.42% 438269.30 346694 661492 438481.21 0 661492 1946206 1946206 0.00
crit 2.05 31.58% 876228.51 693388 1322985 797385.03 0 1322985 1795863 1795863 0.00
 
 

Action details: ebonbolt

Static Values
  • id:214634
  • school:shadowfrost
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
Spelldata
  • id:214634
  • name:Ebonbolt
  • school:shadowfrost
  • tooltip:
  • description:Deals {$228599s1=0} Shadowfrost damage and grants two charges of Fingers of Frost.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flurry (_bolt) 41842 9.0% 58.8 4.59sec 214687 0 Direct 58.8 126100 252441 214687 70.1%  

Stats details: flurry_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.81 58.81 0.00 0.00 0.0000 0.0000 12625700.39 12625700.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.57 29.88% 126100.14 101205 193099 125984.86 106590 163841 2216027 2216027 0.00
crit 41.24 70.12% 252441.07 202409 386197 252203.57 213910 297451 10409673 10409673 0.00
 
 

Action details: flurry_bolt

Static Values
  • id:228354
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228354
  • name:Flurry
  • school:frost
  • tooltip:Movement slowed by {$s2=70}%.
  • description:{$@spelldesc44614=Unleash a flurry of ice shards, striking the target {$s1=3} times for a total of ${{$228354s1=0 to 2}*$m1} Frost damage. Each shard reduces the target's movement speed by {$228354s2=70}% for {$228354d=1 second}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.523000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
Frost Bomb (_explosion) 37126 8.0% 103.6 2.86sec 107784 0 Direct 103.6 78201 154465 107784 38.8%  

Stats details: frost_bomb_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.61 103.61 0.00 0.00 0.0000 0.0000 11167103.51 11167103.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.42 61.21% 78200.73 60671 115761 78239.92 70689 89039 4959182 4959182 0.00
crit 40.19 38.79% 154464.86 121343 231522 154443.55 134676 176938 6207922 6207922 0.00
 
 

Action details: frost_bomb_explosion

Static Values
  • id:113092
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113092
  • name:Frost Bomb
  • school:frost
  • tooltip:Slowed by $113092s3%.
  • description:{$@spelldesc112948=Places a Frost Bomb on the target for {$d=12 seconds}. Limit 1 target. Your Ice Lances that benefit from Shatter will trigger the release of a wave of freezing ice, dealing {$113092s1=0} Frost damage to the target and {$113092s2=0} Frost damage to all other enemies within $113092A2 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.575000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Frostbolt 68023 (99782) 14.6% (21.5%) 119.0 2.45sec 252896 224705 Direct 119.5 110425 221017 171588 55.3%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.96 119.53 0.00 0.00 1.1255 0.0000 20509359.92 20509359.92 0.00 224704.61 224704.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.43 44.70% 110425.31 88985 169783 110393.99 98723 122110 5899463 5899463 0.00
crit 66.10 55.30% 221017.28 177970 339566 220871.77 202790 239565 14609897 14609897 0.00
 
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=1} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.100000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Icicle 31760 6.8% 142.1 2.11sec 67367 0 Direct 141.4 67736 0 67736 0.0%  

Stats details: icicle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 142.15 141.37 0.00 0.00 0.0000 0.0000 9576115.27 9576115.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 141.37 100.00% 67736.07 29292 223553 67700.83 56043 82002 9576115 9576115 0.00
 
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt, ${$m1}.1% of the damage done is stored as an Icicle for {$148012d=60 seconds}. Also increases the damage done by your Water Elemental by ${$m3}.1%. Casting Ice Lance causes any Icicles stored to begin launching at the target. Up to {$s2=5} Icicles can be stored. Excess Icicles will automatically be launched. }
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:60054.78
  • base_dd_max:60054.78
 
Frozen Orb 0 (5849) 0.0% (1.3%) 5.3 61.61sec 328923 373783

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 104.37 0.00 0.8801 0.5000 0.00 0.00 0.00 30834.77 373782.87
 
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches an orb of swirling ice up to {$s1=40} yards forward which deals up to ${20*$84721s2} Frost damage to all enemies it passes through. Grants 1 charge of Fingers of Frost when it first damages an enemy. Enemies damaged by the Frost Orb are slowed by {$205708s1=50}% for {$205708d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Frozen Orb (_bolt) 5849 1.3% 0.0 0.00sec 0 0 Periodic 104.4 12766 25540 16804 31.6% 0.0%

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 104.37 0.0000 0.0000 1753789.25 1753789.25 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.4 68.39% 12765.66 10132 19332 12797.54 11263 15549 911189 911189 0.00
crit 33.0 31.61% 25539.89 20264 38664 25599.52 21477 31472 842600 842600 0.00
 
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=1}%.
  • description:{$@spelldesc84714=Launches an orb of swirling ice up to {$s1=40} yards forward which deals up to ${20*$84721s2} Frost damage to all enemies it passes through. Grants 1 charge of Fingers of Frost when it first damages an enemy. Enemies damaged by the Frost Orb are slowed by {$205708s1=50}% for {$205708d=15 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.263000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Ice Lance 129733 27.8% 109.2 2.73sec 357581 409776 Direct 108.9 119274 411455 358489 81.9%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.15 108.88 0.00 0.00 0.8726 0.0000 39030780.24 39030780.24 0.00 409776.27 409776.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.74 18.13% 119273.65 35088 315047 118799.69 59618 189611 2353894 2353894 0.00
crit 89.14 81.87% 411455.03 84211 756112 411431.39 358170 480870 36676886 36676886 0.00
 
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=0&prev_gcd.flurry
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Quickly fling a shard of ice at the target, dealing {$228598s1=0} Frost damage{$?s56377=false}[, and ${{$228598s1=0}*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is tripled against frozen targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.893000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Maddening Whispers 12463 2.6% 2.8 121.33sec 1308538 0 Direct 2.8 996526 1989050 1308524 31.4%  

Stats details: maddening_whispers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.84 2.84 0.00 0.00 0.0000 0.0000 3715346.60 3715346.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.95 68.57% 996525.56 727664 1309795 959601.54 0 1309795 1939939 1939939 0.00
crit 0.89 31.43% 1989049.91 1455328 2619591 1302330.12 0 2619591 1775407 1775407 0.00
 
 

Action details: maddening_whispers

Static Values
  • id:222050
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222050
  • name:Maddening Whispers
  • school:shadow
  • tooltip:Deals {$222046s1=36653} Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70372.42
  • base_dd_max:70372.42
 
Mark of the Hidden Satyr 11988 2.6% 24.7 12.22sec 146107 0 Direct 24.7 111040 221953 146107 31.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.67 24.67 0.00 0.00 0.0000 0.0000 3604796.49 3604796.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.87 68.38% 111040.24 89706 161470 111093.68 89706 148912 1873483 1873483 0.00
crit 7.80 31.62% 221952.76 179412 322941 221962.53 0 322941 1731314 1731314 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Plague Swarm 20020 4.3% 20.0 15.02sec 301583 0 Periodic 86.3 53047 106118 69779 31.5% 56.4%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.97 0.00 86.32 86.32 0.0000 1.9639 6023495.52 6023495.52 0.00 35531.40 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.1 68.47% 53046.94 23 81338 53064.37 43566 60508 3135456 3135456 0.00
crit 27.2 31.53% 106118.06 45 162677 106156.80 86869 132049 2888039 2888039 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
sorcerous_arcane_blast 1276 0.3% 0.5 300.27sec 780068 0 Direct 0.5 709130 1411095 780081 10.1%  

Stats details: sorcerous_arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.50 0.50 0.00 0.00 0.0000 0.0000 386757.51 386757.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.45 89.89% 709129.60 446233 803220 286421.92 0 803220 316005 316005 0.00
crit 0.05 10.11% 1411094.73 892467 1606441 70204.86 0 1606441 70752 70752 0.00
 
 

Action details: sorcerous_arcane_blast

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:431550.00
  • base_dd_max:431550.00
 
sorcerous_fireball 1937 0.4% 0.5 300.25sec 1190471 0 Direct 0.5 402672 822865 442988 9.6%  
Periodic 6.2 59654 0 59654 0.0% 0.8%

Stats details: sorcerous_fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.49 0.49 6.18 6.18 0.0000 0.3945 587377.23 587377.23 0.00 240827.07 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.45 90.41% 402671.65 254991 458983 164004.60 0 458983 179616 179616 0.00
crit 0.05 9.59% 822865.33 509981 917966 38668.53 0 917966 38954 38954 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.2 100.00% 59654.20 1572 68847 26251.42 0 68847 368808 368808 0.00
 
 

Action details: sorcerous_fireball

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:246600.00
  • base_dd_max:246600.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:36990.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
sorcerous_frostbolt 1218 0.3% 0.5 300.24sec 738319 0 Direct 0.5 666311 1329316 738319 10.9%  

Stats details: sorcerous_frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.50 0.50 0.00 0.00 0.0000 0.0000 371670.26 371670.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.45 89.14% 666310.81 420734 757322 270554.29 0 757322 298991 298991 0.00
crit 0.05 10.86% 1329315.57 841469 1514644 71377.30 0 1514644 72679 72679 0.00
 
 

Action details: sorcerous_frostbolt

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:406890.00
  • base_dd_max:406890.00
 
pet - water_elemental 53774 / 53774
Water Jet 5635 1.2% 10.2 29.25sec 166883 58641 Periodic 40.4 31874 63705 41937 31.6% 7.7%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.16 0.00 40.43 40.43 2.8459 0.5717 1695538.58 1695538.58 0.00 58640.75 58640.75
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.6 68.38% 31873.72 27111 40667 31895.93 27111 38202 881231 881231 0.00
crit 12.8 31.62% 63705.32 54223 81334 63780.38 54223 81334 814308 814308 0.00
 
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking $w1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, {$?s198146=false}[slowing the target by $m2% and ][]dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.706000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Waterbolt 48139 10.3% 192.8 1.55sec 75095 54850 Direct 191.6 57476 114963 75544 31.4%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 192.78 191.63 0.00 0.00 1.3691 0.0000 14476669.39 14476669.39 0.00 54850.41 54850.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.41 68.57% 57475.94 49922 74883 57480.90 54571 60681 7552676 7552676 0.00
crit 60.23 31.43% 114963.18 99844 149766 114974.46 106437 125294 6923993 6923993 0.00
 
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals ${{$s1=0}*0.75} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Mage_Frost_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Frost_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.40sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Frost_T19M
  • harmful:false
  • if_expr:
 
Flurry 19.7 14.24sec

Stats details: flurry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.68 0.00 58.81 0.00 0.8697 0.2000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flurry

Static Values
  • id:44614
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react&buff.fingers_of_frost.react=0&prev_gcd.frostbolt
Spelldata
  • id:44614
  • name:Flurry
  • school:frost
  • tooltip:
  • description:Unleash a flurry of ice shards, striking the target {$s1=3} times for a total of ${{$228354s1=0 to 2}*$m1} Frost damage. Each shard reduces the target's movement speed by {$228354s2=70}% for {$228354d=1 second}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:0.60
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Frost_T19M
  • harmful:false
  • if_expr:
 
Frost Bomb 19.8 15.37sec

Stats details: frost_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.84 0.00 79.44 0.00 0.8873 2.9215 0.00 0.00 0.00 0.00 0.00
 
 

Action details: frost_bomb

Static Values
  • id:112948
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:13750.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.frost_bomb.remains<action.ice_lance.travel_time&buff.fingers_of_frost.react>0
Spelldata
  • id:112948
  • name:Frost Bomb
  • school:frost
  • tooltip:The Mage's Ice Lances that hit the target while frozen will cause the Frost Bomb to release a wave of freezing ice that deals {$113092s1=0} Frost damage to the target, {$113092s2=0} Frost damage to all other enemies within $113092A2 yards.
  • description:Places a Frost Bomb on the target for {$d=12 seconds}. Limit 1 target. Your Ice Lances that benefit from Shatter will trigger the release of a wave of freezing ice, dealing {$113092s1=0} Frost damage to the target and {$113092s2=0} Frost damage to all other enemies within $113092A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:6.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Frozen Touch 10.1 31.05sec

Stats details: frozen_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.12 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: frozen_touch

Static Values
  • id:205030
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
Spelldata
  • id:205030
  • name:Frozen Touch
  • school:frost
  • tooltip:
  • description:Immediately generates 2 charges of Fingers of Frost.
 
Icy Veins 2.7 137.28sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.icy_veins.down
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:Haste increased by $w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=20 seconds}, granting $m1% haste and preventing damage from delaying your spellcasts.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.9 35.98sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.94 0.00 0.00 0.00 0.8890 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.icy_veins.remains<cast_time|charges_fractional>1.9&cooldown.icy_veins.remains>10|buff.icy_veins.up|target.time_to_die.remains+5<charges_fractional*10
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 
Time Warp 2.5 259.84sec

Stats details: time_warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: time_warp

Static Values
  • id:80353
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:44000.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
Spelldata
  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by {$s1=30}%.
  • description:Warp the flow of time, increasing haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.
 
Summon Water Elemental (water_elemental) 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to follow and fight for you.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.1 0.0 180.4sec 180.4sec 6.83% 15.44% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 2.5 1.0 113.4sec 259.8sec 31.15% 34.43% 1.0(1.0) 2.2

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:31.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bone Chilling 1.5 388.0 158.8sec 0.8sec 99.49% 100.00% 371.3(371.3) 0.5

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_bone_chilling
  • max_stacks:12
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • bone_chilling_1:0.66%
  • bone_chilling_2:0.34%
  • bone_chilling_3:0.30%
  • bone_chilling_4:0.32%
  • bone_chilling_5:0.38%
  • bone_chilling_6:0.27%
  • bone_chilling_7:0.33%
  • bone_chilling_8:0.30%
  • bone_chilling_9:0.29%
  • bone_chilling_10:0.30%
  • bone_chilling_11:0.25%
  • bone_chilling_12:95.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205766
  • name:Bone Chilling
  • tooltip:Damage dealt by Frost spells increased by $w1%
  • description:{$@spelldesc205027=Whenever you attempt to chill a target, you gain Bone Chilling, increasing all Frost damage you deal by ${$m1/10}.1% for {$205766d=8 seconds}, stacking up to {$205766u=12} times.}
  • max_stacks:12
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Brain Freeze 20.4 7.3 14.2sec 10.3sec 27.67% 27.67% 7.3(7.3) 0.4

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_brain_freeze
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • brain_freeze_1:27.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190446
  • name:Brain Freeze
  • tooltip:Your next Flurry is instant cast$?a231584[,][ and] deals {$s2=50}% increased damage$?a231584[, and will cause Winter's Chill on the target][].
  • description:{$@spelldesc190447=Frostbolt has a $m1% chance to empower your next Flurry to be instant cast$?a231584[,][ and] deal {$190446s2=50}% increased damage$?a231584[, and apply Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen][].}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Chain Reaction 16.9 49.2 17.6sec 4.4sec 77.01% 76.49% 28.0(28.0) 16.1

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_chain_reaction
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • chain_reaction_1:19.99%
  • chain_reaction_2:14.67%
  • chain_reaction_3:42.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:195418
  • name:Chain Reaction
  • tooltip:Increases the damage of your Ice Lance by $m1%.
  • description:Increases the damage of your Ice Lance by $m1%.
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Chilled to the Core 2.7 0.0 137.3sec 137.3sec 17.27% 17.27% 0.0(0.0) 2.5

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_chilled_to_the_core
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chilled_to_the_core_1:17.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:195446
  • name:Chilled to the Core
  • tooltip:Increases Frost damage by {$s1=20}%.
  • description:Increases Frost damage by {$s1=20}%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Fingers of Frost 41.4 42.5 7.3sec 3.6sec 43.73% 87.00% 4.9(4.9) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_fingers_of_frost
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • fingers_of_frost_1:22.48%
  • fingers_of_frost_2:16.61%
  • fingers_of_frost_3:4.65%

Trigger Attempt Success

  • trigger_pct:21.86%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance deals damage as if the target were frozen.
  • description:{$@spelldesc112965=Frostbolt and Frozen Orb damage have a {$s1=12}% chance, and Blizzard damage has a {$s2=5}% chance, to grant a charge of Fingers of Frost. Fingers of Frost causes your next Ice Lance to deal damage as if the target were frozen. Maximum {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Icicle (s) 56.0 87.8 5.4sec 2.0sec 44.99% 44.99% 11.0(11.0) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_icicles
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • icicles_1:20.16%
  • icicles_2:9.87%
  • icicles_3:6.03%
  • icicles_4:3.53%
  • icicles_5:5.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:148012
  • name:Icicle
  • tooltip:Icicle storing $w1 damage.
  • description:$@spelldesc148011
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Veins 2.7 0.0 137.3sec 137.3sec 70.81% 70.81% 0.0(0.0) 2.1

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • icy_veins_1:70.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:Haste increased by $w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=20 seconds}, granting $m1% haste and preventing damage from delaying your spellcasts.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Maddening Whispers 3.0 0.0 120.6sec 120.6sec 12.53% 12.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:1.38%
  • maddening_whispers_2:1.16%
  • maddening_whispers_3:1.29%
  • maddening_whispers_4:1.27%
  • maddening_whispers_5:1.33%
  • maddening_whispers_6:1.17%
  • maddening_whispers_7:1.16%
  • maddening_whispers_8:0.97%
  • maddening_whispers_9:1.86%
  • maddening_whispers_10:0.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222046
  • name:Maddening Whispers
  • tooltip:Your damaging spells transfer a Maddening Whisper to the target. When all Whispers have been applied, each deals $s~1 Shadow damage.
  • description:Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.
  • max_stacks:10
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 58.3sec 0.0sec 19.61% 19.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 36.0sec 36.0sec 28.94% 28.94% 0.0(0.0) 8.4

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frost Armor

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Haste increased by $7302w1%. Movement speed of attackers is slowed.
  • description:Increases Haste by {$s1=8}% and causes enemies who strike you to have movement speed slowed by $205708s2% for {$205708d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Frost_T19M
blizzard Mana 13.4 367494.0 27500.0 27499.8 11.4
flurry Mana 19.7 216523.0 11000.0 11000.2 0.0
frost_bomb Mana 19.8 272752.6 13750.0 13750.0 0.0
frostbolt Mana 120.0 2639199.3 22000.0 22184.9 11.4
frozen_orb Mana 5.3 58650.0 11000.0 10999.8 29.9
ice_lance Mana 109.2 1200671.8 11000.0 11000.0 32.5
time_warp Mana 2.5 109868.0 44000.0 43997.7 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 986.76 4787723.24 (100.00%) 4851.97 168519.65 3.40%
Resource RPS-Gain RPS-Loss
Mana 15918.50 16176.01
Combat End Resource Mean Min Max
Mana 1022569.85 861723.50 1100000.00

Benefits & Uptimes

Benefits %
Fingers of Frost from Frostbolt 14.2%
Fingers of Frost from Water Jet 20.2%
Fingers of Frost from Blizzard 5.3%
Fingers of Frost from Frozen Touch 20.2%
Fingers of Frost from Frozen Orb Initial Impact 5.3%
Fingers of Frost from Frozen Orb Tick 12.3%
Fingers of Frost from Ebonbolt 13.0%
Fingers of Frost from Waterbolt 9.4%
Uptimes %
Mana Cap 1.8%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Mage_Frost_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Mage_Frost_T19M Damage Per Second
Count 7499
Mean 466501.49
Minimum 393497.00
Maximum 544901.61
Spread ( max - min ) 151404.61
Range [ ( max - min ) / 2 * 100% ] 16.23%
Standard Deviation 17276.6617
5th Percentile 437722.57
95th Percentile 495082.50
( 95th Percentile - 5th Percentile ) 57359.93
Mean Distribution
Standard Deviation 199.5070
95.00% Confidence Intervall ( 466110.46 - 466892.51 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5268
0.1 Scale Factor Error with Delta=300 2548022
0.05 Scale Factor Error with Delta=300 10192091
0.01 Scale Factor Error with Delta=300 254802291
Priority Target DPS
Sample Data Mage_Frost_T19M Priority Target Damage Per Second
Count 7499
Mean 466501.49
Minimum 393497.00
Maximum 544901.61
Spread ( max - min ) 151404.61
Range [ ( max - min ) / 2 * 100% ] 16.23%
Standard Deviation 17276.6617
5th Percentile 437722.57
95th Percentile 495082.50
( 95th Percentile - 5th Percentile ) 57359.93
Mean Distribution
Standard Deviation 199.5070
95.00% Confidence Intervall ( 466110.46 - 466892.51 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5268
0.1 Scale Factor Error with Delta=300 2548022
0.05 Scale Factor Error with Delta=300 10192091
0.01 Scale Factor Error with Delta=300 254802291
DPS(e)
Sample Data Mage_Frost_T19M Damage Per Second (Effective)
Count 7499
Mean 466501.49
Minimum 393497.00
Maximum 544901.61
Spread ( max - min ) 151404.61
Range [ ( max - min ) / 2 * 100% ] 16.23%
Damage
Sample Data Mage_Frost_T19M Damage
Count 7499
Mean 124048033.98
Minimum 91508719.07
Maximum 163891382.34
Spread ( max - min ) 72382663.27
Range [ ( max - min ) / 2 * 100% ] 29.18%
DTPS
Sample Data Mage_Frost_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mage_Frost_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mage_Frost_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mage_Frost_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mage_Frost_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mage_Frost_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Mage_Frost_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mage_Frost_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 mirror_image
6 0.00 potion,name=deadly_grace
7 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
8 15.44 ice_lance,if=buff.fingers_of_frost.react=0&prev_gcd.flurry
9 2.50 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
A 0.00 call_action_list,name=cooldowns
B 13.36 blizzard,if=buff.potion_of_deadly_grace.up&!prev_off_gcd.water_jet
0.00 ice_nova,if=debuff.winters_chill.up
C 10.18 frostbolt,if=prev_off_gcd.water_jet
D 10.18 water_jet,if=prev_gcd.frostbolt&buff.fingers_of_frost.stack<(2+artifact.icy_hand.enabled)&buff.brain_freeze.react=0
0.00 ray_of_frost,if=buff.icy_veins.up|(cooldown.icy_veins.remains>action.ray_of_frost.cooldown&buff.rune_of_power.down)
E 19.68 flurry,if=buff.brain_freeze.react&buff.fingers_of_frost.react=0&prev_gcd.frostbolt
0.00 glacial_spike
F 10.12 frozen_touch,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
G 19.90 frost_bomb,if=debuff.frost_bomb.remains<action.ice_lance.travel_time&buff.fingers_of_frost.react>0
H 93.71 ice_lance,if=buff.fingers_of_frost.react>0&cooldown.icy_veins.remains>10|buff.fingers_of_frost.react>2
I 5.33 frozen_orb
0.00 ice_nova
0.00 comet_storm
0.00 blizzard,if=talent.artic_gale.enabled
J 6.55 ebonbolt,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
K 109.23 frostbolt
actions.cooldowns
# count action,conditions
L 8.97 rune_of_power,if=cooldown.icy_veins.remains<cast_time|charges_fractional>1.9&cooldown.icy_veins.remains>10|buff.icy_veins.up|target.time_to_die.remains+5<charges_fractional*10
M 2.69 icy_veins,if=buff.icy_veins.down
0.00 mirror_image
N 1.49 use_item,slot=neck
O 3.00 use_item,slot=trinket2
0.00 blood_fury
P 2.06 berserking
0.00 arcane_torrent
Q 1.00 potion,name=deadly_grace

Sample Sequence

0123679LMNOPBFIGHHBHJHHBHHLKBHKGHHBKEHHKBKDCKHBGHKE8FKHHKKHKKKH9KLKKGHKE8KKKDCKHHHJKGHHQBHKKEBFHHHIKBGHKHKBHKHKBHKE8LBKDCKGHBHHKHKFKHHKKGHJKHHKKKKDCEGHHKKKHOHKE8FIGHHKHKKLMHHHGHKDCKEHHJKHHKKKKFKGHHLKKKKHHKE8KDCKGHHKKKKPEHKKHKE8FIGHHHKKJKHHHKLGHKDCKHHKE8KKEGFHHHKKE8KKKDCGHHHKE8KOJKGHFHHHIKHHKE8KDCGHHHKE8KKE8LMKFKGHHKKE8KLKE8JKDCGHHHHK9NE8HKK

Sample Sequence Table

time name target resources buffs
Pre flask Mage_Frost_T19M 1100000.0/1100000: 100% mana
Pre food Mage_Frost_T19M 1100000.0/1100000: 100% mana
Pre augmentation Mage_Frost_T19M 1100000.0/1100000: 100% mana
Pre water_elemental Fluffy_Pillow 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 frostbolt Fluffy_Pillow 1078000.0/1100000: 98% mana icicles, potion_of_deadly_grace
0:00.000 time_warp Fluffy_Pillow 1078000.0/1100000: 98% mana icicles, potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1034000.0/1100000: 94% mana bloodlust, icicles, potion_of_deadly_grace
0:00.858 icy_veins Fluffy_Pillow 1048157.0/1100000: 95% mana bloodlust, icicles, rune_of_power, potion_of_deadly_grace
0:00.858 use_item_sorcerous_shadowruby_pendant Fluffy_Pillow 1048157.0/1100000: 95% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:00.858 use_item_wriggling_sinew Fluffy_Pillow 1048157.0/1100000: 95% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:00.858 berserking Fluffy_Pillow 1048157.0/1100000: 95% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(10), potion_of_deadly_grace
0:00.858 blizzard Fluffy_Pillow 1048157.0/1100000: 95% mana bloodlust, berserking, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(10), potion_of_deadly_grace
0:01.623 frozen_touch Fluffy_Pillow 1033279.5/1100000: 94% mana bloodlust, berserking, bone_chilling, icicles, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:01.623 frozen_orb Fluffy_Pillow 1033279.5/1100000: 94% mana bloodlust, berserking, bone_chilling, fingers_of_frost(2), icicles, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:02.378 frost_bomb Fluffy_Pillow 1034737.0/1100000: 94% mana bloodlust, berserking, bone_chilling(2), fingers_of_frost(3), icicles, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:03.132 ice_lance Fluffy_Pillow 1033428.0/1100000: 94% mana bloodlust, berserking, bone_chilling(4), fingers_of_frost(3), icicles, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:03.887 ice_lance Fluffy_Pillow 1034885.5/1100000: 94% mana bloodlust, berserking, bone_chilling(7), fingers_of_frost(2), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:04.640 blizzard Fluffy_Pillow 1036310.0/1100000: 94% mana bloodlust, berserking, bone_chilling(11), fingers_of_frost, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, maddening_whispers(8), potion_of_deadly_grace
0:05.434 ice_lance Fluffy_Pillow 1021911.0/1100000: 93% mana bloodlust, berserking, bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, maddening_whispers(7), potion_of_deadly_grace
0:06.189 ebonbolt Fluffy_Pillow 1023368.5/1100000: 93% mana bloodlust, berserking, bone_chilling(12), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, maddening_whispers(7), potion_of_deadly_grace
0:07.336 ice_lance Fluffy_Pillow 1042294.0/1100000: 95% mana bloodlust, berserking, bone_chilling(12), fingers_of_frost(3), icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(6), potion_of_deadly_grace
0:08.092 ice_lance Fluffy_Pillow 1043768.0/1100000: 95% mana bloodlust, berserking, bone_chilling(12), fingers_of_frost(3), icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(6), potion_of_deadly_grace
0:08.848 blizzard Fluffy_Pillow 1045242.0/1100000: 95% mana bloodlust, berserking, bone_chilling(12), fingers_of_frost(2), icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(4), potion_of_deadly_grace
0:09.614 ice_lance Fluffy_Pillow 1030381.0/1100000: 94% mana bloodlust, berserking, bone_chilling(12), fingers_of_frost(2), icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(3), potion_of_deadly_grace
0:10.370 ice_lance Fluffy_Pillow 1031855.0/1100000: 94% mana bloodlust, berserking, bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(3), potion_of_deadly_grace
0:11.165 rune_of_power Fluffy_Pillow 1033972.5/1100000: 94% mana bloodlust, bone_chilling(12), icy_veins, chilled_to_the_core, maddening_whispers, potion_of_deadly_grace
0:11.921 frostbolt Fluffy_Pillow 1046446.5/1100000: 95% mana bloodlust, bone_chilling(12), icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers, potion_of_deadly_grace
0:12.802 blizzard Fluffy_Pillow 1038983.0/1100000: 94% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers, potion_of_deadly_grace
0:13.809 ice_lance Fluffy_Pillow 1028098.5/1100000: 93% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers, potion_of_deadly_grace
0:14.562 frostbolt Fluffy_Pillow 1029523.0/1100000: 94% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, potion_of_deadly_grace
0:15.441 frost_bomb Fluffy_Pillow 1022026.5/1100000: 93% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, potion_of_deadly_grace
0:16.197 ice_lance Fluffy_Pillow 1020750.5/1100000: 93% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, potion_of_deadly_grace
0:16.951 ice_lance Fluffy_Pillow 1022191.5/1100000: 93% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, potion_of_deadly_grace
0:17.706 blizzard Fluffy_Pillow 1023649.0/1100000: 93% mana bloodlust, brain_freeze, bone_chilling(12), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, potion_of_deadly_grace
0:18.587 frostbolt Fluffy_Pillow 1010685.5/1100000: 92% mana bloodlust, brain_freeze, bone_chilling(12), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, potion_of_deadly_grace
0:19.467 flurry Fluffy_Pillow 1003205.5/1100000: 91% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, potion_of_deadly_grace
0:20.221 ice_lance Fluffy_Pillow 1004646.5/1100000: 91% mana bloodlust, bone_chilling(12), fingers_of_frost(2), icicles, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:20.977 ice_lance Fluffy_Pillow 1006120.5/1100000: 91% mana bloodlust, bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, potion_of_deadly_grace
0:21.732 frostbolt Fluffy_Pillow 1007578.0/1100000: 92% mana bloodlust, bone_chilling(12), icy_veins, rune_of_power, potion_of_deadly_grace
0:22.612 blizzard Fluffy_Pillow 1000098.0/1100000: 91% mana bloodlust, bone_chilling(12), icicles, icy_veins, potion_of_deadly_grace
0:23.492 frostbolt Fluffy_Pillow 987118.0/1100000: 90% mana bloodlust, bone_chilling(12), icicles, icy_veins, potion_of_deadly_grace
0:24.371 water_jet Fluffy_Pillow 979621.5/1100000: 89% mana bloodlust, bone_chilling(12), icicles(2), icy_veins, chain_reaction, potion_of_deadly_grace
0:24.371 frostbolt Fluffy_Pillow 979621.5/1100000: 89% mana bloodlust, bone_chilling(12), icicles(2), icy_veins, chain_reaction, potion_of_deadly_grace
0:25.251 frostbolt Fluffy_Pillow 972141.5/1100000: 88% mana bloodlust, brain_freeze, bone_chilling(12), icicles(3), icy_veins, chain_reaction, potion_of_deadly_grace
0:26.132 ice_lance Fluffy_Pillow 964678.0/1100000: 88% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles(4), icy_veins, chain_reaction, potion_of_deadly_grace
0:26.884 blizzard Fluffy_Pillow 966086.0/1100000: 88% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction, potion_of_deadly_grace
0:27.875 frost_bomb Fluffy_Pillow 954937.5/1100000: 87% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(2), potion_of_deadly_grace
0:28.631 ice_lance Fluffy_Pillow 953661.5/1100000: 87% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(2)
0:29.384 frostbolt Fluffy_Pillow 955086.0/1100000: 87% mana bloodlust, brain_freeze, bone_chilling(12), icy_veins, chain_reaction(2)
0:30.266 flurry Fluffy_Pillow 947639.0/1100000: 86% mana bloodlust, brain_freeze, bone_chilling(12), icicles, icy_veins, chain_reaction(2)
0:31.020 ice_lance Fluffy_Pillow 949080.0/1100000: 86% mana bloodlust, bone_chilling(12), icicles, icy_veins, chain_reaction(2)
0:31.773 frozen_touch Fluffy_Pillow 950504.5/1100000: 86% mana bloodlust, bone_chilling(12), icy_veins, chain_reaction(3)
0:31.773 frostbolt Fluffy_Pillow 950504.5/1100000: 86% mana bloodlust, bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction(3)
0:32.652 ice_lance Fluffy_Pillow 943008.0/1100000: 86% mana bloodlust, bone_chilling(12), fingers_of_frost(2), icicles, icy_veins, chain_reaction(3)
0:33.407 ice_lance Fluffy_Pillow 944465.5/1100000: 86% mana bloodlust, bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(3)
0:34.161 frostbolt Fluffy_Pillow 945906.5/1100000: 86% mana bloodlust, bone_chilling(12), icy_veins, chain_reaction(3)
0:35.041 frostbolt Fluffy_Pillow 938426.5/1100000: 85% mana bloodlust, bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction(3)
0:35.921 ice_lance Fluffy_Pillow 930946.5/1100000: 85% mana bloodlust, bone_chilling(12), fingers_of_frost, icicles(2), icy_veins, chain_reaction(3)
0:36.674 frostbolt Fluffy_Pillow 932371.0/1100000: 85% mana bloodlust, bone_chilling(12), icy_veins, chain_reaction(3)
0:37.554 frostbolt Fluffy_Pillow 924891.0/1100000: 84% mana bloodlust, bone_chilling(12), icicles(2), icy_veins, chain_reaction(3)
0:38.435 frostbolt Fluffy_Pillow 917427.5/1100000: 83% mana bloodlust, bone_chilling(12), fingers_of_frost, icicles(3), icy_veins, chain_reaction(3)
0:39.315 ice_lance Fluffy_Pillow 909947.5/1100000: 83% mana bloodlust, bone_chilling(12), fingers_of_frost, icicles(4), icy_veins, chain_reaction(3)
0:40.091 time_warp Fluffy_Pillow 911751.5/1100000: 83% mana bone_chilling(12), icy_veins, chain_reaction(3)
0:40.091 frostbolt Fluffy_Pillow 867751.5/1100000: 79% mana bloodlust, bone_chilling(12), icy_veins, chain_reaction(3)
0:40.971 rune_of_power Fluffy_Pillow 860271.5/1100000: 78% mana bloodlust, bone_chilling(12), icicles, icy_veins, chain_reaction(3)
0:41.724 frostbolt Fluffy_Pillow 872696.0/1100000: 79% mana bloodlust, bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(3)
0:42.603 frostbolt Fluffy_Pillow 865199.5/1100000: 79% mana bloodlust, brain_freeze, bone_chilling(12), icicles(2), icy_veins, rune_of_power, chain_reaction(3)
0:43.484 frost_bomb Fluffy_Pillow 857736.0/1100000: 78% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles(3), icy_veins, rune_of_power, chain_reaction(3)
0:44.238 ice_lance Fluffy_Pillow 856427.0/1100000: 78% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles(4), icy_veins, rune_of_power, chain_reaction(3)
0:44.991 frostbolt Fluffy_Pillow 857851.5/1100000: 78% mana bloodlust, brain_freeze, bone_chilling(12), icy_veins, rune_of_power, chain_reaction(3)
0:45.871 flurry Fluffy_Pillow 850371.5/1100000: 77% mana bloodlust, brain_freeze, bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(3)
0:46.624 ice_lance Fluffy_Pillow 851796.0/1100000: 77% mana bloodlust, bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(3)
0:47.377 frostbolt Fluffy_Pillow 853220.5/1100000: 78% mana bloodlust, bone_chilling(12), icy_veins, rune_of_power, chain_reaction(3)
0:48.256 frostbolt Fluffy_Pillow 845724.0/1100000: 77% mana bloodlust, bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(3)
0:49.136 frostbolt Fluffy_Pillow 838244.0/1100000: 76% mana bloodlust, bone_chilling(12), icicles(2), icy_veins, rune_of_power, chain_reaction(3)
0:50.016 water_jet Fluffy_Pillow 830764.0/1100000: 76% mana bloodlust, bone_chilling(12), icicles(3), icy_veins, rune_of_power, chain_reaction(3)
0:50.016 frostbolt Fluffy_Pillow 830764.0/1100000: 76% mana bloodlust, bone_chilling(12), icicles(3), icy_veins, rune_of_power, chain_reaction(3)
0:50.897 frostbolt Fluffy_Pillow 823300.5/1100000: 75% mana bloodlust, bone_chilling(12), icicles(4), icy_veins, rune_of_power, chain_reaction(3)
0:51.778 ice_lance Fluffy_Pillow 815837.0/1100000: 74% mana bloodlust, bone_chilling(12), fingers_of_frost(2), icicles(5), icy_veins, chain_reaction(3)
0:52.531 ice_lance Fluffy_Pillow 817261.5/1100000: 74% mana bloodlust, bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction(3)
0:53.286 ice_lance Fluffy_Pillow 818719.0/1100000: 74% mana bloodlust, bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(3)
0:54.040 ebonbolt Fluffy_Pillow 820160.0/1100000: 75% mana bloodlust, bone_chilling(12), icy_veins, chain_reaction(3)
0:55.357 frostbolt Fluffy_Pillow 841890.5/1100000: 77% mana bloodlust, bone_chilling(12), fingers_of_frost(3), icy_veins, chain_reaction(3)
0:56.239 frost_bomb Fluffy_Pillow 834443.5/1100000: 76% mana bloodlust, bone_chilling(12), fingers_of_frost(3), icicles, icy_veins, chain_reaction(3)
0:56.994 ice_lance Fluffy_Pillow 833151.0/1100000: 76% mana bloodlust, bone_chilling(12), fingers_of_frost(3), icicles, icy_veins, chain_reaction(3)
0:57.749 ice_lance Fluffy_Pillow 834608.5/1100000: 76% mana bloodlust, bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction(3)
0:58.504 potion Fluffy_Pillow 836066.0/1100000: 76% mana bloodlust, bone_chilling(12), fingers_of_frost, icy_veins
0:58.504 blizzard Fluffy_Pillow 836066.0/1100000: 76% mana bloodlust, bone_chilling(12), fingers_of_frost, icy_veins, potion_of_deadly_grace
0:59.385 ice_lance Fluffy_Pillow 823102.5/1100000: 75% mana bloodlust, bone_chilling(12), fingers_of_frost, icy_veins, potion_of_deadly_grace
1:00.140 frostbolt Fluffy_Pillow 824560.0/1100000: 75% mana bloodlust, bone_chilling(12), icy_veins, potion_of_deadly_grace
1:01.020 frostbolt Fluffy_Pillow 817080.0/1100000: 74% mana bloodlust, brain_freeze, bone_chilling(12), icicles, icy_veins, potion_of_deadly_grace
1:01.901 flurry Fluffy_Pillow 809616.5/1100000: 74% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles(2), icy_veins, potion_of_deadly_grace
1:02.655 blizzard Fluffy_Pillow 811057.5/1100000: 74% mana bloodlust, bone_chilling(12), fingers_of_frost, icicles(3), icy_veins, potion_of_deadly_grace
1:03.764 frozen_touch Fluffy_Pillow 801856.0/1100000: 73% mana bloodlust, bone_chilling(12), fingers_of_frost, icicles(3), icy_veins, chain_reaction, potion_of_deadly_grace
1:03.764 ice_lance Fluffy_Pillow 801856.0/1100000: 73% mana bloodlust, bone_chilling(12), fingers_of_frost(3), icicles(3), icy_veins, chain_reaction, potion_of_deadly_grace
1:04.518 ice_lance Fluffy_Pillow 803297.0/1100000: 73% mana bloodlust, bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction, potion_of_deadly_grace
1:05.274 ice_lance Fluffy_Pillow 804771.0/1100000: 73% mana bloodlust, bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction, potion_of_deadly_grace
1:06.029 frozen_orb Fluffy_Pillow 806228.5/1100000: 73% mana bloodlust, bone_chilling(12), icy_veins, chain_reaction, potion_of_deadly_grace
1:06.784 frostbolt Fluffy_Pillow 807686.0/1100000: 73% mana bloodlust, bone_chilling(12), icy_veins, chain_reaction, potion_of_deadly_grace
1:07.664 blizzard Fluffy_Pillow 800206.0/1100000: 73% mana bloodlust, bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction, potion_of_deadly_grace
1:08.544 frost_bomb Fluffy_Pillow 787226.0/1100000: 72% mana bloodlust, bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction, potion_of_deadly_grace
1:09.299 ice_lance Fluffy_Pillow 785933.5/1100000: 71% mana bloodlust, bone_chilling(12), fingers_of_frost, icicles(2), icy_veins, chain_reaction(2), potion_of_deadly_grace
1:10.052 frostbolt Fluffy_Pillow 787358.0/1100000: 72% mana bloodlust, bone_chilling(12), icy_veins, chain_reaction(2), potion_of_deadly_grace
1:10.931 ice_lance Fluffy_Pillow 779861.5/1100000: 71% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction(2), potion_of_deadly_grace
1:11.685 frostbolt Fluffy_Pillow 781302.5/1100000: 71% mana bloodlust, brain_freeze, bone_chilling(12), icy_veins, chain_reaction(2), potion_of_deadly_grace
1:12.565 blizzard Fluffy_Pillow 773822.5/1100000: 70% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction(3), potion_of_deadly_grace
1:13.445 ice_lance Fluffy_Pillow 760842.5/1100000: 69% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction(3), potion_of_deadly_grace
1:14.198 frostbolt Fluffy_Pillow 762267.0/1100000: 69% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(3), potion_of_deadly_grace
1:15.080 ice_lance Fluffy_Pillow 754820.0/1100000: 69% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction(3), potion_of_deadly_grace
1:15.835 frostbolt Fluffy_Pillow 756277.5/1100000: 69% mana bloodlust, brain_freeze, bone_chilling(12), icy_veins, chain_reaction(3), potion_of_deadly_grace
1:16.715 blizzard Fluffy_Pillow 748797.5/1100000: 68% mana bloodlust, brain_freeze, bone_chilling(12), icicles, icy_veins, chain_reaction(3), potion_of_deadly_grace
1:17.828 ice_lance Fluffy_Pillow 739662.0/1100000: 67% mana bloodlust, brain_freeze, bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction(3), potion_of_deadly_grace
1:18.584 frostbolt Fluffy_Pillow 741136.0/1100000: 67% mana bloodlust, brain_freeze, bone_chilling(12), icy_veins, chain_reaction(3), potion_of_deadly_grace
1:19.464 flurry Fluffy_Pillow 733656.0/1100000: 67% mana bloodlust, brain_freeze, bone_chilling(12), icicles, icy_veins, chain_reaction(3), potion_of_deadly_grace
1:20.257 ice_lance Fluffy_Pillow 735740.5/1100000: 67% mana bone_chilling(12), icicles, icy_veins, chain_reaction(3), potion_of_deadly_grace
1:21.116 rune_of_power Fluffy_Pillow 738914.0/1100000: 67% mana bone_chilling(12), icy_veins, chain_reaction(3), potion_of_deadly_grace
1:21.975 blizzard Fluffy_Pillow 753087.5/1100000: 68% mana bone_chilling(12), icy_veins, rune_of_power, chain_reaction(3), potion_of_deadly_grace
1:23.119 frostbolt Fluffy_Pillow 744463.5/1100000: 68% mana bone_chilling(12), icy_veins, rune_of_power, chain_reaction(3), potion_of_deadly_grace
1:24.264 water_jet Fluffy_Pillow 741356.0/1100000: 67% mana bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(3), potion_of_deadly_grace
1:24.264 frostbolt Fluffy_Pillow 741356.0/1100000: 67% mana bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(3), potion_of_deadly_grace
1:25.406 frostbolt Fluffy_Pillow 738199.0/1100000: 67% mana bone_chilling(12), fingers_of_frost(2), icicles(2), icy_veins, rune_of_power, chain_reaction(3), potion_of_deadly_grace
1:26.548 frost_bomb Fluffy_Pillow 735042.0/1100000: 67% mana bone_chilling(12), fingers_of_frost(3), icicles(3), icy_veins, rune_of_power, chain_reaction(3), potion_of_deadly_grace
1:27.406 ice_lance Fluffy_Pillow 735449.0/1100000: 67% mana bone_chilling(12), fingers_of_frost(3), icicles(3), icy_veins, rune_of_power, chain_reaction(3), potion_of_deadly_grace
1:28.264 blizzard Fluffy_Pillow 738606.0/1100000: 67% mana bone_chilling(12), fingers_of_frost(2), icy_veins, rune_of_power, chain_reaction(3), potion_of_deadly_grace
1:29.407 ice_lance Fluffy_Pillow 729965.5/1100000: 66% mana bone_chilling(12), fingers_of_frost(2), icy_veins, rune_of_power, chain_reaction(3)
1:30.266 ice_lance Fluffy_Pillow 733139.0/1100000: 67% mana bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction(3)
1:31.125 frostbolt Fluffy_Pillow 736312.5/1100000: 67% mana bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction(3)
1:32.269 ice_lance Fluffy_Pillow 733188.5/1100000: 67% mana bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction(3)
1:33.128 frostbolt Fluffy_Pillow 736362.0/1100000: 67% mana bone_chilling(12), icy_veins
1:34.270 frozen_touch Fluffy_Pillow 733205.0/1100000: 67% mana bone_chilling(12), icicles, icy_veins
1:34.270 frostbolt Fluffy_Pillow 733205.0/1100000: 67% mana bone_chilling(12), fingers_of_frost(2), icicles, icy_veins
1:35.414 ice_lance Fluffy_Pillow 730081.0/1100000: 66% mana bone_chilling(12), fingers_of_frost(2), icicles(3), icy_veins
1:36.271 ice_lance Fluffy_Pillow 733221.5/1100000: 67% mana bone_chilling(12), fingers_of_frost, icy_veins
1:37.129 frostbolt Fluffy_Pillow 736378.5/1100000: 67% mana bone_chilling(12), icy_veins
1:38.271 frostbolt Fluffy_Pillow 733221.5/1100000: 67% mana bone_chilling(12), icicles, icy_veins
1:39.416 frost_bomb Fluffy_Pillow 730114.0/1100000: 66% mana bone_chilling(12), fingers_of_frost, icicles(3), icy_veins, chain_reaction
1:40.275 ice_lance Fluffy_Pillow 730537.5/1100000: 66% mana bone_chilling(12), fingers_of_frost, icicles(3), icy_veins, chain_reaction
1:41.135 ebonbolt Fluffy_Pillow 733727.5/1100000: 67% mana bone_chilling(12), icy_veins, chain_reaction(2)
1:42.848 frostbolt Fluffy_Pillow 761992.0/1100000: 69% mana bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction(2)
1:43.992 ice_lance Fluffy_Pillow 758868.0/1100000: 69% mana bone_chilling(12), fingers_of_frost(2), icicles, icy_veins, chain_reaction(2)
1:44.849 ice_lance Fluffy_Pillow 762008.5/1100000: 69% mana bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(2)
1:45.705 frostbolt Fluffy_Pillow 765132.5/1100000: 70% mana bone_chilling(12), icicles, icy_veins, chain_reaction(2)
1:46.849 frostbolt Fluffy_Pillow 762008.5/1100000: 69% mana bone_chilling(12), icicles(2), icy_veins
1:47.991 frostbolt Fluffy_Pillow 758851.5/1100000: 69% mana bone_chilling(12), icicles(3), icy_veins
1:49.133 frostbolt Fluffy_Pillow 755694.5/1100000: 69% mana bone_chilling(12), icicles(4), icy_veins
1:50.278 water_jet Fluffy_Pillow 752587.0/1100000: 68% mana brain_freeze, bone_chilling(12), icicles(5), icy_veins
1:50.278 frostbolt Fluffy_Pillow 752587.0/1100000: 68% mana brain_freeze, bone_chilling(12), icicles(5), icy_veins
1:51.421 flurry Fluffy_Pillow 749446.5/1100000: 68% mana brain_freeze, bone_chilling(12), fingers_of_frost, icicles(5)
1:52.538 frost_bomb Fluffy_Pillow 756877.0/1100000: 69% mana bone_chilling(12), fingers_of_frost(2), icicles(5), chain_reaction
1:53.653 ice_lance Fluffy_Pillow 761524.5/1100000: 69% mana bone_chilling(12), fingers_of_frost(2), icicles(5), chain_reaction
1:54.770 ice_lance Fluffy_Pillow 768955.0/1100000: 70% mana bone_chilling(12), fingers_of_frost, chain_reaction
1:55.884 frostbolt Fluffy_Pillow 776336.0/1100000: 71% mana bone_chilling(12), chain_reaction
1:57.369 frostbolt Fluffy_Pillow 778838.5/1100000: 71% mana bone_chilling(12), icicles, chain_reaction
1:58.856 frostbolt Fluffy_Pillow 781374.0/1100000: 71% mana brain_freeze, bone_chilling(12), fingers_of_frost, icicles(2)
2:00.344 ice_lance Fluffy_Pillow 783926.0/1100000: 71% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles(4), chain_reaction
2:01.459 use_item_wriggling_sinew Fluffy_Pillow 791323.5/1100000: 72% mana brain_freeze, bone_chilling(12), fingers_of_frost, chain_reaction(2)
2:01.459 ice_lance Fluffy_Pillow 791323.5/1100000: 72% mana brain_freeze, bone_chilling(12), fingers_of_frost, chain_reaction(2), maddening_whispers(10)
2:02.575 frostbolt Fluffy_Pillow 798737.5/1100000: 73% mana brain_freeze, bone_chilling(12), chain_reaction(2), maddening_whispers(9)
2:04.059 flurry Fluffy_Pillow 801223.5/1100000: 73% mana brain_freeze, bone_chilling(12), icicles, chain_reaction(2), maddening_whispers(9)
2:05.174 ice_lance Fluffy_Pillow 808621.0/1100000: 74% mana bone_chilling(12), icicles, chain_reaction(3), maddening_whispers(7)
2:06.290 frozen_touch Fluffy_Pillow 816035.0/1100000: 74% mana bone_chilling(12), chain_reaction(3), maddening_whispers(4)
2:06.290 frozen_orb Fluffy_Pillow 816035.0/1100000: 74% mana bone_chilling(12), fingers_of_frost(2), chain_reaction(3), maddening_whispers(4)
2:07.404 frost_bomb Fluffy_Pillow 823416.0/1100000: 75% mana bone_chilling(12), fingers_of_frost(2), chain_reaction(3), maddening_whispers(4)
2:08.519 ice_lance Fluffy_Pillow 828063.5/1100000: 75% mana bone_chilling(12), fingers_of_frost(3), chain_reaction(3), maddening_whispers(4)
2:09.635 ice_lance Fluffy_Pillow 835477.5/1100000: 76% mana bone_chilling(12), fingers_of_frost(3), chain_reaction(3), maddening_whispers(3)
2:10.753 frostbolt Fluffy_Pillow 842924.5/1100000: 77% mana bone_chilling(12), fingers_of_frost(2), chain_reaction(3), maddening_whispers(2)
2:12.239 ice_lance Fluffy_Pillow 845443.5/1100000: 77% mana bone_chilling(12), fingers_of_frost(3), icicles, maddening_whispers(2)
2:13.355 frostbolt Fluffy_Pillow 852857.5/1100000: 78% mana bone_chilling(12), fingers_of_frost(2), chain_reaction
2:14.840 frostbolt Fluffy_Pillow 855360.0/1100000: 78% mana bone_chilling(12), fingers_of_frost(3), icicles, chain_reaction
2:16.328 rune_of_power Fluffy_Pillow 857912.0/1100000: 78% mana bone_chilling(12), fingers_of_frost(3), icicles(2), chain_reaction(2)
2:17.443 icy_veins Fluffy_Pillow 876309.5/1100000: 80% mana bone_chilling(12), fingers_of_frost(3), icicles(3), rune_of_power, chain_reaction(2)
2:17.443 ice_lance Fluffy_Pillow 876309.5/1100000: 80% mana bone_chilling(12), fingers_of_frost(3), icicles(3), icy_veins, rune_of_power, chain_reaction(2), chilled_to_the_core
2:18.302 ice_lance Fluffy_Pillow 879483.0/1100000: 80% mana bone_chilling(12), fingers_of_frost(3), icy_veins, rune_of_power, chain_reaction(2), chilled_to_the_core
2:19.160 ice_lance Fluffy_Pillow 882640.0/1100000: 80% mana bone_chilling(12), fingers_of_frost(2), icy_veins, rune_of_power, chain_reaction(2), chilled_to_the_core
2:20.018 frost_bomb Fluffy_Pillow 885797.0/1100000: 81% mana bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction(2), chilled_to_the_core
2:20.875 ice_lance Fluffy_Pillow 886187.5/1100000: 81% mana bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction(2), chilled_to_the_core
2:21.733 frostbolt Fluffy_Pillow 889344.5/1100000: 81% mana bone_chilling(12), icy_veins, rune_of_power, chain_reaction(2), chilled_to_the_core
2:22.876 water_jet Fluffy_Pillow 886204.0/1100000: 81% mana bone_chilling(12), icicles, icy_veins, rune_of_power, chilled_to_the_core
2:22.876 frostbolt Fluffy_Pillow 886204.0/1100000: 81% mana bone_chilling(12), icicles, icy_veins, rune_of_power, chilled_to_the_core
2:24.020 frostbolt Fluffy_Pillow 883080.0/1100000: 80% mana brain_freeze, bone_chilling(12), fingers_of_frost, icicles(2), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core
2:25.164 flurry Fluffy_Pillow 879956.0/1100000: 80% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles(3), icy_veins, rune_of_power, chain_reaction(2), chilled_to_the_core
2:26.022 ice_lance Fluffy_Pillow 883113.0/1100000: 80% mana bone_chilling(12), fingers_of_frost(2), icicles(3), icy_veins, rune_of_power, chain_reaction(2), chilled_to_the_core
2:26.880 ice_lance Fluffy_Pillow 886270.0/1100000: 81% mana bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
2:27.739 ebonbolt Fluffy_Pillow 889443.5/1100000: 81% mana bone_chilling(12), icy_veins, chain_reaction(3), chilled_to_the_core
2:29.558 frostbolt Fluffy_Pillow 919457.0/1100000: 84% mana bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction(3), chilled_to_the_core
2:30.700 ice_lance Fluffy_Pillow 916300.0/1100000: 83% mana bone_chilling(12), fingers_of_frost(2), icicles, icy_veins, chain_reaction(3), chilled_to_the_core
2:31.560 ice_lance Fluffy_Pillow 919490.0/1100000: 84% mana bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(3), chilled_to_the_core
2:32.417 frostbolt Fluffy_Pillow 922630.5/1100000: 84% mana bone_chilling(12), icy_veins, chain_reaction(3), chilled_to_the_core
2:33.561 frostbolt Fluffy_Pillow 919506.5/1100000: 84% mana bone_chilling(12), icicles, icy_veins, chain_reaction(3), chilled_to_the_core
2:34.704 frostbolt Fluffy_Pillow 916366.0/1100000: 83% mana bone_chilling(12), icicles(2), icy_veins, chain_reaction(3), chilled_to_the_core
2:35.848 frostbolt Fluffy_Pillow 913242.0/1100000: 83% mana bone_chilling(12), icicles(3), icy_veins, chain_reaction(3), chilled_to_the_core
2:36.992 frozen_touch Fluffy_Pillow 910118.0/1100000: 83% mana bone_chilling(12), icicles(4), icy_veins, chain_reaction(3), chilled_to_the_core
2:36.992 frostbolt Fluffy_Pillow 910118.0/1100000: 83% mana bone_chilling(12), fingers_of_frost(2), icicles(4), icy_veins, chain_reaction(3), chilled_to_the_core
2:38.136 frost_bomb Fluffy_Pillow 906994.0/1100000: 82% mana bone_chilling(12), fingers_of_frost(2), icicles(5), icy_veins, chain_reaction
2:38.993 ice_lance Fluffy_Pillow 907384.5/1100000: 82% mana bone_chilling(12), fingers_of_frost(2), icicles(5), icy_veins, chain_reaction
2:39.851 ice_lance Fluffy_Pillow 910541.5/1100000: 83% mana bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction
2:40.711 rune_of_power Fluffy_Pillow 913731.5/1100000: 83% mana bone_chilling(12), icy_veins, chain_reaction
2:41.713 frostbolt Fluffy_Pillow 930264.5/1100000: 85% mana bone_chilling(12), icy_veins, rune_of_power, chain_reaction
2:42.857 frostbolt Fluffy_Pillow 927140.5/1100000: 84% mana bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction
2:44.001 frostbolt Fluffy_Pillow 924016.5/1100000: 84% mana bone_chilling(12), icicles(2), icy_veins, rune_of_power, chain_reaction(2)
2:45.144 frostbolt Fluffy_Pillow 920876.0/1100000: 84% mana brain_freeze, bone_chilling(12), fingers_of_frost, icicles(3), icy_veins, rune_of_power, chain_reaction(2)
2:46.287 ice_lance Fluffy_Pillow 917735.5/1100000: 83% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles(4), icy_veins, rune_of_power, chain_reaction(2)
2:47.147 ice_lance Fluffy_Pillow 920925.5/1100000: 84% mana brain_freeze, bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction(2)
2:48.008 frostbolt Fluffy_Pillow 924132.0/1100000: 84% mana brain_freeze, bone_chilling(12), icy_veins, rune_of_power, chain_reaction(2)
2:49.151 flurry Fluffy_Pillow 920991.5/1100000: 84% mana brain_freeze, bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(2)
2:50.011 ice_lance Fluffy_Pillow 924181.5/1100000: 84% mana bone_chilling(12), icicles, icy_veins, rune_of_power
2:50.871 frostbolt Fluffy_Pillow 927371.5/1100000: 84% mana bone_chilling(12), icy_veins, rune_of_power
2:52.014 water_jet Fluffy_Pillow 924231.0/1100000: 84% mana bone_chilling(12), icicles, icy_veins
2:52.014 frostbolt Fluffy_Pillow 924231.0/1100000: 84% mana bone_chilling(12), icicles, icy_veins
2:53.156 frostbolt Fluffy_Pillow 921074.0/1100000: 84% mana bone_chilling(12), fingers_of_frost, icicles(2), icy_veins, chain_reaction
2:54.300 frost_bomb Fluffy_Pillow 917950.0/1100000: 83% mana bone_chilling(12), fingers_of_frost(2), icicles(3), icy_veins, chain_reaction(2)
2:55.157 ice_lance Fluffy_Pillow 918340.5/1100000: 83% mana bone_chilling(12), fingers_of_frost(2), icicles(3), icy_veins, chain_reaction(2)
2:56.014 ice_lance Fluffy_Pillow 921481.0/1100000: 84% mana bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(2)
2:56.873 frostbolt Fluffy_Pillow 924654.5/1100000: 84% mana bone_chilling(12), icy_veins, chain_reaction(2)
2:58.018 frostbolt Fluffy_Pillow 921547.0/1100000: 84% mana bone_chilling(12), icicles, icy_veins, chain_reaction(2)
2:59.162 frostbolt Fluffy_Pillow 918423.0/1100000: 83% mana bone_chilling(12), icicles(2), icy_veins, chain_reaction(2)
3:00.306 frostbolt Fluffy_Pillow 915299.0/1100000: 83% mana brain_freeze, bone_chilling(12), icicles(4), icy_veins, chain_reaction
3:01.450 berserking Fluffy_Pillow 912175.0/1100000: 83% mana brain_freeze, bone_chilling(12), fingers_of_frost, icicles(5), icy_veins, chain_reaction
3:01.450 flurry Fluffy_Pillow 912175.0/1100000: 83% mana berserking, brain_freeze, bone_chilling(12), fingers_of_frost, icicles(5), icy_veins, chain_reaction
3:02.203 ice_lance Fluffy_Pillow 913599.5/1100000: 83% mana berserking, bone_chilling(12), fingers_of_frost, icicles(5), icy_veins, chain_reaction
3:02.957 frostbolt Fluffy_Pillow 915040.5/1100000: 83% mana berserking, bone_chilling(12), icicles, icy_veins, chain_reaction
3:03.951 frostbolt Fluffy_Pillow 909441.5/1100000: 83% mana berserking, bone_chilling(12), fingers_of_frost, icicles(2), icy_veins, chain_reaction
3:04.945 ice_lance Fluffy_Pillow 903842.5/1100000: 82% mana berserking, brain_freeze, bone_chilling(12), fingers_of_frost, icicles(3), icy_veins, chain_reaction
3:05.699 frostbolt Fluffy_Pillow 905283.5/1100000: 82% mana berserking, brain_freeze, bone_chilling(12), icy_veins, chain_reaction(2)
3:06.696 flurry Fluffy_Pillow 899734.0/1100000: 82% mana berserking, brain_freeze, bone_chilling(12), icicles, icy_veins, chain_reaction(2)
3:07.449 ice_lance Fluffy_Pillow 901158.5/1100000: 82% mana berserking, bone_chilling(12), icicles, icy_veins, chain_reaction(2)
3:08.203 frozen_touch Fluffy_Pillow 902599.5/1100000: 82% mana berserking, bone_chilling(12), icy_veins, chain_reaction(2)
3:08.203 frozen_orb Fluffy_Pillow 902599.5/1100000: 82% mana berserking, bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction(2)
3:08.960 frost_bomb Fluffy_Pillow 904090.0/1100000: 82% mana berserking, bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction(2)
3:09.715 ice_lance Fluffy_Pillow 902797.5/1100000: 82% mana berserking, bone_chilling(12), fingers_of_frost(3), icy_veins, chain_reaction(2)
3:10.467 ice_lance Fluffy_Pillow 904205.5/1100000: 82% mana berserking, bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction(2)
3:11.221 ice_lance Fluffy_Pillow 905646.5/1100000: 82% mana berserking, bone_chilling(12), fingers_of_frost, icy_veins
3:12.052 frostbolt Fluffy_Pillow 908358.0/1100000: 83% mana bone_chilling(12), icy_veins
3:13.195 frostbolt Fluffy_Pillow 905217.5/1100000: 82% mana bone_chilling(12), icicles, icy_veins
3:14.339 ebonbolt Fluffy_Pillow 902093.5/1100000: 82% mana bone_chilling(12), icicles(3), icy_veins, chain_reaction
3:16.265 frostbolt Fluffy_Pillow 933872.5/1100000: 85% mana bone_chilling(12), fingers_of_frost(2), icicles(4), icy_veins, chain_reaction(2)
3:17.408 ice_lance Fluffy_Pillow 930732.0/1100000: 85% mana bone_chilling(12), fingers_of_frost(3), icicles(5), icy_veins, chain_reaction(2)
3:18.266 ice_lance Fluffy_Pillow 933889.0/1100000: 85% mana bone_chilling(12), fingers_of_frost(2), icy_veins, chain_reaction(2)
3:19.127 ice_lance Fluffy_Pillow 937095.5/1100000: 85% mana bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(2)
3:19.986 frostbolt Fluffy_Pillow 940269.0/1100000: 85% mana bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction(2)
3:21.131 rune_of_power Fluffy_Pillow 937161.5/1100000: 85% mana bone_chilling(12), fingers_of_frost, icicles, icy_veins, chain_reaction(2)
3:21.992 frost_bomb Fluffy_Pillow 951368.0/1100000: 86% mana bone_chilling(12), fingers_of_frost, icicles, icy_veins, rune_of_power
3:22.850 ice_lance Fluffy_Pillow 951775.0/1100000: 87% mana bone_chilling(12), fingers_of_frost, icicles, icy_veins, rune_of_power
3:23.707 frostbolt Fluffy_Pillow 954915.5/1100000: 87% mana bone_chilling(12), icy_veins, rune_of_power
3:24.850 water_jet Fluffy_Pillow 951775.0/1100000: 87% mana bone_chilling(12), icicles, icy_veins, rune_of_power
3:24.850 frostbolt Fluffy_Pillow 951775.0/1100000: 87% mana bone_chilling(12), icicles, icy_veins, rune_of_power
3:25.993 frostbolt Fluffy_Pillow 948634.5/1100000: 86% mana brain_freeze, bone_chilling(12), fingers_of_frost, icicles(2), icy_veins, rune_of_power
3:27.137 ice_lance Fluffy_Pillow 945510.5/1100000: 86% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles(3), icy_veins, rune_of_power
3:27.995 ice_lance Fluffy_Pillow 948667.5/1100000: 86% mana brain_freeze, bone_chilling(12), fingers_of_frost, rune_of_power
3:29.109 frostbolt Fluffy_Pillow 956048.5/1100000: 87% mana brain_freeze, bone_chilling(12), icicles, rune_of_power, chain_reaction
3:30.594 flurry Fluffy_Pillow 958551.0/1100000: 87% mana brain_freeze, bone_chilling(12), icicles(2), rune_of_power, chain_reaction
3:31.709 ice_lance Fluffy_Pillow 965948.5/1100000: 88% mana bone_chilling(12), icicles(2), rune_of_power, chain_reaction(2)
3:32.823 frostbolt Fluffy_Pillow 973329.5/1100000: 88% mana bone_chilling(12), chain_reaction(2)
3:34.309 frostbolt Fluffy_Pillow 975848.5/1100000: 89% mana brain_freeze, bone_chilling(12), icicles, chain_reaction(2)
3:35.795 flurry Fluffy_Pillow 978367.5/1100000: 89% mana brain_freeze, bone_chilling(12), fingers_of_frost, icicles(3), chain_reaction(3)
3:36.911 frost_bomb Fluffy_Pillow 985781.5/1100000: 90% mana bone_chilling(12), fingers_of_frost, icicles(4), chain_reaction(3)
3:38.026 frozen_touch Fluffy_Pillow 990429.0/1100000: 90% mana bone_chilling(12), fingers_of_frost, icicles(4), chain_reaction(3)
3:38.203 ice_lance Fluffy_Pillow 993349.5/1100000: 90% mana bone_chilling(12), fingers_of_frost(3), icicles(4), chain_reaction(3)
3:39.318 ice_lance Fluffy_Pillow 1000747.0/1100000: 91% mana bone_chilling(12), fingers_of_frost(2), chain_reaction(3)
3:40.433 ice_lance Fluffy_Pillow 1008144.5/1100000: 92% mana bone_chilling(12), fingers_of_frost, chain_reaction(3)
3:41.548 frostbolt Fluffy_Pillow 1015542.0/1100000: 92% mana bone_chilling(12), chain_reaction(3)
3:43.035 frostbolt Fluffy_Pillow 1018077.5/1100000: 93% mana brain_freeze, bone_chilling(12), icicles
3:44.519 flurry Fluffy_Pillow 1020563.5/1100000: 93% mana brain_freeze, bone_chilling(12), icicles(2), chain_reaction
3:45.633 ice_lance Fluffy_Pillow 1027944.5/1100000: 93% mana bone_chilling(12), icicles(2), chain_reaction
3:46.748 frostbolt Fluffy_Pillow 1035342.0/1100000: 94% mana bone_chilling(12), chain_reaction
3:48.234 frostbolt Fluffy_Pillow 1037861.0/1100000: 94% mana bone_chilling(12), icicles, chain_reaction
3:49.719 frostbolt Fluffy_Pillow 1040363.5/1100000: 95% mana bone_chilling(12), icicles(2), chain_reaction(2)
3:51.203 water_jet Fluffy_Pillow 1042849.5/1100000: 95% mana bone_chilling(12), fingers_of_frost(2), icicles(3), chain_reaction(3)
3:51.203 frostbolt Fluffy_Pillow 1042849.5/1100000: 95% mana bone_chilling(12), fingers_of_frost(2), icicles(3), chain_reaction(3)
3:52.688 frost_bomb Fluffy_Pillow 1045352.0/1100000: 95% mana brain_freeze, bone_chilling(12), fingers_of_frost(3), icicles(5), chain_reaction(3)
3:53.806 ice_lance Fluffy_Pillow 1050049.0/1100000: 95% mana brain_freeze, bone_chilling(12), fingers_of_frost(3), icicles(5), chain_reaction(3)
3:54.923 ice_lance Fluffy_Pillow 1057479.5/1100000: 96% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), chain_reaction(3)
3:56.038 ice_lance Fluffy_Pillow 1064877.0/1100000: 97% mana brain_freeze, bone_chilling(12), fingers_of_frost, chain_reaction(3)
3:57.154 frostbolt Fluffy_Pillow 1072291.0/1100000: 97% mana brain_freeze, bone_chilling(12), chain_reaction(3)
3:58.639 flurry Fluffy_Pillow 1074793.5/1100000: 98% mana brain_freeze, bone_chilling(12), icicles, chain_reaction(3)
3:59.755 ice_lance Fluffy_Pillow 1082207.5/1100000: 98% mana bone_chilling(12), icicles
4:00.871 frostbolt Fluffy_Pillow 1089621.5/1100000: 99% mana bone_chilling(12)
4:02.356 use_item_wriggling_sinew Fluffy_Pillow 1078066.0/1100000: 98% mana bone_chilling(12), icicles
4:02.356 ebonbolt Fluffy_Pillow 1078066.0/1100000: 98% mana bone_chilling(12), icicles, maddening_whispers(10)
4:04.582 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana bone_chilling(12), fingers_of_frost(2), icicles, chain_reaction, maddening_whispers(9)
4:06.066 frost_bomb Fluffy_Pillow 1078049.5/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles(2), chain_reaction, maddening_whispers(8)
4:07.183 ice_lance Fluffy_Pillow 1082730.0/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles(2), chain_reaction(2), maddening_whispers(7)
4:08.299 frozen_touch Fluffy_Pillow 1090144.0/1100000: 99% mana brain_freeze, bone_chilling(12), fingers_of_frost, chain_reaction(2), maddening_whispers(6)
4:08.299 ice_lance Fluffy_Pillow 1090144.0/1100000: 99% mana brain_freeze, bone_chilling(12), fingers_of_frost(3), chain_reaction(2), maddening_whispers(6)
4:09.415 ice_lance Fluffy_Pillow 1097558.0/1100000: 100% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), chain_reaction(2), maddening_whispers(5)
4:10.530 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana brain_freeze, bone_chilling(12), fingers_of_frost, chain_reaction(2), maddening_whispers(4)
4:11.646 frozen_orb Fluffy_Pillow 1100000.0/1100000: 100% mana brain_freeze, bone_chilling(12), chain_reaction(2), maddening_whispers(3)
4:12.762 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana brain_freeze, bone_chilling(12), chain_reaction(2), maddening_whispers(3)
4:14.247 ice_lance Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles, maddening_whispers(3)
4:15.362 ice_lance Fluffy_Pillow 1085463.5/1100000: 99% mana brain_freeze, bone_chilling(12), fingers_of_frost, maddening_whispers
4:16.477 frostbolt Fluffy_Pillow 1092861.0/1100000: 99% mana brain_freeze, bone_chilling(12)
4:17.962 flurry Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, bone_chilling(12), icicles
4:19.077 ice_lance Fluffy_Pillow 1085463.5/1100000: 99% mana bone_chilling(12), icicles, chain_reaction
4:20.193 frostbolt Fluffy_Pillow 1092877.5/1100000: 99% mana bone_chilling(12), chain_reaction
4:21.679 water_jet Fluffy_Pillow 1078082.5/1100000: 98% mana bone_chilling(12), fingers_of_frost(2), icicles, chain_reaction
4:21.679 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana bone_chilling(12), fingers_of_frost(2), icicles, chain_reaction
4:23.164 frost_bomb Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(3), icicles(2), chain_reaction(2)
4:24.279 ice_lance Fluffy_Pillow 1082713.5/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(3), icicles(2), chain_reaction(3)
4:25.394 ice_lance Fluffy_Pillow 1090111.0/1100000: 99% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), chain_reaction(3)
4:26.510 ice_lance Fluffy_Pillow 1097525.0/1100000: 100% mana brain_freeze, bone_chilling(12), fingers_of_frost, chain_reaction(3)
4:27.624 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana brain_freeze, bone_chilling(12), chain_reaction(3)
4:29.110 flurry Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, bone_chilling(12), icicles, chain_reaction(3)
4:30.226 ice_lance Fluffy_Pillow 1085496.5/1100000: 99% mana bone_chilling(12), icicles, chain_reaction(3)
4:31.343 frostbolt Fluffy_Pillow 1092927.0/1100000: 99% mana bone_chilling(12), chain_reaction(3)
4:32.829 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, bone_chilling(12), icicles, chain_reaction(3)
4:34.314 flurry Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, bone_chilling(12), icicles(3), chain_reaction(3)
4:35.429 ice_lance Fluffy_Pillow 1085463.5/1100000: 99% mana bone_chilling(12), icicles(3), chain_reaction(3)
4:36.544 rune_of_power Fluffy_Pillow 1092861.0/1100000: 99% mana bone_chilling(12), chain_reaction(3)
4:37.660 icy_veins Fluffy_Pillow 1100000.0/1100000: 100% mana bone_chilling(12), rune_of_power, chain_reaction(3)
4:37.660 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana bone_chilling(12), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:38.805 frozen_touch Fluffy_Pillow 1078099.0/1100000: 98% mana bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:38.805 frostbolt Fluffy_Pillow 1078099.0/1100000: 98% mana bone_chilling(12), fingers_of_frost(2), icicles, icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:39.948 frost_bomb Fluffy_Pillow 1074958.5/1100000: 98% mana bone_chilling(12), fingers_of_frost(2), icicles(2), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:40.808 ice_lance Fluffy_Pillow 1075398.5/1100000: 98% mana bone_chilling(12), fingers_of_frost(2), icicles(2), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:41.666 ice_lance Fluffy_Pillow 1078555.5/1100000: 98% mana bone_chilling(12), fingers_of_frost, icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:42.526 frostbolt Fluffy_Pillow 1081745.5/1100000: 98% mana bone_chilling(12), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:43.669 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:44.812 flurry Fluffy_Pillow 1074925.5/1100000: 98% mana brain_freeze, bone_chilling(12), icicles(2), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:45.669 ice_lance Fluffy_Pillow 1078066.0/1100000: 98% mana bone_chilling(12), icicles(2), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:46.528 frostbolt Fluffy_Pillow 1081239.5/1100000: 98% mana bone_chilling(12), icicles, icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:47.673 rune_of_power Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, bone_chilling(12), icicles(2), icy_veins, chain_reaction(3), chilled_to_the_core
4:48.533 frostbolt Fluffy_Pillow 1092289.0/1100000: 99% mana brain_freeze, bone_chilling(12), icicles(2), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:49.675 flurry Fluffy_Pillow 1078049.5/1100000: 98% mana brain_freeze, bone_chilling(12), icicles(3), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:50.534 ice_lance Fluffy_Pillow 1081223.0/1100000: 98% mana bone_chilling(12), icicles(3), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:51.392 ebonbolt Fluffy_Pillow 1084380.0/1100000: 99% mana bone_chilling(12), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:53.105 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana bone_chilling(12), fingers_of_frost(2), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:54.249 water_jet Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles, icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:54.249 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icicles, icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
4:55.394 frost_bomb Fluffy_Pillow 1074975.0/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(3), icicles(2), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core
4:56.253 ice_lance Fluffy_Pillow 1075398.5/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(3), icicles(2), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core
4:57.111 ice_lance Fluffy_Pillow 1078555.5/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(3), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core
4:57.969 ice_lance Fluffy_Pillow 1081712.5/1100000: 98% mana brain_freeze, bone_chilling(12), fingers_of_frost(2), icy_veins, rune_of_power, chain_reaction
4:58.829 ice_lance Fluffy_Pillow 1084902.5/1100000: 99% mana brain_freeze, bone_chilling(12), fingers_of_frost, icy_veins, chain_reaction
4:59.687 frostbolt Fluffy_Pillow 1088059.5/1100000: 99% mana brain_freeze, bone_chilling(12), icy_veins, chain_reaction
5:00.829 time_warp Fluffy_Pillow 1078049.5/1100000: 98% mana brain_freeze, bone_chilling(12), icicles, icy_veins, chain_reaction
5:00.829 use_item_sorcerous_shadowruby_pendant Fluffy_Pillow 1034049.5/1100000: 94% mana bloodlust, brain_freeze, bone_chilling(12), icicles, icy_veins, chain_reaction
5:00.858 flurry Fluffy_Pillow 1034528.0/1100000: 94% mana bloodlust, brain_freeze, bone_chilling(12), icicles, icy_veins, chain_reaction
5:01.611 ice_lance Fluffy_Pillow 1035952.5/1100000: 94% mana bloodlust, bone_chilling(12), icicles, icy_veins
5:02.366 ice_lance Fluffy_Pillow 1037410.0/1100000: 94% mana bloodlust, bone_chilling(12), fingers_of_frost, icy_veins
5:03.121 frostbolt Fluffy_Pillow 1038867.5/1100000: 94% mana bloodlust, bone_chilling(12), icy_veins
5:04.002 frostbolt Fluffy_Pillow 1031404.0/1100000: 94% mana bloodlust, bone_chilling(12), icicles, icy_veins

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4876 4551 0
Agility 6579 6254 0
Stamina 40980 40980 25820
Intellect 37254 35548 26532 (965)
Spirit 1 1 0
Health 2458800 2458800 0
Mana 1100000 1100000 0
Spell Power 37254 35548 0
Crit 31.50% 31.50% 9276
Haste 25.01% 23.86% 7754
Damage / Heal Versatility 3.40% 3.40% 1361
ManaReg per Second 16500 16500 0
Mastery 32.92% 32.92% 2321
Armor 1810 1810 1810
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 881.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Sorcerous Shadowruby Pendant of the Fireflash
ilevel: 850, stats: { +1094 Sta, +1101 Crit, +734 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Robes of Celestial Adornment
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +855 Haste, +605 Crit }
Local Waist Pliable Spider Silk Cinch
ilevel: 880, stats: { 163 Armor, +1930 Sta, +1287 Int, +689 Mastery, +406 Crit }
Local Legs Leggings of the Lower Planes
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +1012 Crit, +448 Haste }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +735 Haste, +360 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +569 Haste, +252 Mastery }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Shard of the Exodar
ilevel: 895, stats: { +1665 Sta, +1397 Crit, +776 Haste }, enchant: { +200 Haste }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Haste }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Wriggling Sinew
ilevel: 880, stats: { +1043 Crit }
Local Back Mantle of the Victorious Dead
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Vers, +340 Haste }, enchant: { +200 Int }
Local Main Hand Ebonchill
ilevel: 906, weapon: { 5654 - 8482, 3.6 }, stats: { +2186 Int, +3279 Sta, +806 Haste, +806 Mastery, +11923 Int }

Talents

Level
15 Ray of Frost (Frost Mage) Lonely Winter (Frost Mage) Bone Chilling (Frost Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Ice Nova (Frost Mage) Frozen Touch (Frost Mage) Splitting Ice (Frost Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Frost Bomb (Frost Mage) Unstable Magic Arctic Gale (Frost Mage)
100 Thermal Void (Frost Mage) Glacial Spike (Frost Mage) Comet Storm (Frost Mage)

Profile

mage="Mage_Frost_T19M"
level=110
race=troll
role=spell
position=back
talents=3122111
artifact=53:139259:139269:139259:0:783:1:784:3:785:3:786:5:788:3:789:4:790:3:791:3:792:3:793:1:794:1:795:1:796:1:797:1:798:1:1296:1
spec=frost

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/frostbolt

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/ice_lance,if=buff.fingers_of_frost.react=0&prev_gcd.flurry
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/call_action_list,name=cooldowns
actions+=/blizzard,if=buff.potion_of_deadly_grace.up&!prev_off_gcd.water_jet
actions+=/ice_nova,if=debuff.winters_chill.up
actions+=/frostbolt,if=prev_off_gcd.water_jet
actions+=/water_jet,if=prev_gcd.frostbolt&buff.fingers_of_frost.stack<(2+artifact.icy_hand.enabled)&buff.brain_freeze.react=0
actions+=/ray_of_frost,if=buff.icy_veins.up|(cooldown.icy_veins.remains>action.ray_of_frost.cooldown&buff.rune_of_power.down)
actions+=/flurry,if=buff.brain_freeze.react&buff.fingers_of_frost.react=0&prev_gcd.frostbolt
actions+=/glacial_spike
actions+=/frozen_touch,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
actions+=/frost_bomb,if=debuff.frost_bomb.remains<action.ice_lance.travel_time&buff.fingers_of_frost.react>0
actions+=/ice_lance,if=buff.fingers_of_frost.react>0&cooldown.icy_veins.remains>10|buff.fingers_of_frost.react>2
actions+=/frozen_orb
actions+=/ice_nova
actions+=/comet_storm
actions+=/blizzard,if=talent.artic_gale.enabled
actions+=/ebonbolt,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
actions+=/frostbolt

actions.cooldowns=rune_of_power,if=cooldown.icy_veins.remains<cast_time|charges_fractional>1.9&cooldown.icy_veins.remains>10|buff.icy_veins.up|target.time_to_die.remains+5<charges_fractional*10
actions.cooldowns+=/icy_veins,if=buff.icy_veins.down
actions.cooldowns+=/mirror_image
actions.cooldowns+=/use_item,slot=neck
actions.cooldowns+=/use_item,slot=trinket2
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=deadly_grace

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=sorcerous_shadowruby_pendant,id=130233,bonus_id=1758/689/601/669,gem_id=130219,enchant=mark_of_the_hidden_satyr,enchant_id=5439
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=mantle_of_the_victorious_dead,id=142540,bonus_id=1502,enchant=binding_of_intellect
chest=robes_of_celestial_adornment,id=142410,bonus_id=1502
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1806
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=pliable_spider_silk_cinch,id=138217,bonus_id=1806
legs=leggings_of_the_lower_planes,id=142413,bonus_id=1502
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1806
finger1=shard_of_the_exodar,id=132410,enchant=binding_of_haste
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_haste
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=wriggling_sinew,id=139326,bonus_id=1806
main_hand=ebonchill,id=128862,ilevel=906

# Gear Summary
# gear_ilvl=880.73
# gear_stamina=25820
# gear_intellect=26532
# gear_crit_rating=9276
# gear_haste_rating=7754
# gear_mastery_rating=2321
# gear_versatility_rating=1361
# gear_armor=1810

Paladin_Retribution_T19M : 419688 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
419687.7 419687.7 355.2 / 0.085% 61469.3 / 14.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 1.96% 60.0 100.0% 100%
Talents
  • 15: Final Verdict (Retribution Paladin)
  • 30: The Fires of Justice (Retribution Paladin)
  • 45: Fist of Justice
  • 60: Blade of Wrath (Retribution Paladin)
  • 75: Justicar's Vengeance (Retribution Paladin)
  • 90: Divine Intervention (Retribution Paladin)
  • 100: Crusade (Retribution Paladin)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Paladin_Retribution_T19M 419688
Blade of Justice 38051 9.1% 49.0 6.10sec 233490 230452 Direct 49.0 188283 376896 233485 24.0%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.96 48.96 0.00 0.00 1.0132 0.0000 11432699.71 16807151.51 31.98 230451.52 230451.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.23 76.03% 188283.50 161318 246010 188355.68 169316 202772 7009515 10304651 31.98
crit 11.74 23.97% 376895.68 322636 492019 377104.91 322636 463789 4423185 6502500 31.98
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Strikes an enemy with the Blade of Justice, dealing ${$sw2*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Greater Blessing of Might (blessing_of_might_proc) 33130 7.9% 189.3 1.99sec 52570 0 Direct 162.7 61170 0 61170 0.0%  

Stats details: blessing_of_might_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.31 162.70 0.00 0.00 0.0000 0.0000 9952236.64 9952236.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 162.70 100.00% 61170.33 9186 1073619 61193.20 42836 86894 9952237 9952237 0.00
 
 

Action details: blessing_of_might_proc

Static Values
  • id:205729
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205729
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:
  • description:{$@spelldesc203528=Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.}
 
Brutal Haymaker 2551 (10990) 0.6% (2.6%) 4.8 54.49sec 692832 0 Direct 4.8 129605 258375 160881 24.3%  

Stats details: brutal_haymaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.77 4.77 0.00 0.00 0.0000 0.0000 766999.51 1127561.93 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.61 75.71% 129605.30 115242 175744 128624.56 0 175744 467842 687773 31.70
crit 1.16 24.29% 258375.27 230484 351488 181124.65 0 351488 299157 439789 22.40
 
 

Action details: brutal_haymaker

Static Values
  • id:214169
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214169
  • name:Brutal Haymaker
  • school:physical
  • tooltip:Damage taken from the caster increased by {$s2=15}%.
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal {$214169s1=84038} Physical damage and increase all damage the target takes from you by {$214169s2=15}% for {$214169d=15 seconds}, up to {$214169s3=315142} extra damage dealt.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:161348.62
  • base_dd_max:161348.62
 
    Brutal Haymaker (_vulnerability) 8439 2.0% 53.9 4.06sec 47044 0 Direct 51.8 48987 0 48987 0.0%  

Stats details: brutal_haymaker_vulnerability

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.91 51.78 0.00 0.00 0.0000 0.0000 2536216.99 2536216.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.78 100.00% 48986.52 9 605059 49628.22 29178 110447 2536217 2536217 0.00
 
 

Action details: brutal_haymaker_vulnerability

Static Values
  • id:228784
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228784
  • name:Brutal Haymaker
  • school:physical
  • tooltip:
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal {$214169s1=84038} Physical damage and increase all damage the target takes from you by {$214169s2=15}% for {$214169d=15 seconds}, up to {$214169s3=315142} extra damage dealt.}
 
Crusader Strike 50369 12.0% 106.2 2.82sec 142479 141085 Direct 106.2 92540 185000 142480 54.0%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.16 106.16 0.00 0.00 1.0099 0.0000 15126168.80 22236900.93 31.98 141085.21 141085.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.82 45.99% 92540.48 78894 120313 92588.64 84474 101191 4518129 6642077 31.98
crit 57.34 54.01% 185000.10 157788 240626 185087.88 170107 202963 10608040 15594823 31.98
 
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:3.500
  • base_execute_time:0.00
  • base_crit:0.30
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:Strike the target for ${$sw2*$<mult>} Physical damage.$?a231667[ Maximum 2 charges.][]{$?s85256=true}[ |cFFFFFFFFGenerates {$s3=1} Holy Power.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Templar's Verdict (echoed_verdict) 17425 4.2% 88.7 3.38sec 59008 0 Direct 88.7 47596 95155 59009 24.0%  

Stats details: echoed_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.71 88.71 0.00 0.00 0.0000 0.0000 5234800.73 5234800.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.43 76.00% 47596.10 40356 67078 47615.06 43774 51105 3209155 3209155 0.00
crit 21.29 24.00% 95155.18 80712 134157 95200.89 80712 116788 2025645 2025645 0.00
 
 

Action details: echoed_verdict

Static Values
  • id:224266
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:224266
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals $sw1 Holy damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.40
 
Judgment 29536 7.0% 34.5 8.82sec 257365 250563 Direct 34.5 207721 415598 257436 23.9%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.48 34.47 0.00 0.00 1.0272 0.0000 8872942.65 8872942.65 0.00 250563.16 250563.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.22 76.09% 207721.29 178992 311605 207783.72 184519 228790 5447356 5447356 0.00
crit 8.24 23.91% 415598.13 357983 623210 415589.17 0 551694 3425586 3425586 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 18840 4.5% 127.0 2.36sec 44555 18945 Direct 127.0 35923 71875 44554 24.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.97 126.97 0.00 0.00 2.3518 0.0000 5656898.33 8316176.38 31.98 18944.55 18944.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.48 75.99% 35923.33 30620 46696 35940.80 34324 37967 3465980 5095318 31.98
crit 30.48 24.01% 71875.02 61241 93392 71895.39 63098 82139 2190919 3220858 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 26690 6.3% 36.7 4.05sec 214844 0 Direct 36.7 172965 345789 214846 24.2%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.73 36.73 0.00 0.00 0.0000 0.0000 7892263.14 11602374.39 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.83 75.77% 172965.12 121349 185058 172945.35 162084 181872 4814155 7077264 31.98
crit 8.90 24.23% 345789.04 242699 370115 345764.09 276676 370115 3078108 4525111 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
shield_of_vengeance_proc 12437 3.0% 3.8 89.44sec 981328 0 Direct 3.6 828715 1662912 1029993 24.1%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.80 3.62 0.00 0.00 0.0000 0.0000 3726011.13 3726011.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.74 75.87% 828715.10 586677 1789365 825607.48 0 1789365 2274363 2274363 0.00
crit 0.87 24.13% 1662911.63 1173354 3578730 1062136.83 0 3578730 1451648 1451648 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:558740.00
  • base_dd_max:558740.00
 
Templar's Verdict 165105 39.4% 88.7 3.38sec 558867 548446 Direct 88.7 450492 901511 558865 24.0%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.74 88.74 0.00 0.00 1.0190 0.0000 49594300.14 49594300.14 0.00 548445.71 548445.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.42 75.97% 450491.55 322850 670783 450644.88 416705 484407 30370628 30370628 0.00
crit 21.32 24.03% 901511.08 645700 1341566 901732.76 739326 1125939 19223672 19223672 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 17116 4.1% 9.8 32.49sec 525519 508348 Direct 9.8 211136 422261 261512 23.9%  
Periodic 58.0 35861 71693 44519 24.2% 19.3%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.79 9.79 58.05 58.05 1.0338 1.0000 5143977.86 5143977.86 0.00 75460.30 508348.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.45 76.14% 211136.21 190671 290773 211121.34 190671 262411 1573561 1573561 0.00
crit 2.34 23.86% 422260.74 381342 581547 389945.73 0 581547 986195 986195 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.0 75.84% 35860.55 32267 49208 35852.32 33365 38586 1578713 1578713 0.00
crit 14.0 24.16% 71692.84 64534 98415 71668.13 64534 86154 1005509 1005509 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=0&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Paladin_Retribution_T19M
Arcane Torrent 3.7 90.59sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:155145
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<5
Spelldata
  • id:155145
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$?s137027=false}[{$s2=1} Holy Power][{$s3=3}% of your mana]. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
 
Cleansed Drake's Breath 3.1 63.59sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
Crusade 3.0 120.41sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:231895
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:holy_power>=5
Spelldata
  • id:231895
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
 
Greater Blessing of Might 1.0 0.00sec

Stats details: greater_blessing_of_might

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: greater_blessing_of_might

Static Values
  • id:203528
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
Spelldata
  • id:203528
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
 
Judgment (_aoe) 34.5 8.82sec

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield of Vengeance 3.8 90.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 3.80 3.80 0.00 0.00 0.0000 0.0000 0.00 2622255.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.90 76.40% 0.00 0 0 0.00 0 0 0 1620711 99.44
crit 0.90 23.60% 0.00 0 0 0.00 0 0 0 1001545 63.50
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade of Wrath! 25.6 8.9 11.8sec 8.7sec 32.44% 32.44% 8.9(8.9) 25.3

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_blade_of_wrath
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • blade_of_wrath_1:32.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231843
  • name:Blade of Wrath!
  • tooltip:
  • description:{$@spelldesc231832=Your auto attacks have a chance to reset the cooldown of Blade of Justice.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 25.24% 0.0(0.0) 1.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cleansed Ancient's Blessing 2.8 0.0 72.1sec 72.1sec 9.18% 9.18% 0.0(0.0) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:9.18%

Trigger Attempt Success

  • trigger_pct:95.58%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 2.8 0.0 74.0sec 74.0sec 9.05% 9.05% 0.0(0.0) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:9.05%

Trigger Attempt Success

  • trigger_pct:95.25%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 2.8 0.0 73.0sec 73.0sec 9.11% 9.11% 0.0(0.0) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.11%

Trigger Attempt Success

  • trigger_pct:95.25%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crusade 3.0 33.9 120.4sec 7.4sec 28.47% 100.00% 22.1(60.6) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.48%
  • crusade_4:2.44%
  • crusade_7:2.63%
  • crusade_10:2.82%
  • crusade_13:2.41%
  • crusade_15:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231895
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
Mark of the Claw 11.3 3.1 26.2sec 20.2sec 25.51% 25.51% 3.1(3.1) 11.1

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 121.4sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shield of Vengeance 3.8 0.0 90.0sec 90.0sec 18.46% 18.46% 0.0(0.0) 3.6

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:18.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
The Fires of Justice 15.5 0.4 18.6sec 18.1sec 9.85% 10.51% 0.4(0.4) 0.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_the_fires_of_justice
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • the_fires_of_justice_1:9.85%

Trigger Attempt Success

  • trigger_pct:14.96%

Spelldata details

  • id:209785
  • name:The Fires of Justice
  • tooltip:Your next damaging or healing Holy Power spender costs {$s2=1} less Holy Power.
  • description:{$@spelldesc203316=Reduces the cooldown of Crusader Strike by ${$m2/-1000}.1 sec and gives it a {$h=15}% chance to reduce the cost of your next damaging or healing Holy Power ability by {$209785s1=1}.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Whisper of the Nathrezim 88.7 0.0 3.4sec 3.4sec 89.77% 77.30% 0.0(0.0) 19.3

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_whisper_of_the_nathrezim
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • whisper_of_the_nathrezim_1:89.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207635
  • name:Whisper of the Nathrezim
  • tooltip:Increases damage done by your next Templar's Verdict or Divine Storm by {$s1=25}%.
  • description:{$@spelldesc207633=Templar's Verdict and Divine Storm increase the damage of your next Templar's Verdict or Divine Storm within {$207635d=4 seconds} by {$207635s1=25}%.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Blessing of Might (blessing_of_might)

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_blessing_of_might
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_might_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203528
  • name:Greater Blessing of Might
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Paladin_Retribution_T19M
templars_verdict Holy Power 88.7 250.8 2.8 2.8 197718.5
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 9.79 45.92 (18.10%) 4.69 3.02 6.18%
arcane_torrent Holy Power 3.73 3.73 (1.47%) 1.00 0.00 0.00%
crusader_strike Holy Power 106.16 106.16 (41.84%) 1.00 0.00 0.00%
blade_of_justice Holy Power 48.96 97.93 (38.59%) 2.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.84 0.83
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.92 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
the_fires_of_justice 15.9 18.1sec
blade_of_wrath 34.5 8.7sec

Statistics & Data Analysis

Fight Length
Sample Data Paladin_Retribution_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Paladin_Retribution_T19M Damage Per Second
Count 7499
Mean 419687.74
Minimum 374689.18
Maximum 475102.51
Spread ( max - min ) 100413.33
Range [ ( max - min ) / 2 * 100% ] 11.96%
Standard Deviation 15693.6462
5th Percentile 394434.74
95th Percentile 446443.89
( 95th Percentile - 5th Percentile ) 52009.15
Mean Distribution
Standard Deviation 181.2267
95.00% Confidence Intervall ( 419332.54 - 420042.93 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5371
0.1 Scale Factor Error with Delta=300 2102477
0.05 Scale Factor Error with Delta=300 8409910
0.01 Scale Factor Error with Delta=300 210247763
Priority Target DPS
Sample Data Paladin_Retribution_T19M Priority Target Damage Per Second
Count 7499
Mean 419687.74
Minimum 374689.18
Maximum 475102.51
Spread ( max - min ) 100413.33
Range [ ( max - min ) / 2 * 100% ] 11.96%
Standard Deviation 15693.6462
5th Percentile 394434.74
95th Percentile 446443.89
( 95th Percentile - 5th Percentile ) 52009.15
Mean Distribution
Standard Deviation 181.2267
95.00% Confidence Intervall ( 419332.54 - 420042.93 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5371
0.1 Scale Factor Error with Delta=300 2102477
0.05 Scale Factor Error with Delta=300 8409910
0.01 Scale Factor Error with Delta=300 210247763
DPS(e)
Sample Data Paladin_Retribution_T19M Damage Per Second (Effective)
Count 7499
Mean 419687.74
Minimum 374689.18
Maximum 475102.51
Spread ( max - min ) 100413.33
Range [ ( max - min ) / 2 * 100% ] 11.96%
Damage
Sample Data Paladin_Retribution_T19M Damage
Count 7499
Mean 125935515.64
Minimum 92826597.36
Maximum 158563405.20
Spread ( max - min ) 65736807.84
Range [ ( max - min ) / 2 * 100% ] 26.10%
DTPS
Sample Data Paladin_Retribution_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Paladin_Retribution_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Paladin_Retribution_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Paladin_Retribution_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Paladin_Retribution_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Paladin_Retribution_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Paladin_Retribution_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Paladin_Retribution_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 greater_blessing_of_might
4 0.00 snapshot_stats
5 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_attack
0.00 rebuke
7 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
0.00 holy_wrath
0.00 avenging_wrath
8 3.80 shield_of_vengeance
9 3.01 crusade,if=holy_power>=5
A 1.00 wake_of_ashes,if=holy_power>=0&time<2
0.00 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 blood_fury
0.00 berserking
B 3.73 arcane_torrent,if=holy_power<5
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
C 37.86 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
D 26.89 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
E 8.79 wake_of_ashes,if=holy_power=0|holy_power=1&(cooldown.blade_of_justice.remains>gcd|cooldown.divine_hammer.remains>gcd)|holy_power=2&(cooldown.zeal.charges_fractional<=0.65|cooldown.crusader_strike.charges_fractional<=0.65)
0.00 zeal,if=charges=2&holy_power<=4
F 55.98 crusader_strike,if=charges=2&holy_power<=4
G 48.97 blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
0.00 divine_hammer,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
H 34.48 judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
I 6.15 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
J 16.51 templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 zeal,if=holy_power<=4
K 50.19 crusader_strike,if=holy_power<=4
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
L 1.34 templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

Sample Sequence

0123568A9HCBFJGFJKKHGCFGCFGCFGHCFKIGFCFGCFHFJFGDECFGCFGHCFKJKGDHFGJFKDKKGHCKDECFGHCFKDGKKHCKJGGCFHDFKG8DKDBGFHDFDECFGHCFKDKGDHFIKGKK97HCKJGKDKDEHCFGCFJGFHJFGJFIKHKGDKKIKKDGHDFGDECFHDFGDFKKHJGK8DKGBHCFGCFDEHCFGCFKKHCGJFKDKHGKIKLKGHDECFGCFHDFKGKH9CFGCFGCFKHDGDFECFGCFHKJKGJKKHKDGK8JGKHDBFIGFDGFHDFGDFDEHCFGCFGHCFJ

Sample Sequence Table

time name target resources buffs
Pre flask Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre food Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre augmentation Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre greater_blessing_of_might Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, potion_of_the_old_war
0:00.000 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:00.900 crusade Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:00.900 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, potion_of_the_old_war
0:01.770 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, potion_of_the_old_war
0:02.641 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, potion_of_the_old_war
0:02.641 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, potion_of_the_old_war
0:03.397 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, potion_of_the_old_war
0:04.150 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(7), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:04.905 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(7), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:05.658 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(7), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:06.411 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(10), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:07.167 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:07.922 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(10), whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:08.675 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(10), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:09.431 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(10), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:10.184 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:10.938 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(13), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:11.692 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(13), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:12.448 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:13.202 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:13.957 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:14.711 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:15.464 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing, potion_of_the_old_war
0:16.218 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:16.971 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:17.725 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:18.479 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:19.234 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:19.990 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:20.745 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:21.499 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:22.254 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:23.009 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing
0:23.764 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing
0:24.517 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
0:25.272 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
0:26.026 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
0:26.780 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
0:27.534 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
0:28.288 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:29.043 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:29.796 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:30.755 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:31.509 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:32.399 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:33.288 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim
0:34.191 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, whisper_of_the_nathrezim
0:35.093 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim
0:35.994 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim
0:36.896 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim
0:37.798 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, whisper_of_the_nathrezim
0:38.700 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, whisper_of_the_nathrezim
0:39.601 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, whisper_of_the_nathrezim
0:40.501 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:41.674 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:42.845 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
0:44.014 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:45.184 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim
0:46.357 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
0:47.526 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
0:48.696 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:49.867 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim
0:51.038 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim
0:52.210 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:53.379 Waiting 0.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:53.979 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:55.307 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
0:56.478 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
0:57.648 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
0:58.816 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:59.986 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim
1:01.157 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:02.329 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
1:03.500 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:04.670 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:05.839 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
1:07.009 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:08.180 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:09.350 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:10.519 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:11.689 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:12.859 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:14.030 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:15.202 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, mark_of_the_claw
1:16.356 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, mark_of_the_claw
1:17.510 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:18.666 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:19.820 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:21.005 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
1:22.158 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
1:23.314 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:24.485 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:25.656 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
1:26.750 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
1:27.843 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
1:28.939 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim, cleansed_sisters_blessing
1:30.000 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, shield_of_vengeance, cleansed_sisters_blessing
1:30.157 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, shield_of_vengeance, cleansed_sisters_blessing
1:31.250 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:32.346 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:33.441 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:33.441 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:34.535 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:35.704 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:36.874 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, blade_of_wrath, shield_of_vengeance
1:38.044 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:39.213 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:40.383 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:41.476 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:42.570 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:43.665 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:44.759 Waiting 0.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:44.859 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:46.127 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power cleansed_sisters_blessing
1:47.222 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
1:48.316 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
1:49.410 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:50.579 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:51.734 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:52.888 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:54.043 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:55.198 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:56.352 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim
1:57.521 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
1:58.692 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
1:59.847 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
2:01.001 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, mark_of_the_claw
2:02.155 crusade Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, mark_of_the_claw
2:02.155 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, the_fires_of_justice, mark_of_the_claw
2:02.155 Waiting 0.900 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, the_fires_of_justice, mark_of_the_claw, potion_of_the_old_war
2:03.055 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, the_fires_of_justice, mark_of_the_claw, potion_of_the_old_war
2:04.366 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, the_fires_of_justice, mark_of_the_claw, potion_of_the_old_war
2:05.482 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(4), whisper_of_the_nathrezim, potion_of_the_old_war
2:06.508 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), whisper_of_the_nathrezim, potion_of_the_old_war
2:07.533 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), whisper_of_the_nathrezim, potion_of_the_old_war
2:08.474 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), whisper_of_the_nathrezim, potion_of_the_old_war
2:09.415 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:10.356 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), whisper_of_the_nathrezim, potion_of_the_old_war
2:11.224 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:12.092 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:12.897 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:13.702 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:14.507 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:15.275 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:16.044 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:16.813 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:17.582 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:18.350 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:19.120 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:19.887 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:20.656 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:21.424 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:22.191 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:22.960 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:23.730 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:24.499 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:25.268 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:26.036 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:26.793 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:27.551 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
2:28.310 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
2:29.067 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
2:29.824 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
2:30.582 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, mark_of_the_claw
2:31.340 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
2:32.100 Waiting 0.400 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
2:32.500 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
2:33.805 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim, mark_of_the_claw
2:34.957 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
2:36.113 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:37.284 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:38.453 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:39.624 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
2:40.793 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:41.965 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
2:43.262 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
2:44.432 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
2:45.602 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:46.771 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:47.941 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
2:49.111 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power the_fires_of_justice, whisper_of_the_nathrezim
2:50.282 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim
2:51.453 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
2:52.623 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
2:53.794 Waiting 0.200 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:53.994 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:55.344 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
2:56.516 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath
2:57.687 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim
2:58.858 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:00.000 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:00.030 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:01.201 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:02.372 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
3:03.543 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:03.543 Waiting 0.900 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:04.443 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, shield_of_vengeance, mark_of_the_claw
3:05.828 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, shield_of_vengeance, mark_of_the_claw
3:06.981 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:08.137 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:09.291 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:10.447 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:11.602 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:12.757 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:13.912 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:15.068 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:16.223 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:17.377 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:18.531 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw
3:19.686 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:20.856 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:22.025 Waiting 0.200 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:22.225 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:23.576 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power cleansed_wisps_blessing
3:24.747 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, cleansed_wisps_blessing
3:25.917 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing
3:27.088 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:28.260 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:29.428 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
3:30.597 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
3:31.690 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
3:32.784 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
3:33.997 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
3:35.173 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power cleansed_sisters_blessing
3:36.267 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, cleansed_sisters_blessing
3:37.361 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
3:38.455 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
3:39.551 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:40.722 Waiting 0.800 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:41.522 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:42.884 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:44.056 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
3:45.227 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:46.397 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
3:47.567 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
3:48.737 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:49.909 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:51.078 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:52.248 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:53.419 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:54.588 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:55.758 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:56.929 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
3:58.098 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
3:59.269 Waiting 2.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
4:01.369 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
4:02.746 crusade Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath
4:02.746 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, blade_of_wrath
4:03.876 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim
4:04.901 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim
4:05.928 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), whisper_of_the_nathrezim
4:06.956 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), whisper_of_the_nathrezim
4:07.896 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), blade_of_wrath, whisper_of_the_nathrezim
4:08.836 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(7), blade_of_wrath, whisper_of_the_nathrezim
4:09.778 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim
4:10.645 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), whisper_of_the_nathrezim
4:11.513 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), whisper_of_the_nathrezim
4:12.383 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim
4:13.252 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim
4:14.058 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim
4:14.864 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:15.632 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim
4:16.400 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:17.169 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:17.937 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:18.706 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:19.473 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
4:20.240 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
4:21.009 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
4:21.778 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:22.537 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:23.295 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:24.054 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:24.812 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:25.570 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:26.329 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:27.115 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:27.873 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:28.632 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:29.391 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:30.000 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:30.149 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:30.910 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:31.668 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:32.428 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:33.187 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
4:34.357 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:34.357 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:35.528 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance
4:36.699 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:37.854 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:39.009 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:40.164 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:41.319 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:42.472 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
4:43.643 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power shield_of_vengeance
4:44.815 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:45.986 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim
4:47.157 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, whisper_of_the_nathrezim
4:48.326 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
4:49.496 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
4:50.667 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
4:51.838 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
4:53.009 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
4:54.179 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
4:55.348 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:56.519 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:57.688 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:58.859 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
5:00.032 Waiting 0.900 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
5:00.932 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, blade_of_wrath
5:02.337 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, blade_of_wrath
5:03.508 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
5:04.680 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 27937 26231 14754 (12368)
Agility 3202 3202 0
Stamina 42162 42162 26174
Intellect 7331 7331 0
Spirit 2 2 0
Health 2529720 2529720 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 27937 26231 0
Crit 22.90% 22.90% 5916
Haste 28.63% 27.48% 8931
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 27937 26231 0
Mastery 37.10% 37.10% 5856
Armor 4346 4346 4346
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Crown of Steely Brambles
ilevel: 880, stats: { 593 Armor, +2573 Sta, +1715 StrInt, +949 Crit, +511 Mastery }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1448 Sta, +1115 Mastery, +939 Haste }, enchant: mark_of_the_claw
Local Shoulders Midnight Herald's Pauldrons
ilevel: 880, stats: { 547 Armor, +1930 Sta, +1287 StrInt, +735 Haste, +360 Crit }
Local Chest Horror Inscribed Chestguard
ilevel: 880, stats: { 729 Armor, +2573 Sta, +1715 StrInt, +1043 Crit, +417 Haste }
Local Waist Waistplate of Nameless Horror
ilevel: 880, stats: { 410 Armor, +1930 Sta, +1287 StrInt, +665 Haste, +430 Crit }
Local Legs Storm-Battered Legplates
ilevel: 880, stats: { 638 Armor, +2573 Sta, +1715 StrInt, +855 Haste, +605 Mastery }
Local Feet Trampling Warboots
ilevel: 880, stats: { 501 Armor, +1930 Sta, +1287 StrInt, +618 Mastery, +477 Haste }
Local Wrists Dragonbone Wristclamps
ilevel: 880, stats: { 319 Armor, +1447 Sta, +965 StrInt, +551 Mastery, +270 Haste }
Local Hands Fitted Ironbark Gauntlets
ilevel: 880, stats: { 456 Armor, +1930 Sta, +1287 StrInt, +712 Haste, +383 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Haste }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Haste }
Local Trinket1 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Trinket2 Spiked Counterweight
ilevel: 880, stats: { +1043 Haste }
Local Back Whisper of the Nathrezim
ilevel: 895, stats: { 153 Armor, +1665 Sta, +1110 StrInt, +559 Crit, +310 Haste }, enchant: { +200 Str }
Local Main Hand Ashbringer
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Seal of Light (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Paladin_Retribution_T19M"
level=110
race=blood_elf
role=attack
position=back
talents=1112112
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:44:3:47:3:49:1:50:3:51:3:52:3:53:3:54:1:350:1:351:1:352:1:353:1:1275:1
spec=retribution

head=crown_of_steely_brambles,id=139231,bonus_id=1806
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806,enchant=mark_of_the_claw
shoulders=midnight_heralds_pauldrons,id=139232,bonus_id=1806
back=whisper_of_the_nathrezim,id=137020,enchant=binding_of_strength
chest=horror_inscribed_chestguard,id=138216,bonus_id=1806
wrists=dragonbone_wristclamps,id=138218,bonus_id=1806
hands=fitted_ironbark_gauntlets,id=139225,bonus_id=1806
waist=waistplate_of_nameless_horror,id=139227,bonus_id=1806
legs=stormbattered_legplates,id=139230,bonus_id=1806
feet=trampling_warboots,id=139234,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=binding_of_haste
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=binding_of_haste
trinket1=natures_call,id=139334,bonus_id=1806
trinket2=spiked_counterweight,id=136715,bonus_id=1806
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=139265/139266/139265,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=882.73
# gear_strength=14754
# gear_stamina=26174
# gear_crit_rating=5916
# gear_haste_rating=8931
# gear_mastery_rating=5856
# gear_armor=4346

Priest_Shadow_T19M : 424440 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
424439.8 424439.8 237.6 / 0.056% 41462.5 / 9.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.16% 54.5 100.0% 100%
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Void Lord (Shadow Priest)
  • 75: Shadowy Insight (Shadow Priest)
  • 90: Power Infusion (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Priest_Shadow_T19M 424440
Deadly Grace 16471 3.8% 40.9 7.50sec 119063 0 Direct 40.9 95379 190819 119083 24.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.92 40.91 0.00 0.00 0.0000 0.0000 4872292.91 4872292.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.75 75.16% 95378.60 87090 104508 95372.15 91271 99965 2933153 2933153 0.00
crit 10.16 24.84% 190818.54 174181 209017 190836.53 174181 209017 1939139 1939139 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 92030 21.7% 110.4 2.71sec 250519 288854 Direct 111.4 198922 397743 248270 24.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.42 111.42 0.00 0.00 0.8673 0.0000 27662653.83 27662653.83 0.00 288853.72 288853.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.77 75.18% 198922.04 153942 240149 198904.56 189715 208614 16662827 16662827 0.00
crit 27.66 24.82% 397743.25 307883 480298 397685.34 358611 443084 10999827 10999827 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 33284 7.9% 76.0 3.89sec 131951 94751 Periodic 224.1 35840 71673 44731 24.8% 32.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.97 0.00 224.10 224.10 1.3926 0.4315 10024389.55 10024389.55 0.00 94751.17 94751.17
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.5 75.19% 35839.71 29483 46111 35847.73 33977 38229 6038663 6038663 0.00
crit 55.6 24.81% 71672.91 58966 92221 71686.86 65502 77768 3985726 3985726 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Plague Swarm 17669 4.2% 20.5 14.32sec 258636 0 Periodic 84.7 50296 100599 62748 24.8% 55.0%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.54 0.00 84.67 84.67 0.0000 1.9554 5312961.73 5312961.73 0.00 32090.27 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.7 75.25% 50295.80 24 57685 50311.72 46564 53590 3204395 3204395 0.00
crit 21.0 24.75% 100598.63 48 115371 100638.24 84120 113234 2108567 2108567 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 5368 1.3% 5.4 10.66sec 300249 342367 Direct 5.4 240565 481889 300242 24.7%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.36 5.36 0.00 0.00 0.8770 0.0000 1610150.15 1610150.15 0.00 342366.61 342366.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.04 75.27% 240565.17 192121 249757 240253.36 0 249757 971020 971020 0.00
crit 1.33 24.73% 481889.19 384241 499514 371974.23 0 499514 639130 639130 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 55660 (62137) 13.1% (14.6%) 3.5 107.21sec 5263656 5975927 Direct 3.5 36847 73408 46014 25.1%  
Periodic 265.2 50059 100062 62491 24.9% 98.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 3.55 265.16 265.16 0.8810 1.1174 16733453.37 16733453.37 0.00 62390.62 5975927.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.66 74.93% 36847.17 31076 63993 35948.62 0 61084 97991 97991 0.00
crit 0.89 25.07% 73408.16 62153 124107 45681.87 0 122168 65301 65301 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.2 75.14% 50059.01 38 90171 50056.05 47318 52825 9973607 9973607 0.00
crit 65.9 24.86% 100061.80 80 178404 100040.53 86588 111815 6596554 6596554 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.410000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 6477 1.5% 188.9 1.53sec 10309 0 Direct 104.3 18675 0 18675 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 188.90 104.28 0.00 0.00 0.0000 0.0000 1947295.86 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.28 100.00% 18674.78 9603 166167 18696.16 15612 22354 1947296 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 5581 1.3% 85.7 3.46sec 19579 0 Direct 84.5 15915 31834 19862 24.8%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.70 84.48 0.00 0.00 0.0000 0.0000 1677870.11 1677870.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.54 75.21% 15915.27 12315 19212 15914.99 14834 17070 1011188 1011188 0.00
crit 20.94 24.79% 31833.86 24631 38424 31832.84 27863 35561 666682 666682 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Tormenting Cyclone 9999 2.4% 15.4 18.99sec 195315 0 Direct 105.8 22767 45512 28414 24.8%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.39 105.80 0.00 0.00 0.0000 0.0000 3006273.81 3006273.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.53 75.17% 22766.54 17562 27396 22767.62 19624 25486 1810717 1810717 0.00
crit 26.27 24.83% 45511.99 35123 54792 45527.41 38134 52106 1195557 1195557 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Vampiric Touch 69537 16.4% 1.0 0.00sec 20904630 23704556 Periodic 177.4 94449 188762 117870 24.8% 99.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 177.38 177.38 0.8824 1.6808 20907417.97 20907417.97 0.00 69921.20 23704555.52
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.3 75.17% 94449.00 9562 169323 94440.79 88743 100642 12593113 12593113 0.00
crit 44.0 24.83% 188762.17 43460 331362 188743.63 158247 213402 8314305 8314305 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 64208 15.1% 75.9 3.76sec 254458 299328 Direct 75.5 204828 409645 255578 24.8%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.85 75.52 0.00 0.00 0.8501 0.0000 19301554.66 19301554.66 0.00 299327.80 299327.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.81 75.22% 204828.32 147731 230460 204816.64 198772 210847 11636088 11636088 0.00
crit 18.71 24.78% 409645.03 295462 460921 409598.07 384101 443850 7665467 7665467 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 4349 1.0% 7.3 42.56sec 178411 0 Direct 14.6 71786 143573 89604 24.8%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 14.59 0.00 0.00 0.0000 0.0000 1307097.73 1307097.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.97 75.18% 71785.81 67176 80611 71775.77 67176 77924 787271 787271 0.00
crit 3.62 24.82% 143573.27 134351 161222 141429.40 0 161222 519826 519826 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 21455 5.1% 5.1 62.68sec 1264507 299400 Periodic 40.2 128855 257529 160606 24.7% 6.7%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.11 0.00 40.20 40.20 4.2235 0.5046 6456252.85 6456252.85 0.00 299399.59 299399.59
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.3 75.33% 128855.17 194 153697 128846.24 113292 140035 3901939 3901939 0.00
crit 9.9 24.67% 257529.32 389 307394 257477.67 130035 307394 2554314 2554314 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 127761 / 9563
melee 127761 2.2% 27.9 7.01sec 102362 131951 Direct 27.9 82069 164085 102362 24.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.93 27.93 0.00 0.00 0.7758 0.0000 2859238.57 2859238.57 0.00 131950.65 131950.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.02 75.26% 82068.67 73399 84409 82030.59 78292 84409 1725169 1725169 0.00
crit 6.91 24.74% 164085.13 146798 168817 163710.35 0 168817 1134070 1134070 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 43953 / 10542
Mind Flay (_void_tendril) 43953 (50841) 2.5% (4.1%) 7.3 38.52sec 714969 80719 Periodic 65.0 39147 78294 48832 24.7% 21.6%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 0.00 64.98 64.98 8.8576 1.0000 3172942.92 3172942.92 0.00 80718.62 80718.62
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.9 75.26% 39147.00 39147 39147 39147.00 39147 39147 1914424 1914424 0.00
crit 16.1 24.74% 78294.00 78294 78294 78294.00 78294 78294 1258519 1258519 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43939 0.6% 1.8 84.63sec 433073 48919 Periodic 16.0 39147 78294 48917 25.0% 5.3%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.81 0.00 16.05 16.05 8.8533 1.0000 785102.93 785102.93 0.00 48919.12 48919.12
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.0 75.04% 39147.00 39147 39147 39053.25 0 39147 471498 471498 0.00
crit 4.0 24.96% 78294.00 78294 78294 75294.02 0 78294 313605 313605 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43855 0.4% 1.1 124.14sec 432247 49018 Periodic 9.4 39147 78294 49017 25.2% 3.1%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.07 0.00 9.40 9.40 8.8184 1.0000 460569.19 460569.19 0.00 49017.58 49017.58
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.0 74.79% 39147.00 39147 39147 38949.69 0 39147 275094 275094 0.00
crit 2.4 25.21% 78294.00 78294 78294 70559.31 0 78294 185475 185475 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43477 0.3% 1.0 0.00sec 434769 48308 Periodic 9.0 39147 78294 48308 23.4% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 434768.95 434768.95 0.00 48307.66 48307.66
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.9 76.60% 39147.00 39147 39147 39147.00 39147 39147 269877 269877 0.00
crit 2.1 23.40% 78294.00 78294 78294 72362.64 0 78294 164892 164892 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 39147 0.3% 1.0 0.00sec 391470 43497 Periodic 9.0 39147 78294 43497 11.1% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 391470.00 391470.00 0.00 43496.67 43496.67
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.0 88.89% 39147.00 39147 39147 39147.00 39147 39147 313176 313176 0.00
crit 1.0 11.11% 78294.00 78294 78294 78294.00 78294 78294 78294 78294 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Priest_Shadow_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.01sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:false
  • if_expr:
 
Mental Fortitude 177.4 1.68sec

Stats details: mental_fortitude

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 177.38 177.38 0.00 0.00 0.0000 0.0000 0.00 13054789.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.27 75.13% 0.00 0 0 0.00 0 0 0 7852614 100.00
crit 44.11 24.87% 0.00 0 0 0.00 0 0 0 5202175 100.00
 
 

Action details: mental_fortitude

Static Values
  • id:194018
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:true
  • if_expr:
Spelldata
  • id:194018
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:35012.93
  • base_dd_max:35012.93
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Power Infusion 2.7 126.19sec

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.insanity_drain_stacks.stack>=85
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
 
Shadowfiend 1.9 198.62sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.90 0.00 0.00 0.00 0.8626 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Summons a shadowy fiend to attack the target for {$d=12 seconds}.
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - shadowfiend
Shadowcrawl 3.8 66.67sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.77 0.00 0.00 0.00 0.8598 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 182.0sec 182.0sec 6.76% 8.81% 0.0(0.0) 2.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 14.50% 0.0(0.0) 1.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 7.3 188.9 42.6sec 42.6sec 69.84% 69.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:5.02%
  • insanity_drain_stacks_2:2.43%
  • insanity_drain_stacks_3:2.50%
  • insanity_drain_stacks_4:2.48%
  • insanity_drain_stacks_5:2.40%
  • insanity_drain_stacks_6:2.43%
  • insanity_drain_stacks_7:2.39%
  • insanity_drain_stacks_8:2.39%
  • insanity_drain_stacks_9:2.45%
  • insanity_drain_stacks_10:2.36%
  • insanity_drain_stacks_11:2.92%
  • insanity_drain_stacks_12:2.85%
  • insanity_drain_stacks_13:2.37%
  • insanity_drain_stacks_14:3.23%
  • insanity_drain_stacks_15:2.66%
  • insanity_drain_stacks_16:2.35%
  • insanity_drain_stacks_17:2.56%
  • insanity_drain_stacks_18:2.39%
  • insanity_drain_stacks_19:2.27%
  • insanity_drain_stacks_20:2.29%
  • insanity_drain_stacks_21:2.26%
  • insanity_drain_stacks_22:2.12%
  • insanity_drain_stacks_23:1.97%
  • insanity_drain_stacks_24:1.80%
  • insanity_drain_stacks_25:1.51%
  • insanity_drain_stacks_26:1.30%
  • insanity_drain_stacks_27:1.10%
  • insanity_drain_stacks_28:0.96%
  • insanity_drain_stacks_29:0.89%
  • insanity_drain_stacks_30:0.85%
  • insanity_drain_stacks_31:0.80%
  • insanity_drain_stacks_32:0.69%
  • insanity_drain_stacks_33:0.50%
  • insanity_drain_stacks_34:0.25%
  • insanity_drain_stacks_35:0.10%
  • insanity_drain_stacks_36:0.02%
  • insanity_drain_stacks_37:0.00%
  • insanity_drain_stacks_38:0.00%
  • insanity_drain_stacks_39:0.00%
  • insanity_drain_stacks_40:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 7.3 0.0 39.8sec 39.8sec 43.00% 86.11% 0.0(0.0) 6.1

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_20:0.01%
  • lingering_insanity_21:0.64%
  • lingering_insanity_22:3.56%
  • lingering_insanity_23:1.74%
  • lingering_insanity_24:3.70%
  • lingering_insanity_25:1.65%
  • lingering_insanity_26:0.55%
  • lingering_insanity_27:0.76%
  • lingering_insanity_28:1.47%
  • lingering_insanity_29:3.91%
  • lingering_insanity_30:2.60%
  • lingering_insanity_31:3.25%
  • lingering_insanity_32:1.56%
  • lingering_insanity_33:1.16%
  • lingering_insanity_34:1.74%
  • lingering_insanity_35:2.28%
  • lingering_insanity_36:4.99%
  • lingering_insanity_37:4.25%
  • lingering_insanity_38:2.21%
  • lingering_insanity_39:0.91%
  • lingering_insanity_40:0.06%
  • lingering_insanity_41:0.02%
  • lingering_insanity_42:0.00%
  • lingering_insanity_43:0.00%
  • lingering_insanity_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.3 3.1 26.2sec 20.2sec 25.47% 25.47% 3.1(3.1) 11.1

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Mental Fortitude 1.0 176.4 3.5sec 1.7sec 98.81% 98.81% 176.4(176.4) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • mental_fortitude_1:98.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194018
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 264.3sec 0.0sec 19.61% 19.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power Infusion 2.7 0.0 126.1sec 126.1sec 17.41% 17.41% 0.0(0.0) 2.6

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • power_infusion_1:17.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowy Insight 25.2 1.3 11.5sec 10.9sec 9.02% 9.02% 1.3(1.3) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

  • shadowy_insight_1:9.02%

Trigger Attempt Success

  • trigger_pct:10.01%

Spelldata details

  • id:162452
  • name:Shadowy Insight
  • tooltip:
  • description:Shadow Word: Pain periodic damage has a {$h=10}% chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
Sphere of Insanity 7.3 0.0 42.6sec 42.6sec 69.84% 71.07% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:69.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 1.0 196.2 0.0sec 0.5sec 35.06% 35.06% 196.2(196.2) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:35.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 5.1 0.0 62.7sec 62.7sec 6.75% 6.75% 0.0(0.0) 5.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 7.3 0.0 42.6sec 42.6sec 69.84% 73.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.43%
  • voidform_2:2.43%
  • voidform_3:2.42%
  • voidform_4:2.41%
  • voidform_5:2.41%
  • voidform_6:2.40%
  • voidform_7:2.39%
  • voidform_8:2.38%
  • voidform_9:2.37%
  • voidform_10:2.36%
  • voidform_11:2.35%
  • voidform_12:2.34%
  • voidform_13:2.33%
  • voidform_14:2.32%
  • voidform_15:2.31%
  • voidform_16:2.31%
  • voidform_17:2.30%
  • voidform_18:2.29%
  • voidform_19:2.28%
  • voidform_20:2.27%
  • voidform_21:2.26%
  • voidform_22:2.14%
  • voidform_23:1.99%
  • voidform_24:1.86%
  • voidform_25:1.70%
  • voidform_26:1.65%
  • voidform_27:1.61%
  • voidform_28:1.56%
  • voidform_29:1.41%
  • voidform_30:1.24%
  • voidform_31:1.08%
  • voidform_32:0.95%
  • voidform_33:0.88%
  • voidform_34:0.82%
  • voidform_35:0.70%
  • voidform_36:0.51%
  • voidform_37:0.26%
  • voidform_38:0.11%
  • voidform_39:0.02%
  • voidform_40:0.00%
  • voidform_41:0.00%
  • voidform_42:0.00%
  • voidform_43:0.00%
  • voidform_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend: Shadowcrawl 3.8 0.0 66.8sec 66.8sec 83.49% 78.35% 0.0(0.0) 3.7

Buff details

  • buff initial source:Priest_Shadow_T19M_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:83.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T19M
Resource Gains Type Count Total Average Overflow
Insanity Drained by Voidform Insanity 4201.55 -3193.76 (-4978.65%) -0.76 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 111.42 1319.86 (2057.49%) 11.85 17.20 1.29%
Insanity Gained from Mind Flay Insanity 224.10 448.20 (698.68%) 2.00 0.00 0.00%
Insanity Gained from Power Infusion Insanity 77.55 126.39 (197.03%) 1.63 70.25 35.73%
Insanity Gained from Shadow Word: Death Insanity 5.36 51.92 (80.93%) 9.68 1.80 3.36%
Insanity Gained from Shadow Word: Pain Casts Insanity 3.55 10.65 (16.60%) 3.00 0.00 0.00%
Insanity Gained from Vampiric Touch Casts Insanity 1.00 4.00 (6.24%) 4.00 0.00 0.00%
Insanity Gained from Void Bolt Insanity 75.85 1058.13 (1649.48%) 13.95 155.53 12.82%
Insanity Saved by Void Torrent Insanity 403.38 238.77 (372.21%) 0.59 0.00 0.00%
Health from Vampiric Touch Ticks Health 177.38 0.00 (0.00%) 0.00 10453819.43 100.00%
mp5_regen Mana 889.20 0.00 (0.00%) 0.00 2644106.07 100.00%
Resource RPS-Gain RPS-Loss
Insanity 10.83 10.62
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 64.07 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 85.7 3.5sec
Shadowy Insight Mind Blast CD Reset from Shadow Word: Pain 25.2 11.5sec
Shadowy Insight Mind Blast CD Reset lost to overflow 1.3 78.2sec
Void Eruption casted when a target with both DoTs was up 7.3 42.6sec
Void Tendril spawned from Call to the Void 8.9 31.0sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Priest_Shadow_T19M Damage Per Second
Count 7499
Mean 424439.84
Minimum 385084.39
Maximum 466834.18
Spread ( max - min ) 81749.79
Range [ ( max - min ) / 2 * 100% ] 9.63%
Standard Deviation 10497.8090
5th Percentile 408009.38
95th Percentile 441941.10
( 95th Percentile - 5th Percentile ) 33931.73
Mean Distribution
Standard Deviation 121.2263
95.00% Confidence Intervall ( 424202.24 - 424677.44 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2349
0.1 Scale Factor Error with Delta=300 940764
0.05 Scale Factor Error with Delta=300 3763058
0.01 Scale Factor Error with Delta=300 94076467
Priority Target DPS
Sample Data Priest_Shadow_T19M Priority Target Damage Per Second
Count 7499
Mean 424439.84
Minimum 385084.39
Maximum 466834.18
Spread ( max - min ) 81749.79
Range [ ( max - min ) / 2 * 100% ] 9.63%
Standard Deviation 10497.8090
5th Percentile 408009.38
95th Percentile 441941.10
( 95th Percentile - 5th Percentile ) 33931.73
Mean Distribution
Standard Deviation 121.2263
95.00% Confidence Intervall ( 424202.24 - 424677.44 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2349
0.1 Scale Factor Error with Delta=300 940764
0.05 Scale Factor Error with Delta=300 3763058
0.01 Scale Factor Error with Delta=300 94076467
DPS(e)
Sample Data Priest_Shadow_T19M Damage Per Second (Effective)
Count 7499
Mean 424439.84
Minimum 385084.39
Maximum 466834.18
Spread ( max - min ) 81749.79
Range [ ( max - min ) / 2 * 100% ] 9.63%
Damage
Sample Data Priest_Shadow_T19M Damage
Count 7499
Mean 120819664.53
Minimum 91122069.02
Maximum 155027970.12
Spread ( max - min ) 63905901.10
Range [ ( max - min ) / 2 * 100% ] 26.45%
DTPS
Sample Data Priest_Shadow_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Priest_Shadow_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Priest_Shadow_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Priest_Shadow_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 2.60 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 1.00 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 7.33 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
E 0.84 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
F 27.96 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
G 1.17 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
H 20.49 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
I 2.71 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
J 2.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
K 3.22 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
L 72.63 void_bolt
M 5.11 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
N 1.43 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
O 81.54 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
P 3.09 shadow_word_death,if=cooldown.shadow_word_death.charges=2
Q 1.90 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
R 0.95 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
S 0.00 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
T 36.33 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain

Sample Sequence

012456BCFFHFHBGDMLOOLOOIJLTLOLOLOLOLOLOLOLOLOLOLOOLOQLTFHFHFHFDTKOTLOTLOTLOMLOTLOTLOTLTFHFFFHFHDTKOTLOTLTLOOLOTLOOLTLOFHFFHGDMKORLOILTLOOLOOLOTLOTLTLOOLOTLOOLOOLTFHFHFHDOTKTLOTLOTLMLJOOLTLOOLTLOTLOFFHFHFHDTLOTLTLOOLTLOQLOTLTFFHEFHFDMKOPLOOILT7LOTLOPLOTLOOLOOLOPLOTLTLOTLNNFFFFFFHFDOO

Sample Sequence Table

time name target resources buffs
Pre flask Priest_Shadow_T19M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Priest_Shadow_T19M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Priest_Shadow_T19M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.886 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity bloodlust, potion_of_deadly_grace
0:01.774 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity bloodlust, potion_of_deadly_grace
0:02.663 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, potion_of_deadly_grace
0:03.549 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:08.201 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:09.089 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:10.675 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.0/100: 81% insanity bloodlust, shadowy_insight, potion_of_deadly_grace, mental_fortitude
0:11.561 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:12.450 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:12.450 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace, mental_fortitude
0:16.740 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.3/100: 93% insanity bloodlust, shadowy_insight, sphere_of_insanity, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace, mental_fortitude
0:17.584 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.2/100: 92% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
0:18.421 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
0:19.258 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity bloodlust, sphere_of_insanity, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace, mental_fortitude
0:20.081 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.4/100: 91% insanity bloodlust, sphere_of_insanity, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace, mental_fortitude
0:20.902 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity bloodlust, sphere_of_insanity, voidform(9), insanity_drain_stacks(6), potion_of_deadly_grace, mental_fortitude
0:21.731 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.9/100: 97% insanity bloodlust, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
0:21.731 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.9/100: 97% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
0:21.731 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.9/100: 97% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
0:22.487 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace, mental_fortitude
0:23.321 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.3/100: 88% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace, mental_fortitude
0:24.144 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(9), potion_of_deadly_grace, mental_fortitude
0:24.895 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 96% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace, mental_fortitude
0:25.788 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.9/100: 90% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
0:26.541 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.4/100: 94% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), potion_of_deadly_grace, mental_fortitude
0:27.407 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), potion_of_deadly_grace, mental_fortitude
0:28.154 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), mental_fortitude
0:28.996 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), mental_fortitude
0:29.748 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.2/100: 92% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), mental_fortitude
0:30.573 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mental_fortitude
0:31.328 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mental_fortitude
0:32.180 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mental_fortitude
0:32.930 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), mental_fortitude
0:33.829 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.8/100: 87% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mental_fortitude
0:34.583 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.3/100: 88% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), mental_fortitude
0:35.567 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mental_fortitude
0:36.322 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mental_fortitude
0:37.271 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
0:38.021 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.9/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), mark_of_the_claw, mental_fortitude
0:38.944 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), mark_of_the_claw, mental_fortitude
0:39.697 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.8/100: 85% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), mark_of_the_claw, mental_fortitude
0:40.767 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.1/100: 80% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mark_of_the_claw, mental_fortitude
0:41.522 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.2/100: 79% insanity power_infusion, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mark_of_the_claw, mental_fortitude
0:42.412 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mark_of_the_claw, mental_fortitude
0:43.289 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.7/100: 69% insanity sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mental_fortitude
0:44.170 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.2/100: 60% insanity sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mental_fortitude
0:45.037 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.6/100: 41% insanity sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mental_fortitude
0:45.899 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.6/100: 37% insanity sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mental_fortitude
0:47.930 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(36), mental_fortitude
0:48.777 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(36), mental_fortitude
0:50.267 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(36), mental_fortitude
0:51.114 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(36), mental_fortitude
0:55.219 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(36), mental_fortitude
0:56.068 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(36), mental_fortitude
1:00.088 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity lingering_insanity(36), mental_fortitude
1:00.937 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity lingering_insanity(36), mark_of_the_claw, mental_fortitude
1:00.937 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity sphere_of_insanity, voidform, lingering_insanity(36), insanity_drain_stacks, mark_of_the_claw, mental_fortitude
1:02.844 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity sphere_of_insanity, voidform(2), lingering_insanity(36), insanity_drain_stacks(2), mark_of_the_claw, mental_fortitude
1:03.656 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity sphere_of_insanity, voidform(3), lingering_insanity(36), insanity_drain_stacks(3), mark_of_the_claw, mental_fortitude
1:04.463 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity sphere_of_insanity, voidform(4), lingering_insanity(36), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
1:05.266 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.7/100: 88% insanity sphere_of_insanity, voidform(5), lingering_insanity(36), insanity_drain_stacks(5), mark_of_the_claw, mental_fortitude
1:06.062 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.2/100: 91% insanity sphere_of_insanity, voidform(6), lingering_insanity(36), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
1:06.853 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.4/100: 94% insanity sphere_of_insanity, voidform(6), lingering_insanity(36), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
1:07.646 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity sphere_of_insanity, voidform(7), lingering_insanity(36), insanity_drain_stacks(7), mental_fortitude
1:08.435 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity sphere_of_insanity, voidform(8), lingering_insanity(36), insanity_drain_stacks(8), mental_fortitude
1:09.316 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
1:10.371 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.1/100: 82% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
1:11.410 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mark_of_the_claw, mental_fortitude
1:12.435 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mark_of_the_claw, mental_fortitude
1:16.669 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.5/100: 78% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(12), mark_of_the_claw, mental_fortitude
1:17.646 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(13), mental_fortitude
1:18.631 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.5/100: 77% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(14), mental_fortitude
1:19.606 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.8/100: 66% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(15), mental_fortitude
1:20.569 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.6/100: 67% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(16), mental_fortitude
1:21.529 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.8/100: 63% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mental_fortitude
1:22.482 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.6/100: 51% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mental_fortitude
1:23.423 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(19), mental_fortitude
1:24.361 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.9/100: 45% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mental_fortitude
1:25.291 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.4/100: 31% insanity sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mental_fortitude
1:26.211 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.3/100: 30% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mental_fortitude
1:28.336 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(28), mark_of_the_claw, mental_fortitude
1:29.224 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(28), mark_of_the_claw, mental_fortitude
1:30.771 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(28), mark_of_the_claw, mental_fortitude
1:31.660 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(28), mark_of_the_claw, mental_fortitude
1:32.551 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(28), mark_of_the_claw, mental_fortitude
1:33.439 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity lingering_insanity(28), mark_of_the_claw, mental_fortitude
1:36.287 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity lingering_insanity(28), mental_fortitude
1:37.187 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity lingering_insanity(28), mental_fortitude
1:39.830 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity lingering_insanity(28), mental_fortitude
1:39.830 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity sphere_of_insanity, voidform, lingering_insanity(28), insanity_drain_stacks, mental_fortitude
1:41.830 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity sphere_of_insanity, voidform(3), lingering_insanity(28), insanity_drain_stacks(3), mental_fortitude
1:42.704 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity sphere_of_insanity, voidform(3), lingering_insanity(28), insanity_drain_stacks(3), mental_fortitude
1:43.577 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity sphere_of_insanity, voidform(4), lingering_insanity(28), insanity_drain_stacks(4), mental_fortitude
1:44.443 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.3/100: 83% insanity sphere_of_insanity, voidform(5), lingering_insanity(28), insanity_drain_stacks(5), mental_fortitude
1:45.297 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.9/100: 90% insanity sphere_of_insanity, voidform(6), lingering_insanity(28), insanity_drain_stacks(6), mental_fortitude
1:46.146 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.3/100: 92% insanity sphere_of_insanity, voidform(7), lingering_insanity(28), insanity_drain_stacks(7), mental_fortitude
1:46.989 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.1/100: 86% insanity sphere_of_insanity, voidform(8), lingering_insanity(28), insanity_drain_stacks(8), mental_fortitude
1:47.823 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity sphere_of_insanity, voidform(8), lingering_insanity(28), insanity_drain_stacks(8), mental_fortitude
1:49.713 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity shadowy_insight, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
1:50.945 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.3/100: 72% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
1:51.972 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.1/100: 70% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
1:52.992 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.4/100: 66% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:54.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.2/100: 67% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
1:55.003 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.2/100: 63% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
1:55.996 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
1:56.981 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
1:57.955 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.7/100: 46% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
1:58.924 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.6/100: 41% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
1:59.884 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.5/100: 38% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
2:02.074 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.4/100: 5% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mental_fortitude
2:03.010 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.4/100: 2% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(24), mental_fortitude
2:03.940 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(24), mental_fortitude
2:05.088 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(24), mental_fortitude
2:09.923 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:10.840 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:11.756 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:15.332 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity lingering_insanity(24), mental_fortitude
2:16.261 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:16.261 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity sphere_of_insanity, voidform, lingering_insanity(24), insanity_drain_stacks, mark_of_the_claw, mental_fortitude
2:20.452 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.2/100: 92% insanity sphere_of_insanity, voidform(5), lingering_insanity(24), insanity_drain_stacks(2), mark_of_the_claw, mental_fortitude
2:21.325 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity sphere_of_insanity, voidform(6), lingering_insanity(24), insanity_drain_stacks(3), mark_of_the_claw, mental_fortitude
2:22.191 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.3/100: 95% insanity sphere_of_insanity, voidform(6), lingering_insanity(24), insanity_drain_stacks(3), mark_of_the_claw, mental_fortitude
2:23.050 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity sphere_of_insanity, voidform(7), lingering_insanity(24), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
2:23.903 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.9/100: 91% insanity sphere_of_insanity, voidform(8), lingering_insanity(24), insanity_drain_stacks(5), mark_of_the_claw, mental_fortitude
2:25.892 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
2:25.892 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
2:26.713 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), mark_of_the_claw, mental_fortitude
2:28.612 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.6/100: 76% insanity power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), mark_of_the_claw, mental_fortitude
2:29.417 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), mark_of_the_claw, mental_fortitude
2:30.217 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.8/100: 89% insanity power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), mark_of_the_claw, mental_fortitude
2:31.179 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.5/100: 90% insanity power_infusion, shadowy_insight, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), mark_of_the_claw, mental_fortitude
2:31.963 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), mark_of_the_claw, mental_fortitude
2:32.745 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), mark_of_the_claw, mental_fortitude
2:33.525 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 91% insanity power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), mark_of_the_claw, mental_fortitude
2:34.297 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mark_of_the_claw, mental_fortitude
2:35.073 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mental_fortitude
2:35.847 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mental_fortitude
2:36.615 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), mental_fortitude
2:37.377 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.5/100: 89% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mental_fortitude
2:38.133 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mark_of_the_claw, mental_fortitude
2:38.881 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
2:40.599 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.5/100: 65% insanity power_infusion, shadowy_insight, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
2:41.353 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.2/100: 70% insanity power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), mark_of_the_claw, mental_fortitude
2:42.108 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.2/100: 70% insanity power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), mark_of_the_claw, mental_fortitude
2:42.857 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.2/100: 70% insanity power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), mark_of_the_claw, mental_fortitude
2:43.609 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.8/100: 75% insanity power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), mark_of_the_claw, mental_fortitude
2:44.366 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mental_fortitude
2:45.121 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mental_fortitude
2:45.872 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.9/100: 66% insanity power_infusion, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mental_fortitude
2:46.805 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.1/100: 58% insanity sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mental_fortitude
2:47.681 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.8/100: 50% insanity sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mental_fortitude
2:48.550 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.3/100: 46% insanity sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mental_fortitude
2:49.419 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.4/100: 37% insanity sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mental_fortitude
2:50.282 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.0/100: 29% insanity sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mental_fortitude
2:51.137 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.6/100: 25% insanity sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mental_fortitude
2:53.164 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(37), mental_fortitude
2:54.005 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(37), mental_fortitude
2:55.558 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity lingering_insanity(37), mental_fortitude
2:56.400 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity lingering_insanity(37), mental_fortitude
3:00.866 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity lingering_insanity(37), mental_fortitude
3:01.707 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity lingering_insanity(37), mental_fortitude
3:06.160 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity lingering_insanity(37), mental_fortitude
3:06.160 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity sphere_of_insanity, voidform, lingering_insanity(37), insanity_drain_stacks, mental_fortitude
3:06.994 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.8/100: 91% insanity sphere_of_insanity, voidform, lingering_insanity(37), insanity_drain_stacks, mental_fortitude
3:07.826 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.1/100: 87% insanity sphere_of_insanity, voidform(2), lingering_insanity(37), insanity_drain_stacks(2), mental_fortitude
3:08.647 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.3/100: 92% insanity sphere_of_insanity, voidform(3), lingering_insanity(37), insanity_drain_stacks(3), mental_fortitude
3:10.476 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.5/100: 81% insanity sphere_of_insanity, voidform(5), lingering_insanity(37), insanity_drain_stacks(5), mental_fortitude
3:11.278 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity sphere_of_insanity, voidform(6), lingering_insanity(37), insanity_drain_stacks(6), mental_fortitude
3:12.074 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.9/100: 92% insanity sphere_of_insanity, voidform(6), lingering_insanity(37), insanity_drain_stacks(6), mental_fortitude
3:12.868 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity sphere_of_insanity, voidform(7), lingering_insanity(37), insanity_drain_stacks(7), mental_fortitude
3:13.651 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity sphere_of_insanity, voidform(8), lingering_insanity(37), insanity_drain_stacks(8), mental_fortitude
3:14.525 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
3:15.581 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.1/100: 82% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
3:16.624 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
3:20.730 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(11), mental_fortitude
3:21.729 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(12), mental_fortitude
3:21.731 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(12), mental_fortitude
3:22.596 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.2/100: 84% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(13), mental_fortitude
3:23.453 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 83% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(14), mental_fortitude
3:24.301 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.6/100: 87% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(15), mental_fortitude
3:26.231 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.3/100: 63% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mental_fortitude
3:27.058 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.7/100: 66% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mental_fortitude
3:27.887 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.3/100: 63% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mental_fortitude
3:28.862 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.5/100: 58% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(19), mental_fortitude
3:29.673 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.1/100: 59% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mental_fortitude
3:31.437 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.3/100: 34% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mental_fortitude
3:32.305 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mental_fortitude
3:33.213 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mental_fortitude
3:34.113 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.0/100: 13% insanity twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mental_fortitude
3:35.007 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.1/100: 11% insanity twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mental_fortitude
3:35.899 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:36.786 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:37.672 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:39.299 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:40.187 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity twist_of_fate, lingering_insanity(30), mark_of_the_claw, mental_fortitude
3:43.486 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity twist_of_fate, lingering_insanity(30), mark_of_the_claw, mental_fortitude
3:44.362 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, lingering_insanity(30), mark_of_the_claw, mental_fortitude
3:45.914 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:45.914 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(30), insanity_drain_stacks, mental_fortitude
3:47.907 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.4/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(30), insanity_drain_stacks(2), mark_of_the_claw, mental_fortitude
3:48.757 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(30), insanity_drain_stacks(3), mark_of_the_claw, mental_fortitude
3:49.608 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(30), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
3:50.449 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.4/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(30), insanity_drain_stacks(5), mark_of_the_claw, mental_fortitude
3:51.279 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(30), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
3:53.136 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.5/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(30), insanity_drain_stacks(8), mental_fortitude
3:53.971 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
3:55.027 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.5/100: 80% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
3:56.190 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.2/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mark_of_the_claw, mental_fortitude
3:57.212 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.2/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mark_of_the_claw, mental_fortitude
3:59.551 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.7/100: 52% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mark_of_the_claw, mental_fortitude
4:00.544 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mark_of_the_claw, mental_fortitude
4:01.534 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mark_of_the_claw, mental_fortitude
4:02.512 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.2/100: 32% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
4:03.493 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.2/100: 31% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
4:04.470 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.6/100: 26% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
4:05.440 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.5/100: 13% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
4:06.396 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.9/100: 11% insanity twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
4:08.469 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity twist_of_fate, lingering_insanity(22), mental_fortitude
4:09.414 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity twist_of_fate, lingering_insanity(22), mental_fortitude
4:10.358 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity twist_of_fate, lingering_insanity(22), mental_fortitude
4:12.015 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity twist_of_fate, lingering_insanity(22), mental_fortitude
4:12.960 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity twist_of_fate, lingering_insanity(22), mental_fortitude
4:13.905 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, lingering_insanity(22), mark_of_the_claw, mental_fortitude
4:18.344 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, lingering_insanity(22), mark_of_the_claw, mental_fortitude
4:19.276 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, lingering_insanity(22), mark_of_the_claw, mental_fortitude
4:19.276 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(22), insanity_drain_stacks, mark_of_the_claw, mental_fortitude
4:23.576 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(22), insanity_drain_stacks(2), mental_fortitude
4:24.462 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.1/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(22), insanity_drain_stacks(3), mark_of_the_claw, mental_fortitude
4:25.344 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.1/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
4:26.215 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
4:27.079 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(22), insanity_drain_stacks(5), mark_of_the_claw, mental_fortitude
4:28.081 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
4:29.124 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
4:29.124 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
4:29.950 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), mental_fortitude
4:31.862 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), mental_fortitude
4:31.862 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace, mental_fortitude
4:32.676 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
4:33.486 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.7/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), potion_of_deadly_grace, mental_fortitude
4:34.288 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), potion_of_deadly_grace, mental_fortitude
4:35.084 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), potion_of_deadly_grace, mental_fortitude
4:35.879 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), potion_of_deadly_grace, mental_fortitude
4:36.664 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
4:37.445 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.2/100: 87% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), potion_of_deadly_grace, mental_fortitude
4:38.229 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), potion_of_deadly_grace, mental_fortitude
4:39.004 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.7/100: 82% insanity power_infusion, twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), potion_of_deadly_grace, mental_fortitude
4:39.770 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), potion_of_deadly_grace, mental_fortitude
4:40.528 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.1/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), potion_of_deadly_grace, mental_fortitude
4:41.284 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity power_infusion, twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), potion_of_deadly_grace, mental_fortitude
4:42.039 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), potion_of_deadly_grace, mental_fortitude
4:42.787 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.9/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:43.540 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.7/100: 87% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:44.293 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:45.047 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:45.796 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:46.549 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:47.302 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:48.055 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.2/100: 73% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:48.807 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), potion_of_deadly_grace, mental_fortitude
4:50.435 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.4/100: 48% insanity twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(29), potion_of_deadly_grace, mental_fortitude
4:51.307 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.9/100: 45% insanity twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), potion_of_deadly_grace, mental_fortitude
4:52.175 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.3/100: 37% insanity twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), potion_of_deadly_grace, mental_fortitude
4:53.041 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.8/100: 20% insanity twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31), potion_of_deadly_grace, mental_fortitude
4:53.897 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.4/100: 15% insanity twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(32), potion_of_deadly_grace, mental_fortitude
4:54.748 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.5/100: 5% insanity twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), potion_of_deadly_grace, mental_fortitude
4:55.595 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(37), potion_of_deadly_grace, mental_fortitude
4:56.436 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(37), potion_of_deadly_grace, mental_fortitude
4:57.277 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity twist_of_fate, lingering_insanity(37), potion_of_deadly_grace, mental_fortitude
4:58.119 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity twist_of_fate, lingering_insanity(37), potion_of_deadly_grace, mental_fortitude
4:58.959 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity twist_of_fate, lingering_insanity(37), potion_of_deadly_grace, mental_fortitude
4:59.800 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity twist_of_fate, lingering_insanity(37), potion_of_deadly_grace, mental_fortitude
5:00.644 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, lingering_insanity(37), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
5:02.133 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, lingering_insanity(37), mark_of_the_claw, mental_fortitude
5:02.965 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, lingering_insanity(37), mark_of_the_claw, mental_fortitude
5:02.965 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(37), insanity_drain_stacks, mark_of_the_claw, mental_fortitude
5:03.966 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(37), insanity_drain_stacks(2), mark_of_the_claw, mental_fortitude

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 42217 42217 26216
Intellect 39146 37440 28334 (2596)
Spirit 1 1 0
Health 2533020 2533020 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 39146 37440 0
Crit 24.40% 24.40% 6790
Haste 30.67% 29.51% 9592
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 8800 8800 0
Mastery 43.43% 43.43% 3280
Armor 1819 1819 1819
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 884.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_claw
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Dreamscale Inlaid Vestments
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +918 Haste, +542 Mastery }
Local Waist Mangaza's Madness
ilevel: 895, stats: { 172 Armor, +2219 Sta, +1479 Int, +745 Crit, +413 Haste }
Local Legs Ragged Horrorweave Leggings
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +824 Haste, +636 Mastery }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +735 Haste, +360 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +569 Haste, +252 Mastery }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Haste }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Haste }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 906, weapon: { 1922 - 3571, 1.8 }, stats: { +937 Int, +1405 Sta, +350 Crit, +337 Mastery, +11921 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Secrets of the Void
ilevel: 906, stats: { +1230 Int, +1844 Sta, +627 Haste, +278 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Priest_Shadow_T19M"
level=110
race=troll
role=spell
position=back
talents=1211311
artifact=47:139251:139257:139251:0:764:1:765:1:766:1:767:3:768:1:769:1:770:1:771:3:772:5:773:3:774:3:775:3:776:4:777:3:778:3:779:1:1347:1
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_claw
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=200int
chest=dreamscale_inlaid_vestments,id=138215,bonus_id=1806
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1806
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=mangazas_madness,id=132864
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1806
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=200haste
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200haste
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=139251/139257/139251,relic_id=1806/1806/1806
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=884.19
# gear_stamina=26216
# gear_intellect=28334
# gear_crit_rating=6790
# gear_haste_rating=9592
# gear_mastery_rating=3280
# gear_armor=1819

Priest_Shadow_T19M_S2M : 476178 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
476178.0 476178.0 858.6 / 0.180% 165627.4 / 34.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 5.47% 51.7 100.0% 100%
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Shadowy Insight (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Surrender to Madness (Shadow Priest)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Priest_Shadow_T19M_S2M 476178
Deadly Grace 18957 3.9% 46.2 6.28sec 121203 0 Direct 46.2 97185 194365 121206 24.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.16 46.16 0.00 0.00 0.0000 0.0000 5595305.51 5595305.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.75 75.28% 97184.86 79173 104508 96945.42 84931 101300 3377489 3377489 0.00
crit 11.41 24.72% 194365.07 158346 209017 193904.52 167394 209017 2217816 2217816 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 86795 18.3% 101.0 2.80sec 257840 293556 Direct 102.0 204402 408756 255310 24.9%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.02 102.02 0.00 0.00 0.8783 0.0000 26046673.01 26046673.01 0.00 293556.41 293556.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.60 75.09% 204402.26 153942 240149 204423.31 186447 214119 15657845 15657845 0.00
crit 25.42 24.91% 408755.85 307883 480298 408872.52 360767 462509 10388828 10388828 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 25375 5.3% 58.7 4.24sec 129904 90701 Periodic 171.8 35572 71151 44383 24.8% 25.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.70 0.00 171.80 171.80 1.4322 0.4493 7624849.20 7624849.20 0.00 90700.75 90700.75
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.3 75.24% 35572.13 29483 46111 35601.43 33453 38367 4597809 4597809 0.00
crit 42.5 24.76% 71151.29 58966 92221 71206.82 64284 78728 3027040 3027040 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Plague Swarm 17548 3.7% 20.3 14.29sec 258992 0 Periodic 83.7 50474 100931 62957 24.7% 54.4%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.34 0.00 83.68 83.68 0.0000 1.9561 5268528.63 5268528.63 0.00 32186.01 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.0 75.26% 50473.89 24 57685 50506.60 45377 53946 3178830 3178830 0.00
crit 20.7 24.74% 100930.91 48 115371 100979.84 81570 111875 2089699 2089699 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 8898 1.9% 8.5 10.70sec 311418 394814 Direct 8.5 249361 498711 311416 24.9%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.54 8.54 0.00 0.00 0.7889 0.0000 2658282.61 2658282.61 0.00 394813.99 394813.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 75.11% 249360.62 160101 249757 249272.33 0 249757 1598814 1598814 0.00
crit 2.12 24.89% 498710.81 320201 499514 449690.88 0 499514 1059469 1059469 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 78142 (85067) 16.4% (17.8%) 2.8 73.40sec 9206651 10173355 Direct 2.8 32468 64913 40384 24.4%  
Periodic 262.8 70911 141822 88470 24.8% 97.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 2.76 262.78 262.78 0.9051 1.1162 23359262.71 23359262.71 0.00 85981.12 10173355.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.09 75.60% 32467.53 31076 65932 30808.84 0 63993 67801 67801 0.00
crit 0.67 24.40% 64913.11 62153 129924 33935.71 0 129924 43758 43758 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 197.7 75.24% 70911.00 21 145438 71015.19 49933 86164 14019827 14019827 0.00
crit 65.1 24.76% 141821.90 43 290875 141980.27 97461 188682 9227878 9227878 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.410000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 6925 1.5% 206.1 1.35sec 10062 0 Direct 112.1 18504 0 18504 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 206.13 112.09 0.00 0.00 0.0000 0.0000 2074125.77 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.09 100.00% 18504.38 9603 164713 18519.76 15603 22221 2074126 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 5716 1.2% 84.6 3.45sec 20272 0 Direct 83.6 16421 32834 20503 24.9%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.60 83.64 0.00 0.00 0.0000 0.0000 1714933.62 1714933.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.84 75.13% 16421.14 10708 19212 16422.80 14927 17562 1031957 1031957 0.00
crit 20.80 24.87% 32834.18 21416 38424 32829.49 27166 36917 682977 682977 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Tormenting Cyclone 10206 2.1% 15.3 18.87sec 200602 0 Direct 105.3 23326 46644 29087 24.7%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.26 105.27 0.00 0.00 0.0000 0.0000 3061889.34 3061889.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.26 75.29% 23325.95 15965 27396 23336.27 19877 26164 1848798 1848798 0.00
crit 26.01 24.71% 46644.10 31930 54792 46669.41 38281 53962 1213091 1213091 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Vampiric Touch 97282 20.4% 1.2 148.01sec 24740759 27700777 Periodic 174.9 133293 266221 166276 24.8% 97.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.18 0.00 174.93 174.93 0.8932 1.6779 29085815.40 29085815.40 0.00 98744.27 27700776.58
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.5 75.19% 133292.92 53 273101 133514.21 96060 167466 17531193 17531193 0.00
crit 43.4 24.81% 266221.17 105 546202 266589.50 178820 377360 11554622 11554622 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 68987 14.5% 79.0 3.51sec 261593 300765 Direct 78.8 209891 419838 262049 24.8%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.97 78.84 0.00 0.00 0.8698 0.0000 20658625.60 20658625.60 0.00 300764.71 300764.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.25 75.16% 209891.32 147731 230460 209792.06 192050 215891 12436054 12436054 0.00
crit 19.59 24.84% 419838.43 295462 460921 419630.90 384101 455012 8222572 8222572 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 2873 0.6% 5.2 38.75sec 167880 0 Direct 10.3 67269 134532 83941 24.8%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.17 10.34 0.00 0.00 0.0000 0.0000 867830.24 867830.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.78 75.21% 67268.51 67176 80611 67246.84 67176 71014 523096 523096 0.00
crit 2.56 24.79% 134531.69 134351 161222 126821.37 0 161222 344734 344734 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 14954 3.2% 3.3 78.67sec 1398016 329774 Periodic 28.0 131597 263112 164173 24.8% 4.4%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.28 0.00 27.95 27.95 4.2394 0.4684 4589458.69 4589458.69 0.00 329773.56 329773.56
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.0 75.23% 131597.03 197 153697 132437.54 98412 151368 2767489 2767489 0.00
crit 6.9 24.77% 263112.09 523 307394 263701.32 0 307394 1821970 1821970 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - mindbender 94181 / 22664
melee 94181 4.8% 82.4 3.24sec 82704 96875 Direct 82.4 66272 132553 82704 24.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.36 82.36 0.00 0.00 0.8537 0.0000 6811596.23 6811596.23 0.00 96875.35 96875.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.94 75.21% 66272.01 58719 67527 66268.61 65479 67107 4105032 4105032 0.00
crit 20.42 24.79% 132553.21 117438 135054 132535.25 125267 135054 2706565 2706565 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 43916 / 9000
Mind Flay (_void_tendril) 43916 (49307) 1.9% (3.0%) 6.2 40.09sec 698745 77929 Periodic 55.5 39147 78294 48800 24.7% 18.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.19 0.00 55.54 55.54 8.9665 1.0000 2710440.35 2710440.35 0.00 77928.88 77928.88
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.8 75.34% 39147.00 39147 39147 39147.00 39147 39147 1638212 1638212 0.00
crit 13.7 24.66% 78294.00 78294 78294 78294.00 78294 78294 1072228 1072228 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43932 0.5% 1.6 84.63sec 438915 48838 Periodic 14.5 39147 78294 48836 24.7% 4.8%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.62 0.00 14.54 14.54 8.9877 1.0000 710001.88 710001.88 0.00 48837.66 48837.66
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.9 75.25% 39147.00 39147 39147 39125.02 0 39147 428302 428302 0.00
crit 3.6 24.75% 78294.00 78294 78294 74938.33 0 78294 281700 281700 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43956 0.3% 1.0 102.54sec 439466 48895 Periodic 9.4 39147 78294 48890 24.9% 3.1%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.05 0.00 9.42 9.42 8.9889 1.0000 460392.90 460392.90 0.00 48894.74 48894.74
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.1 75.11% 39147.00 39147 39147 39096.62 0 39147 276901 276901 0.00
crit 2.3 24.89% 78294.00 78294 78294 72248.13 0 78294 183492 183492 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 44749 0.3% 1.0 0.00sec 447491 49721 Periodic 9.0 39147 78294 49721 27.0% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 447490.71 447490.71 0.00 49721.19 49721.19
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.6 72.99% 39147.00 39147 39147 39147.00 39147 39147 257155 257155 0.00
crit 2.4 27.01% 78294.00 78294 78294 74244.31 0 78294 190335 190335 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Priest_Shadow_T19M_S2M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:false
  • if_expr:
 
Berserking 1.5 261.15sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dispersion 2.0 90.18sec

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.95 0.00 11.73 0.00 6.2507 1.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage taken by {$s1=60}%. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:Disperse into pure Shadow energy for {$d=6 seconds}, reducing all damage you take by {$47585s1=60}%, but you are unable to attack or cast spells. Castable while stunned, feared, or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed. Voidform does not drain Insanity while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:false
  • if_expr:
 
Mental Fortitude 174.9 1.68sec

Stats details: mental_fortitude

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 174.93 174.93 0.00 0.00 0.0000 0.0000 0.00 18151123.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.58 75.22% 0.00 0 0 0.00 0 0 0 10934669 100.00
crit 43.34 24.78% 0.00 0 0 0.00 0 0 0 7216455 100.00
 
 

Action details: mental_fortitude

Static Values
  • id:194018
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:true
  • if_expr:
Spelldata
  • id:194018
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:30442.82
  • base_dd_max:30442.82
 
Mindbender 5.0 64.32sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.9405 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
Surrender to Madness 1.0 0.00sec

Stats details: surrender_to_madness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: surrender_to_madness

Static Values
  • id:193223
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
Spelldata
  • id:193223
  • name:Surrender to Madness
  • school:physical
  • tooltip:Generating {$s1=150}% more Insanity. When you exit Voidform, you will die.
  • description:All your Insanity-generating abilities generate {$s1=150}% more Insanity, and you can cast while moving, until you exit Voidform. Then you die. Horribly.
 
pet - mindbender
Shadowcrawl 14.6 19.38sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 0.00 0.00 0.00 0.9136 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Well Fed (azshari_salad) 1.0 0.0 0.0sec 0.0sec 94.84% 94.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:94.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 1.5 0.0 261.0sec 261.0sec 4.80% 6.13% 0.0(0.0) 1.5

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:4.80%

Trigger Attempt Success

  • trigger_pct:97.68%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 14.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 94.84% 94.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:94.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dispersion 2.0 0.0 0.0sec 0.0sec 3.97% 3.97% 11.7(11.7) 2.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_dispersion
  • max_stacks:1
  • duration:6.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • dispersion_1:3.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:47585
  • name:Dispersion
  • tooltip:Reduces all damage taken by {$s1=60}%. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:Disperse into pure Shadow energy for {$d=6 seconds}, reducing all damage you take by {$47585s1=60}%, but you are unable to attack or cast spells. Castable while stunned, feared, or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed. Voidform does not drain Insanity while dispersed.
  • max_stacks:0
  • duration:6.00
  • cooldown:120.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 94.84% 94.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:94.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
insanity_drain_stacks 5.2 200.2 38.7sec 38.7sec 75.36% 75.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.32%
  • insanity_drain_stacks_2:2.16%
  • insanity_drain_stacks_3:2.93%
  • insanity_drain_stacks_4:1.86%
  • insanity_drain_stacks_5:1.71%
  • insanity_drain_stacks_6:1.71%
  • insanity_drain_stacks_7:1.72%
  • insanity_drain_stacks_8:1.72%
  • insanity_drain_stacks_9:1.72%
  • insanity_drain_stacks_10:1.72%
  • insanity_drain_stacks_11:1.75%
  • insanity_drain_stacks_12:1.76%
  • insanity_drain_stacks_13:1.73%
  • insanity_drain_stacks_14:1.78%
  • insanity_drain_stacks_15:1.79%
  • insanity_drain_stacks_16:1.77%
  • insanity_drain_stacks_17:1.80%
  • insanity_drain_stacks_18:1.79%
  • insanity_drain_stacks_19:1.74%
  • insanity_drain_stacks_20:1.76%
  • insanity_drain_stacks_21:1.65%
  • insanity_drain_stacks_22:1.45%
  • insanity_drain_stacks_23:1.44%
  • insanity_drain_stacks_24:1.24%
  • insanity_drain_stacks_25:1.21%
  • insanity_drain_stacks_26:1.10%
  • insanity_drain_stacks_27:0.96%
  • insanity_drain_stacks_28:0.82%
  • insanity_drain_stacks_29:0.67%
  • insanity_drain_stacks_30:0.54%
  • insanity_drain_stacks_31:0.44%
  • insanity_drain_stacks_32:0.38%
  • insanity_drain_stacks_33:0.35%
  • insanity_drain_stacks_34:0.34%
  • insanity_drain_stacks_35:0.34%
  • insanity_drain_stacks_36:0.34%
  • insanity_drain_stacks_37:0.34%
  • insanity_drain_stacks_38:0.34%
  • insanity_drain_stacks_39:0.34%
  • insanity_drain_stacks_40:0.34%
  • insanity_drain_stacks_41:0.34%
  • insanity_drain_stacks_42:0.34%
  • insanity_drain_stacks_43:0.34%
  • insanity_drain_stacks_44:0.34%
  • insanity_drain_stacks_45:0.34%
  • insanity_drain_stacks_46:0.34%
  • insanity_drain_stacks_47:0.34%
  • insanity_drain_stacks_48:0.34%
  • insanity_drain_stacks_49:0.34%
  • insanity_drain_stacks_50:0.34%
  • insanity_drain_stacks_51:0.34%
  • insanity_drain_stacks_52:0.34%
  • insanity_drain_stacks_53:0.34%
  • insanity_drain_stacks_54:0.34%
  • insanity_drain_stacks_55:0.34%
  • insanity_drain_stacks_56:0.34%
  • insanity_drain_stacks_57:0.34%
  • insanity_drain_stacks_58:0.34%
  • insanity_drain_stacks_59:1.09%
  • insanity_drain_stacks_60:0.90%
  • insanity_drain_stacks_61:0.37%
  • insanity_drain_stacks_62:0.34%
  • insanity_drain_stacks_63:0.34%
  • insanity_drain_stacks_64:0.34%
  • insanity_drain_stacks_65:0.34%
  • insanity_drain_stacks_66:0.34%
  • insanity_drain_stacks_67:0.34%
  • insanity_drain_stacks_68:0.34%
  • insanity_drain_stacks_69:0.34%
  • insanity_drain_stacks_70:0.34%
  • insanity_drain_stacks_71:0.34%
  • insanity_drain_stacks_72:0.33%
  • insanity_drain_stacks_73:0.33%
  • insanity_drain_stacks_74:0.33%
  • insanity_drain_stacks_75:0.33%
  • insanity_drain_stacks_76:0.33%
  • insanity_drain_stacks_77:0.33%
  • insanity_drain_stacks_78:2.18%
  • insanity_drain_stacks_79:0.32%
  • insanity_drain_stacks_80:0.32%
  • insanity_drain_stacks_81:0.32%
  • insanity_drain_stacks_82:0.31%
  • insanity_drain_stacks_83:0.31%
  • insanity_drain_stacks_84:0.31%
  • insanity_drain_stacks_85:0.31%
  • insanity_drain_stacks_86:0.31%
  • insanity_drain_stacks_87:0.31%
  • insanity_drain_stacks_88:0.31%
  • insanity_drain_stacks_89:0.31%
  • insanity_drain_stacks_90:0.31%
  • insanity_drain_stacks_91:0.31%
  • insanity_drain_stacks_92:0.30%
  • insanity_drain_stacks_93:0.30%
  • insanity_drain_stacks_94:0.29%
  • insanity_drain_stacks_95:0.27%
  • insanity_drain_stacks_96:0.23%
  • insanity_drain_stacks_97:0.16%
  • insanity_drain_stacks_98:0.12%
  • insanity_drain_stacks_99:0.08%
  • insanity_drain_stacks_100:0.08%
  • insanity_drain_stacks_101:0.07%
  • insanity_drain_stacks_102:0.07%
  • insanity_drain_stacks_103:0.06%
  • insanity_drain_stacks_104:0.06%
  • insanity_drain_stacks_105:0.05%
  • insanity_drain_stacks_106:0.05%
  • insanity_drain_stacks_107:0.04%
  • insanity_drain_stacks_108:0.04%
  • insanity_drain_stacks_109:0.05%
  • insanity_drain_stacks_110:0.06%
  • insanity_drain_stacks_111:0.03%
  • insanity_drain_stacks_112:0.01%
  • insanity_drain_stacks_113:0.00%
  • insanity_drain_stacks_114:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 5.2 0.0 58.9sec 58.9sec 16.78% 16.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_19:0.06%
  • lingering_insanity_20:0.46%
  • lingering_insanity_21:1.70%
  • lingering_insanity_22:0.86%
  • lingering_insanity_23:1.31%
  • lingering_insanity_24:0.92%
  • lingering_insanity_25:0.63%
  • lingering_insanity_26:1.25%
  • lingering_insanity_27:1.80%
  • lingering_insanity_28:1.30%
  • lingering_insanity_29:1.23%
  • lingering_insanity_30:0.84%
  • lingering_insanity_31:0.61%
  • lingering_insanity_32:0.78%
  • lingering_insanity_33:0.82%
  • lingering_insanity_34:0.91%
  • lingering_insanity_35:0.65%
  • lingering_insanity_36:0.41%
  • lingering_insanity_37:0.18%
  • lingering_insanity_38:0.04%
  • lingering_insanity_39:0.01%
  • lingering_insanity_40:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.2 3.0 26.2sec 20.3sec 25.02% 25.02% 3.0(3.0) 10.8

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Mental Fortitude 1.8 173.1 278.0sec 1.7sec 98.36% 98.36% 173.1(173.1) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • mental_fortitude_1:98.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194018
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 254.7sec 0.0sec 19.06% 19.06% 0.0(0.0) 1.6

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 94.84% 94.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:94.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 24.1 2.2 11.8sec 10.8sec 13.23% 13.23% 2.2(2.2) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

  • shadowy_insight_1:13.23%

Trigger Attempt Success

  • trigger_pct:10.02%

Spelldata details

  • id:162452
  • name:Shadowy Insight
  • tooltip:
  • description:Shadow Word: Pain periodic damage has a {$h=10}% chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
Sphere of Insanity 5.2 0.0 38.7sec 38.7sec 75.36% 78.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:75.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Surrender to Madness 1.0 0.0 0.0sec 0.0sec 40.45% 45.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_surrender_to_madness
  • max_stacks:1
  • duration:180.00
  • cooldown:600.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • surrender_to_madness_1:40.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193223
  • name:Surrender to Madness
  • tooltip:Generating {$s1=150}% more Insanity. When you exit Voidform, you will die.
  • description:All your Insanity-generating abilities generate {$s1=150}% more Insanity, and you can cast while moving, until you exit Voidform. Then you die. Horribly.
  • max_stacks:0
  • duration:180.00
  • cooldown:600.00
  • default_chance:0.00%
Surrender to Madness (_death) 0.8 0.0 0.0sec 0.0sec 5.16% 5.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_surrender_to_madness_death
  • max_stacks:1
  • duration:0.00
  • cooldown:600.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • surrender_to_madness_death_1:5.16%

Trigger Attempt Success

  • trigger_pct:81.37%

Spelldata details

  • id:193223
  • name:Surrender to Madness
  • tooltip:Generating {$s1=150}% more Insanity. When you exit Voidform, you will die.
  • description:All your Insanity-generating abilities generate {$s1=150}% more Insanity, and you can cast while moving, until you exit Voidform. Then you die. Horribly.
  • max_stacks:0
  • duration:180.00
  • cooldown:600.00
  • default_chance:0.00%
Twist of Fate 1.9 225.9 79.1sec 0.4sec 34.17% 34.17% 225.9(225.9) 0.2

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:34.17%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 3.3 0.0 78.7sec 78.7sec 4.25% 4.25% 0.0(0.0) 3.3

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:4.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 5.2 0.0 38.7sec 38.7sec 75.36% 80.37% 6.8(6.8) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:3.03%
  • voidform_2:2.15%
  • voidform_3:1.71%
  • voidform_4:1.71%
  • voidform_5:1.71%
  • voidform_6:1.71%
  • voidform_7:1.71%
  • voidform_8:1.71%
  • voidform_9:1.71%
  • voidform_10:1.71%
  • voidform_11:1.71%
  • voidform_12:1.71%
  • voidform_13:1.71%
  • voidform_14:1.71%
  • voidform_15:1.71%
  • voidform_16:1.71%
  • voidform_17:1.71%
  • voidform_18:1.71%
  • voidform_19:1.71%
  • voidform_20:1.69%
  • voidform_21:1.59%
  • voidform_22:1.45%
  • voidform_23:1.38%
  • voidform_24:1.25%
  • voidform_25:1.18%
  • voidform_26:1.10%
  • voidform_27:0.97%
  • voidform_28:0.86%
  • voidform_29:0.76%
  • voidform_30:0.68%
  • voidform_31:0.64%
  • voidform_32:0.59%
  • voidform_33:0.53%
  • voidform_34:0.46%
  • voidform_35:0.40%
  • voidform_36:0.37%
  • voidform_37:0.35%
  • voidform_38:0.34%
  • voidform_39:0.34%
  • voidform_40:0.34%
  • voidform_41:0.34%
  • voidform_42:0.34%
  • voidform_43:0.34%
  • voidform_44:0.34%
  • voidform_45:0.34%
  • voidform_46:0.34%
  • voidform_47:0.34%
  • voidform_48:0.34%
  • voidform_49:0.34%
  • voidform_50:0.34%
  • voidform_51:0.34%
  • voidform_52:0.34%
  • voidform_53:0.34%
  • voidform_54:0.34%
  • voidform_55:0.34%
  • voidform_56:0.34%
  • voidform_57:0.34%
  • voidform_58:0.34%
  • voidform_59:0.34%
  • voidform_60:0.34%
  • voidform_61:0.34%
  • voidform_62:0.34%
  • voidform_63:0.34%
  • voidform_64:0.34%
  • voidform_65:0.34%
  • voidform_66:0.34%
  • voidform_67:0.34%
  • voidform_68:0.34%
  • voidform_69:0.34%
  • voidform_70:0.34%
  • voidform_71:0.34%
  • voidform_72:0.34%
  • voidform_73:0.34%
  • voidform_74:0.34%
  • voidform_75:0.34%
  • voidform_76:0.34%
  • voidform_77:0.34%
  • voidform_78:0.34%
  • voidform_79:0.34%
  • voidform_80:0.33%
  • voidform_81:0.33%
  • voidform_82:0.33%
  • voidform_83:0.33%
  • voidform_84:0.33%
  • voidform_85:0.33%
  • voidform_86:2.18%
  • voidform_87:0.32%
  • voidform_88:0.32%
  • voidform_89:0.32%
  • voidform_90:0.31%
  • voidform_91:0.31%
  • voidform_92:0.31%
  • voidform_93:0.31%
  • voidform_94:0.31%
  • voidform_95:0.31%
  • voidform_96:0.31%
  • voidform_97:0.31%
  • voidform_98:0.31%
  • voidform_99:0.31%
  • voidform_100:2.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: Shadowcrawl 14.6 0.0 19.4sec 19.4sec 86.70% 85.72% 0.0(0.0) 9.6

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T19M_S2M
Resource Gains Type Count Total Average Overflow
Insanity Saved by Dispersion Insanity 233.47 322.15 (3181.55%) 1.38 0.00 0.00%
Insanity Drained by Voidform Insanity 4522.03 -5350.20 (-52838.98%) -1.18 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 102.02 1183.69 (11690.20%) 11.60 40.54 3.31%
Insanity Gained from Mind Flay Insanity 171.80 339.31 (3351.03%) 1.98 4.28 1.25%
Insanity Gained from Mindbender Insanity 82.36 281.38 (2778.91%) 3.42 48.07 14.59%
Insanity Gained from Shadow Word: Death Insanity 8.54 195.25 (1928.27%) 22.87 60.84 23.76%
Insanity Gained from Shadow Word: Pain Casts Insanity 2.76 6.08 (60.08%) 2.20 2.20 26.59%
Insanity Gained from Surrender to Madness Insanity 169.16 1662.92 (16423.11%) 9.83 891.67 34.90%
Insanity Gained from Vampiric Touch Casts Insanity 1.18 4.36 (43.11%) 3.71 0.34 7.18%
Insanity Gained from Void Bolt Insanity 78.97 1084.98 (10715.39%) 13.74 178.57 14.13%
Insanity Saved by Void Torrent Insanity 261.51 280.20 (2767.32%) 1.07 0.00 0.00%
Health from Vampiric Touch Ticks Health 174.93 0.00 (0.00%) 0.00 14543066.92 100.00%
mp5_regen Mana 1017.85 0.00 (0.00%) 0.00 2644651.60 100.00%
Resource RPS-Gain RPS-Loss
Insanity 17.82 17.79
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 10.50 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 84.6 3.5sec
Shadowy Insight Mind Blast CD Reset from Shadow Word: Pain 24.1 11.8sec
Shadowy Insight Mind Blast CD Reset lost to overflow 2.2 59.6sec
Void Eruption casted when a target with both DoTs was up 5.2 38.7sec
Void Tendril spawned from Call to the Void 7.5 32.5sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T19M_S2M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Priest_Shadow_T19M_S2M Damage Per Second
Count 7499
Mean 476178.05
Minimum 228221.14
Maximum 584556.56
Spread ( max - min ) 356335.42
Range [ ( max - min ) / 2 * 100% ] 37.42%
Standard Deviation 37936.1590
5th Percentile 386301.97
95th Percentile 525267.33
( 95th Percentile - 5th Percentile ) 138965.36
Mean Distribution
Standard Deviation 438.0782
95.00% Confidence Intervall ( 475319.43 - 477036.66 )
Normalized 95.00% Confidence Intervall ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 243
0.1% Error 24381
0.1 Scale Factor Error with Delta=300 12285430
0.05 Scale Factor Error with Delta=300 49141722
0.01 Scale Factor Error with Delta=300 1228543061
Priority Target DPS
Sample Data Priest_Shadow_T19M_S2M Priority Target Damage Per Second
Count 7499
Mean 476178.05
Minimum 228221.14
Maximum 584556.56
Spread ( max - min ) 356335.42
Range [ ( max - min ) / 2 * 100% ] 37.42%
Standard Deviation 37936.1590
5th Percentile 386301.97
95th Percentile 525267.33
( 95th Percentile - 5th Percentile ) 138965.36
Mean Distribution
Standard Deviation 438.0782
95.00% Confidence Intervall ( 475319.43 - 477036.66 )
Normalized 95.00% Confidence Intervall ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 243
0.1% Error 24381
0.1 Scale Factor Error with Delta=300 12285430
0.05 Scale Factor Error with Delta=300 49141722
0.01 Scale Factor Error with Delta=300 1228543061
DPS(e)
Sample Data Priest_Shadow_T19M_S2M Damage Per Second (Effective)
Count 7499
Mean 476178.05
Minimum 228221.14
Maximum 584556.56
Spread ( max - min ) 356335.42
Range [ ( max - min ) / 2 * 100% ] 37.42%
Damage
Sample Data Priest_Shadow_T19M_S2M Damage
Count 7499
Mean 132605580.34
Minimum 51586661.68
Maximum 173972784.14
Spread ( max - min ) 122386122.46
Range [ ( max - min ) / 2 * 100% ] 46.15%
DTPS
Sample Data Priest_Shadow_T19M_S2M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T19M_S2M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Priest_Shadow_T19M_S2M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T19M_S2M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T19M_S2M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T19M_S2M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Priest_Shadow_T19M_S2MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Priest_Shadow_T19M_S2M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
B 1.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
C 1.06 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
D 2.56 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
E 1.10 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
F 5.17 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
G 0.02 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
0.00 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
H 19.29 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
I 12.86 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain
actions.s2m
# count action,conditions
0.00 shadow_crash,if=talent.shadow_crash.enabled
J 1.93 mindbender,if=talent.mindbender.enabled
K 1.96 dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
0.00 power_infusion,if=buff.insanity_drain_stacks.stack>=85
L 0.93 berserking,if=buff.voidform.stack>=90
M 0.04 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
N 0.64 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
O 42.58 void_bolt
P 2.06 void_torrent
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
Q 3.58 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
R 43.82 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
S 4.93 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
T 0.13 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
U 0.07 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
V 11.06 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
actions.vf
# count action,conditions
W 0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
X 1.54 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
Y 0.55 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
Z 1.31 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
a 34.50 void_bolt
0.00 void_torrent,if=!talent.surrender_to_madness.enabled
b 1.22 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
c 0.01 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
d 38.44 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
e 0.00 shadow_word_death,if=cooldown.shadow_word_death.charges=2
f 0.47 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
g 0.07 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
h 0.00 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
i 23.37 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain

Sample Sequence

012456CDEHHIHFiaddaiadiadiaiadiadiadiabaddadYdadadIHIHIHIHFiZiXaddadiadiaddaiadiadHHHIHHIFdZiadiadiaddaiaddHHHIHIHFiZiaddaddaiadXadiaiHIHHHIFiadiadiadiaiadiadiBIHIHFKNPORRORRJOSROVORVORSOVORRORRORSOVORRORVORSORVOVORVORSORVOVORPORRORROSRJORRO7RROVORSORKORROLROROQOROROQOROROQOROR

Sample Sequence Table

time name target resources buffs
Pre flask Priest_Shadow_T19M_S2M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Priest_Shadow_T19M_S2M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Priest_Shadow_T19M_S2M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.886 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity bloodlust, potion_of_deadly_grace
0:01.774 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity bloodlust, potion_of_deadly_grace
0:02.663 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity bloodlust, potion_of_deadly_grace
0:03.550 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity bloodlust, potion_of_deadly_grace
0:04.440 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:07.275 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:08.164 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:08.164 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace, mental_fortitude
0:10.176 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.2/100: 97% insanity bloodlust, sphere_of_insanity, voidform(3), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
0:11.037 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 96% insanity bloodlust, sphere_of_insanity, voidform(3), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
0:11.889 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 96% insanity bloodlust, sphere_of_insanity, voidform(4), insanity_drain_stacks(4), potion_of_deadly_grace, mental_fortitude
0:12.940 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, sphere_of_insanity, voidform(5), insanity_drain_stacks(5), potion_of_deadly_grace, mental_fortitude
0:13.780 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(6), potion_of_deadly_grace, mental_fortitude
0:15.624 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity bloodlust, sphere_of_insanity, voidform(8), insanity_drain_stacks(8), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:16.432 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity bloodlust, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:17.236 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity bloodlust, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:18.033 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity bloodlust, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:18.824 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity bloodlust, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:19.613 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity bloodlust, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:20.396 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity bloodlust, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:21.175 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.9/100: 87% insanity bloodlust, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), potion_of_deadly_grace, mental_fortitude
0:22.945 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.9/100: 68% insanity bloodlust, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
0:23.711 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.9/100: 72% insanity bloodlust, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), potion_of_deadly_grace, mental_fortitude
0:24.477 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.7/100: 71% insanity bloodlust, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), potion_of_deadly_grace, mental_fortitude
0:25.238 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity bloodlust, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace, mental_fortitude
0:25.992 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.3/100: 65% insanity bloodlust, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace, mental_fortitude
0:26.744 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.9/100: 64% insanity bloodlust, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), potion_of_deadly_grace, mental_fortitude
0:27.496 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.4/100: 54% insanity bloodlust, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), potion_of_deadly_grace, mental_fortitude
0:28.250 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.8/100: 57% insanity bloodlust, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
0:29.000 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.6/100: 55% insanity bloodlust, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mark_of_the_claw, mental_fortitude
0:29.749 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.3/100: 44% insanity bloodlust, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
0:30.498 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.7/100: 46% insanity bloodlust, shadowy_insight, sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mark_of_the_claw, mental_fortitude
0:34.845 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.7/100: 39% insanity bloodlust, shadowy_insight, sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mental_fortitude
0:35.596 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.7/100: 40% insanity bloodlust, sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mental_fortitude
0:36.347 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.5/100: 37% insanity bloodlust, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mental_fortitude
0:37.102 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.8/100: 33% insanity bloodlust, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mental_fortitude
0:37.852 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity bloodlust, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mental_fortitude
0:38.599 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.8/100: 29% insanity bloodlust, sphere_of_insanity, voidform(31), insanity_drain_stacks(27), mark_of_the_claw, mental_fortitude
0:38.599 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.8/100: 29% insanity bloodlust, berserking, sphere_of_insanity, voidform(31), insanity_drain_stacks(27), mark_of_the_claw, mental_fortitude
0:39.351 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.3/100: 24% insanity bloodlust, berserking, sphere_of_insanity, voidform(32), insanity_drain_stacks(28), mark_of_the_claw, mental_fortitude
0:40.136 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.7/100: 23% insanity berserking, sphere_of_insanity, voidform(32), insanity_drain_stacks(28), mark_of_the_claw, mental_fortitude
0:41.384 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity berserking, sphere_of_insanity, voidform(34), insanity_drain_stacks(30), mark_of_the_claw, mental_fortitude
0:42.139 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.7/100: 5% insanity berserking, sphere_of_insanity, voidform(34), insanity_drain_stacks(30), mark_of_the_claw, mental_fortitude
0:42.888 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity berserking, lingering_insanity(35), mark_of_the_claw, mental_fortitude
0:45.271 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity berserking, lingering_insanity(35), mental_fortitude
0:46.026 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity berserking, lingering_insanity(35), mental_fortitude
0:47.378 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity berserking, lingering_insanity(35), mental_fortitude
0:48.133 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity berserking, lingering_insanity(35), mental_fortitude
0:49.465 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(35), mental_fortitude
0:50.321 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(35), mental_fortitude
0:54.502 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity lingering_insanity(35), mental_fortitude
0:55.357 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(35), mental_fortitude
0:55.357 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
0:57.898 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
0:59.009 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.5/100: 89% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mental_fortitude
1:01.407 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
1:02.469 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.7/100: 58% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(8), mark_of_the_claw, mental_fortitude
1:03.519 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.9/100: 65% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mark_of_the_claw, mental_fortitude
1:04.559 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.3/100: 67% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mark_of_the_claw, mental_fortitude
1:05.595 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:06.629 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
1:07.658 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.2/100: 76% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
1:08.677 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.2/100: 69% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:09.687 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
1:10.689 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
1:11.681 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.6/100: 66% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
1:12.663 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.6/100: 69% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
1:13.635 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.1/100: 68% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
1:14.606 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
1:15.564 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.8/100: 69% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
1:17.683 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.5/100: 41% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mental_fortitude
1:18.617 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.5/100: 38% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(24), mental_fortitude
1:19.544 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.3/100: 31% insanity sphere_of_insanity, voidform(25), insanity_drain_stacks(25), mark_of_the_claw, mental_fortitude
1:20.454 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.4/100: 16% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(26), mark_of_the_claw, mental_fortitude
1:21.358 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.4/100: 12% insanity sphere_of_insanity, voidform(27), insanity_drain_stacks(27), mark_of_the_claw, mental_fortitude
1:22.256 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(27), mark_of_the_claw, mental_fortitude
1:23.152 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(27), mark_of_the_claw, mental_fortitude
1:24.049 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(27), mark_of_the_claw, mental_fortitude
1:25.191 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(27), mental_fortitude
1:29.909 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity lingering_insanity(27), mark_of_the_claw, mental_fortitude
1:30.805 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(27), mark_of_the_claw, mental_fortitude
1:31.700 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity lingering_insanity(27), mental_fortitude
1:34.760 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(27), mental_fortitude
1:34.760 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
1:37.020 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.4/100: 91% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
1:38.134 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mental_fortitude
1:40.595 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.7/100: 71% insanity sphere_of_insanity, voidform(6), insanity_drain_stacks(6), mental_fortitude
1:41.672 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mental_fortitude
1:42.749 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(8), mental_fortitude
1:43.817 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.7/100: 63% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
1:44.862 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.9/100: 65% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:45.902 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
1:46.932 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
1:47.949 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:48.957 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.8/100: 50% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
1:49.959 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.8/100: 46% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mark_of_the_claw, mental_fortitude
1:50.938 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.6/100: 46% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
1:53.100 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.7/100: 17% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mark_of_the_claw, mental_fortitude
1:54.054 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.6/100: 16% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
1:55.001 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.3/100: 10% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mark_of_the_claw, mental_fortitude
1:55.944 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(21), mark_of_the_claw, mental_fortitude
1:56.896 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(21), mental_fortitude
1:57.848 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(21), mental_fortitude
1:58.800 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(21), mental_fortitude
2:01.800 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(21), mark_of_the_claw, mental_fortitude
2:02.741 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(21), mark_of_the_claw, mental_fortitude
2:07.237 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity lingering_insanity(21), mental_fortitude
2:08.190 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(21), mark_of_the_claw, mental_fortitude
2:08.190 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mark_of_the_claw, mental_fortitude
2:10.664 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mark_of_the_claw, mental_fortitude
2:11.763 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
2:14.237 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.4/100: 70% insanity shadowy_insight, sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mental_fortitude
2:15.313 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.2/100: 73% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(8), mental_fortitude
2:16.378 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
2:17.434 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
2:18.479 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.8/100: 73% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
2:19.516 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.1/100: 70% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
2:20.592 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.3/100: 66% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
2:21.609 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.3/100: 67% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
2:23.942 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.2/100: 38% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mark_of_the_claw, mental_fortitude
2:24.916 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.3/100: 38% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
2:25.890 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.3/100: 33% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mark_of_the_claw, mental_fortitude
2:26.848 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.4/100: 16% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mark_of_the_claw, mental_fortitude
2:27.797 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.3/100: 19% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
2:28.743 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.6/100: 18% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mark_of_the_claw, mental_fortitude
2:29.683 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.5/100: 9% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
2:30.619 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.0/100: 10% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mental_fortitude
2:32.770 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity lingering_insanity(24), mental_fortitude
2:33.699 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(24), mental_fortitude
2:35.398 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity lingering_insanity(24), mental_fortitude
2:36.325 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(24), mental_fortitude
2:37.256 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity lingering_insanity(24), mental_fortitude
2:38.184 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity lingering_insanity(24), mental_fortitude
2:39.788 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(24), mental_fortitude
2:39.788 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
2:42.351 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.8/100: 86% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
2:43.462 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mental_fortitude
2:44.568 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity sphere_of_insanity, voidform(5), insanity_drain_stacks(5), mark_of_the_claw, mental_fortitude
2:45.649 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.1/100: 81% insanity sphere_of_insanity, voidform(6), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
2:46.715 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
2:47.778 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(8), mark_of_the_claw, mental_fortitude
2:48.831 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.4/100: 74% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mark_of_the_claw, mental_fortitude
2:49.865 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.6/100: 77% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mark_of_the_claw, mental_fortitude
2:50.892 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
2:51.919 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
2:52.938 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.7/100: 65% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
2:55.107 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.4/100: 38% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
2:56.098 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.1/100: 38% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
2:57.084 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.9/100: 34% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
2:58.060 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.6/100: 21% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
2:59.025 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.5/100: 20% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
2:59.986 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.2/100: 14% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
3:00.938 surrender_to_madness Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity lingering_insanity(22), mental_fortitude
3:00.938 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity surrender_to_madness, lingering_insanity(22), mental_fortitude
3:02.116 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity surrender_to_madness, lingering_insanity(22), mental_fortitude
3:03.061 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity surrender_to_madness, lingering_insanity(22), mental_fortitude
3:07.491 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity surrender_to_madness, lingering_insanity(22), mental_fortitude
3:08.436 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, lingering_insanity(22), mental_fortitude
3:08.436 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
3:14.668 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.7/100: 98% insanity surrender_to_madness, sphere_of_insanity, voidform(2), insanity_drain_stacks(2), mental_fortitude
3:15.793 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity surrender_to_madness, sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
3:20.097 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(7), insanity_drain_stacks(3), mental_fortitude
3:21.167 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 90% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(8), insanity_drain_stacks(4), mental_fortitude
3:22.227 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(9), insanity_drain_stacks(5), mental_fortitude
3:23.285 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(10), insanity_drain_stacks(6), mental_fortitude
3:24.323 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(11), insanity_drain_stacks(7), mental_fortitude
3:25.361 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(12), insanity_drain_stacks(8), mental_fortitude
3:26.448 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(14), insanity_drain_stacks(10), mental_fortitude
3:27.458 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.9/100: 87% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(15), insanity_drain_stacks(11), mental_fortitude
3:28.460 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(16), insanity_drain_stacks(12), mental_fortitude
3:29.454 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.9/100: 86% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(17), insanity_drain_stacks(13), mental_fortitude
3:30.473 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(18), insanity_drain_stacks(14), mental_fortitude
3:31.448 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(19), insanity_drain_stacks(15), mental_fortitude
3:33.655 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
3:34.593 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.9/100: 94% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mark_of_the_claw, mental_fortitude
3:35.526 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(23), insanity_drain_stacks(19), mark_of_the_claw, mental_fortitude
3:36.451 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
3:37.368 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.8/100: 94% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
3:38.290 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.0/100: 99% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mental_fortitude
3:39.205 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mental_fortitude
3:40.113 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.2/100: 92% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mental_fortitude
3:42.166 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.5/100: 80% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mental_fortitude
3:43.054 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.1/100: 81% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mental_fortitude
3:43.943 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(31), insanity_drain_stacks(27), mark_of_the_claw, mental_fortitude
3:44.809 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.3/100: 81% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(32), insanity_drain_stacks(28), mark_of_the_claw, mental_fortitude
3:45.669 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.1/100: 81% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(33), insanity_drain_stacks(29), mark_of_the_claw, mental_fortitude
3:46.526 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 91% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(34), insanity_drain_stacks(30), mark_of_the_claw, mental_fortitude
3:47.377 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(34), insanity_drain_stacks(30), mark_of_the_claw, mental_fortitude
3:48.222 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.6/100: 80% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(35), insanity_drain_stacks(31), mark_of_the_claw, mental_fortitude
3:49.066 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(36), insanity_drain_stacks(32), mark_of_the_claw, mental_fortitude
3:49.908 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(37), insanity_drain_stacks(33), mental_fortitude
3:50.747 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(38), insanity_drain_stacks(34), mental_fortitude
3:52.599 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.3/100: 51% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(40), insanity_drain_stacks(36), mental_fortitude
3:53.424 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.5/100: 71% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(40), insanity_drain_stacks(36), mental_fortitude
3:54.247 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(41), insanity_drain_stacks(37), mental_fortitude
3:55.299 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.2/100: 79% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(42), insanity_drain_stacks(38), mental_fortitude
3:56.107 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.7/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(43), insanity_drain_stacks(39), mental_fortitude
3:56.910 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(44), insanity_drain_stacks(40), mental_fortitude
3:57.712 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.9/100: 65% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(45), insanity_drain_stacks(41), mental_fortitude
3:58.506 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.8/100: 77% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(46), insanity_drain_stacks(42), mental_fortitude
3:59.295 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.6/100: 84% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(46), insanity_drain_stacks(42), mental_fortitude
4:00.078 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(47), insanity_drain_stacks(43), mental_fortitude
4:00.860 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(48), insanity_drain_stacks(44), mental_fortitude
4:01.639 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.8/100: 82% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(49), insanity_drain_stacks(45), mental_fortitude
4:02.413 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.5/100: 69% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(49), insanity_drain_stacks(45), mental_fortitude
4:03.181 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.8/100: 77% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(50), insanity_drain_stacks(46), mental_fortitude
4:05.066 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.2/100: 36% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(52), insanity_drain_stacks(48), mental_fortitude
4:05.823 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.8/100: 52% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(53), insanity_drain_stacks(49), mental_fortitude
4:06.576 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.1/100: 57% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(54), insanity_drain_stacks(50), mental_fortitude
4:07.331 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.3/100: 42% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(54), insanity_drain_stacks(50), mental_fortitude
4:08.082 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.9/100: 57% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(55), insanity_drain_stacks(51), mental_fortitude
4:08.833 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(56), insanity_drain_stacks(52), mental_fortitude
4:09.586 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.3/100: 74% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(57), insanity_drain_stacks(53), mental_fortitude
4:10.340 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(57), insanity_drain_stacks(53), mental_fortitude
4:11.089 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.5/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(58), insanity_drain_stacks(54), mental_fortitude
4:11.841 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.8/100: 61% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(59), insanity_drain_stacks(55), mental_fortitude
4:12.594 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(60), insanity_drain_stacks(56), mental_fortitude
4:14.248 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.8/100: 33% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(61), insanity_drain_stacks(57), mental_fortitude
4:14.999 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(62), insanity_drain_stacks(58), mental_fortitude
4:15.751 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.9/100: 47% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(63), insanity_drain_stacks(59), mental_fortitude
4:20.088 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.6/100: 34% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(67), insanity_drain_stacks(59), mental_fortitude
4:20.840 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.1/100: 45% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(68), insanity_drain_stacks(60), mental_fortitude
4:21.593 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.4/100: 46% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(69), insanity_drain_stacks(61), mental_fortitude
4:22.348 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.2/100: 47% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(69), insanity_drain_stacks(61), mental_fortitude
4:23.097 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.9/100: 58% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(70), insanity_drain_stacks(62), mental_fortitude
4:23.848 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.2/100: 58% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(71), insanity_drain_stacks(63), mental_fortitude
4:24.602 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.2/100: 58% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(72), insanity_drain_stacks(64), mental_fortitude
4:25.355 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.2/100: 68% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(72), insanity_drain_stacks(64), mental_fortitude
4:26.105 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.3/100: 69% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(73), insanity_drain_stacks(65), mental_fortitude
4:27.035 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.4/100: 62% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(74), insanity_drain_stacks(66), mental_fortitude
4:27.788 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.2/100: 39% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(75), insanity_drain_stacks(67), mental_fortitude
4:28.542 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.7/100: 58% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(76), insanity_drain_stacks(68), mental_fortitude
4:29.296 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.2/100: 66% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(76), insanity_drain_stacks(68), mental_fortitude
4:30.047 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.1/100: 74% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(77), insanity_drain_stacks(69), mental_fortitude
4:30.798 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.7/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(78), insanity_drain_stacks(70), mental_fortitude
4:30.798 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.7/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(78), insanity_drain_stacks(70), potion_of_deadly_grace, mental_fortitude
4:31.553 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(79), insanity_drain_stacks(71), potion_of_deadly_grace, mental_fortitude
4:32.309 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.8/100: 98% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(79), insanity_drain_stacks(71), potion_of_deadly_grace, mental_fortitude
4:33.059 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(80), insanity_drain_stacks(72), potion_of_deadly_grace, mental_fortitude
4:34.016 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.6/100: 60% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(81), insanity_drain_stacks(73), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:34.962 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.2/100: 76% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(82), insanity_drain_stacks(74), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:35.714 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.2/100: 82% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(83), insanity_drain_stacks(75), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:36.468 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.5/100: 76% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(84), insanity_drain_stacks(76), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:37.223 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.5/100: 76% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(84), insanity_drain_stacks(76), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:38.310 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(85), insanity_drain_stacks(77), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:44.686 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(87), insanity_drain_stacks(79), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:45.440 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(88), insanity_drain_stacks(80), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:46.195 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(88), insanity_drain_stacks(80), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:46.948 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.4/100: 51% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(89), insanity_drain_stacks(81), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:47.699 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.7/100: 55% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(90), insanity_drain_stacks(82), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:47.699 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.7/100: 55% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(90), insanity_drain_stacks(82), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:48.454 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.9/100: 48% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(91), insanity_drain_stacks(83), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:49.357 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.9/100: 43% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(91), insanity_drain_stacks(83), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:50.109 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.4/100: 35% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(92), insanity_drain_stacks(84), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:50.895 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.9/100: 35% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(93), insanity_drain_stacks(85), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:51.655 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.8/100: 62% insanity berserking, twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(94), insanity_drain_stacks(86), potion_of_deadly_grace, mental_fortitude
4:52.438 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.2/100: 59% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(95), insanity_drain_stacks(87), potion_of_deadly_grace, mental_fortitude
4:53.194 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.2/100: 50% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(95), insanity_drain_stacks(87), potion_of_deadly_grace, mental_fortitude
4:53.975 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.2/100: 51% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(96), insanity_drain_stacks(88), potion_of_deadly_grace, mental_fortitude
4:54.728 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.9/100: 42% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(97), insanity_drain_stacks(89), potion_of_deadly_grace, mental_fortitude
4:55.500 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.5/100: 39% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(98), insanity_drain_stacks(90), potion_of_deadly_grace, mental_fortitude
4:56.256 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.2/100: 60% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(98), insanity_drain_stacks(90), potion_of_deadly_grace, mental_fortitude
4:57.015 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.6/100: 60% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(99), insanity_drain_stacks(91), potion_of_deadly_grace, mental_fortitude
4:57.778 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.1/100: 49% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(92), potion_of_deadly_grace, mental_fortitude
4:58.533 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.5/100: 49% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(93), potion_of_deadly_grace, mental_fortitude
4:59.284 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.3/100: 37% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(93), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
5:00.248 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.3/100: 22% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(94), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
5:01.003 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.4/100: 55% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(95), mark_of_the_claw, mental_fortitude
5:01.947 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.2/100: 42% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(96), mark_of_the_claw, mental_fortitude
5:02.701 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.9/100: 30% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(97), mark_of_the_claw, mental_fortitude
5:03.645 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.8/100: 16% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(98), mark_of_the_claw, mental_fortitude

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 42217 42217 26216
Intellect 39146 37440 28334 (2596)
Spirit 1 1 0
Health 2533020 2533020 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 39146 37440 0
Crit 24.40% 24.40% 6790
Haste 30.67% 29.51% 9592
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 8800 8800 0
Mastery 43.43% 43.43% 3280
Armor 1819 1819 1819
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 884.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_claw
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Dreamscale Inlaid Vestments
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +918 Haste, +542 Mastery }
Local Waist Mangaza's Madness
ilevel: 895, stats: { 172 Armor, +2219 Sta, +1479 Int, +745 Crit, +413 Haste }
Local Legs Ragged Horrorweave Leggings
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +824 Haste, +636 Mastery }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +735 Haste, +360 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +569 Haste, +252 Mastery }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Haste }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Haste }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 906, weapon: { 1922 - 3571, 1.8 }, stats: { +937 Int, +1405 Sta, +350 Crit, +337 Mastery, +11921 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Secrets of the Void
ilevel: 906, stats: { +1230 Int, +1844 Sta, +627 Haste, +278 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Priest_Shadow_T19M_S2M"
level=110
race=troll
role=spell
position=back
talents=1212333
artifact=47:139251:139257:139251:0:764:1:765:1:766:1:767:3:768:1:769:1:770:1:771:3:772:5:773:3:774:3:775:3:776:4:777:3:778:3:779:1:1347:1
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_claw
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=200int
chest=dreamscale_inlaid_vestments,id=138215,bonus_id=1806
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1806
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=mangazas_madness,id=132864
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1806
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=200haste
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200haste
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=139251/139257/139251,relic_id=1806/1806/1806
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=884.19
# gear_stamina=26216
# gear_intellect=28334
# gear_crit_rating=6790
# gear_haste_rating=9592
# gear_mastery_rating=3280
# gear_armor=1819

Rogue_Assassination_Exsg_T19M : 408862 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
408862.4 408862.4 315.3 / 0.077% 54420.4 / 13.3% 15934.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
25.6 25.6 Energy 40.78% 36.7 100.0% 100%
Talents
  • 15: Elaborate Planning
  • 30: Nightstalker
  • 45: Deeper Stratagem
  • 75: Thuggee (Assassination Rogue)
  • 90: Exsanguinate
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Assassination_Exsg_T19M 408862
auto_attack_mh 17831 4.4% 203.0 1.49sec 26392 17979 Direct 203.0 21070 42141 26392 44.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 202.98 202.98 0.00 0.00 1.4679 0.0000 5356899.62 7875149.86 31.98 17979.07 17979.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.70 36.80% 21070.23 17439 27531 21074.99 20031 22384 1573923 2313815 31.98
crit 89.77 44.23% 42140.85 34878 55061 42152.59 39967 44413 3782977 5561335 31.98
miss 38.51 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 8801 2.2% 200.8 1.50sec 13169 8887 Direct 200.8 10516 21036 13169 44.2% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.81 200.81 0.00 0.00 1.4818 0.0000 2644415.15 3887540.75 31.98 8887.09 8887.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.90 36.80% 10515.79 8720 13765 10518.38 9783 11300 777091 1142397 31.98
crit 88.77 44.20% 21036.50 17439 27531 21041.02 20051 22236 1867325 2745144 31.98
miss 38.15 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deadly Poison (_dot) 15331 3.8% 373.1 0.92sec 12357 0 Periodic 99.6 32094 64145 46308 44.4% 0.0% 99.3%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 373.11 0.00 99.56 99.56 0.0000 3.0000 4610526.44 4610526.44 0.00 15436.19 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.4 55.65% 32093.68 26593 42789 32103.18 30064 34030 1778150 1778150 0.00
crit 44.2 44.35% 64144.94 53185 85579 64164.56 59813 69442 2832376 2832376 0.00
 
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance to poison the enemy for ${$2818m1*4} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.357500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Deadly Poison (_instant) 36143 8.8% 372.1 0.92sec 29189 0 Direct 372.1 20243 40473 29189 44.2% 0.0%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 372.11 372.11 0.00 0.00 0.0000 0.0000 10861501.56 10861501.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 207.55 55.78% 20242.70 16439 26452 20248.08 19463 21253 4201259 4201259 0.00
crit 164.56 44.22% 40472.72 32878 52903 40483.47 38783 42310 6660242 6660242 0.00
 
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
Envenom 39891 9.8% 28.0 10.47sec 427962 426058 Direct 28.0 296434 592798 427959 44.4% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.01 28.01 0.00 0.00 1.0045 0.0000 11988426.60 11988426.60 0.00 426058.23 426058.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.58 55.62% 296434.20 225028 434500 296549.81 250010 349553 4618573 4618573 0.00
crit 12.43 44.38% 592798.21 450055 869000 593031.46 480059 734841 7369853 7369853 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
From the Shadows 10247 2.5% 142.5 3.76sec 21589 0 Direct 142.5 14960 29921 21588 44.3% 0.0%  

Stats details: from_the_shadows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 142.52 142.52 0.00 0.00 0.0000 0.0000 3076823.99 3076823.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.38 55.70% 14960.41 12811 15855 14968.09 14388 15323 1187536 1187536 0.00
crit 63.14 44.30% 29920.97 25621 31711 29936.93 29032 30847 1889288 1889288 0.00
 
 

Action details: from_the_shadows

Static Values
  • id:192434
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192434
  • name:From the Shadows
  • school:nature
  • tooltip:
  • description:{$@spelldesc192428=Declaring your Vendetta unleashes a barrage of poisoned daggers at the target for ${20*{$192434s1=10}*$m1} Nature damage over {$192432d=20 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.350000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10.00
  • base_dd_max:10.00
 
Garrote 34521 8.4% 20.0 15.45sec 519262 516941 Periodic 173.2 41526 83039 59900 44.3% 0.0% 97.3%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.98 0.00 173.22 173.22 1.0045 1.6896 10376030.49 10376030.49 0.00 33176.01 516940.54
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.6 55.74% 41525.74 32911 79434 41558.80 38848 45517 4009389 4009389 0.00
crit 76.7 44.26% 83038.75 65822 158868 83104.54 77010 91713 6366641 6366641 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Kingsbane 16329 (22072) 4.0% (5.4%) 6.8 46.46sec 973079 968868 Periodic 46.5 73137 146292 105570 44.3% 0.0% 30.9%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 0.00 46.49 46.49 1.0045 2.0000 4908378.85 4908378.85 0.00 66439.01 968868.24
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.9 55.67% 73136.56 22326 160469 73154.85 52329 92663 1892815 1892815 0.00
crit 20.6 44.33% 146291.75 44652 320937 146361.56 100494 195669 3015564 3015564 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 3827 0.9% 6.8 46.46sec 168603 0 Direct 6.8 116923 233812 168605 44.2% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 6.82 0.00 0.00 0.0000 0.0000 1149263.35 1149263.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.80 55.79% 116923.38 115061 121402 116309.76 0 121402 444618 444618 0.00
crit 3.01 44.21% 233811.69 230122 242803 228478.81 0 242803 704645 704645 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 1916 0.5% 6.8 46.46sec 84389 0 Direct 6.8 58454 116925 84385 44.4% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 6.82 0.00 0.00 0.0000 0.0000 575229.76 575229.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.79 55.64% 58454.22 57531 60701 58231.07 0 60701 221711 221711 0.00
crit 3.02 44.36% 116924.64 115061 121402 114432.40 0 121402 353519 353519 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mark of the Hidden Satyr 5665 1.4% 17.3 17.34sec 98374 0 Direct 17.3 68272 136532 98374 44.1% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.30 17.30 0.00 0.00 0.0000 0.0000 1701788.57 1701788.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.67 55.90% 68271.94 61572 70808 68266.16 61572 70808 660205 660205 0.00
crit 7.63 44.10% 136531.68 123145 141616 136476.15 0 141616 1041584 1041584 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Mutilate 0 (59174) 0.0% (14.5%) 92.3 3.26sec 192754 191892

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.25 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 191892.49 191892.49
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit<=1&energy.deficit<=30
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage.{$?s1329=true}|!c1[][ Replaces Sinister Strike.] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 39459 9.7% 92.3 3.26sec 128530 0 Direct 92.3 85506 171017 128530 50.3% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.25 92.25 0.00 0.00 0.0000 0.0000 11857163.03 17431152.80 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.84 49.69% 85505.88 69259 109248 85533.39 79482 93150 3919166 5761545 31.98
crit 46.42 50.31% 171016.94 138518 218495 171046.25 156579 184505 7937997 11669608 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 19715 4.8% 92.3 3.26sec 64224 0 Direct 92.3 42751 85504 64224 50.2% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.25 92.25 0.00 0.00 0.0000 0.0000 5924746.59 8709938.69 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.92 49.77% 42750.84 34628 54621 42764.65 40164 45851 1963022 2885829 31.98
crit 46.33 50.23% 85504.09 69255 109242 85516.23 79794 90636 3961724 5824110 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Poison Bomb 16124 3.9% 35.3 6.28sec 137318 0 Direct 35.3 95076 190165 137318 44.4% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.30 35.30 0.00 0.00 0.0000 0.0000 4847219.29 4847219.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.62 55.58% 95076.10 94100 101279 95058.43 94100 100382 1865184 1865184 0.00
crit 15.68 44.42% 190164.76 188199 202559 190077.87 0 202559 2982036 2982036 0.00
 
 

Action details: poison_bomb

Static Values
  • id:192660
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192660
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc192657=Envenom has a chance to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$192660s1=1}*6} Nature damage over {$192661d=3 seconds} to all enemies within it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Potion of the Old War 19482 4.7% 24.7 5.26sec 233661 0 Direct 24.7 161812 323633 233661 44.4% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.66 24.66 0.00 0.00 0.0000 0.0000 5760966.97 8469167.14 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.71 55.60% 161811.99 143757 165320 161795.42 152998 165320 2218181 3260936 31.98
crit 10.95 44.40% 323632.99 287514 330641 323613.83 301889 330641 3542786 5208231 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rupture 123581 30.3% 20.6 14.80sec 1805353 1797288 Periodic 207.6 116132 232094 179064 54.3% 0.0% 97.3%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.59 0.00 207.56 207.56 1.0045 1.4100 37166108.90 37166108.90 0.00 118613.10 1797287.53
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.9 45.73% 116131.58 70 337848 116136.10 88578 151162 11023187 11023187 0.00
crit 112.6 54.27% 232093.56 280 675696 232113.36 183835 301963 26142922 26142922 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${{$s1=0}*1*8/2} over 8 sec 2 points: ${{$s1=0}*2*12/2} over 12 sec 3 points: ${{$s1=0}*3*16/2} over 16 sec 4 points: ${{$s1=0}*4*20/2} over 20 sec 5 points: ${{$s1=0}*5*24/2} over 24 sec{$?s193531=false}[ 6 points: ${{$s1=0}*6*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Rogue_Assassination_Exsg_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_Exsg_T19M
  • harmful:false
  • if_expr:
 
Blood Fury 2.0 186.69sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.vendetta.up
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
Exsanguinate 6.8 46.46sec

Stats details: exsanguinate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: exsanguinate

Static Values
  • id:200806
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
Spelldata
  • id:200806
  • name:Exsanguinate
  • school:physical
  • tooltip:
  • description:Twist your blades into the target's wounds, causing your Bleed effects on them to bleed out {$s1=100}% faster.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_Exsg_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_Exsg_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.6 139.40sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.62 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 3.6 93.49sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<20
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 10.7 6.6 28.4sec 17.1sec 45.15% 45.15% 6.6(6.6) 10.2

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.0 0.0 186.5sec 186.5sec 10.18% 10.18% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:10.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 11.85% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elaborate Planning 35.5 13.1 8.5sec 6.2sec 75.38% 60.15% 13.1(13.1) 34.7

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.15

Stack Uptimes

  • elaborate_planning_1:75.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Increases damage done by {$s1=15}%.
  • description:Increases damage done by {$s1=15}% for {$d=5 seconds}.
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom 16.6 11.4 17.9sec 10.5sec 59.34% 57.82% 11.4(11.4) 16.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:59.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 97.7sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Vanish 2.6 0.0 139.4sec 139.4sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Assassination_Exsg_T19M
envenom Energy 28.0 980.5 35.0 35.0 12227.3
envenom Combo Points 28.0 158.5 5.7 5.7 75654.2
garrote Energy 20.0 899.2 45.0 45.0 11539.2
kingsbane Energy 6.8 238.6 35.0 35.0 27802.1
mutilate Energy 92.3 5073.9 55.0 55.0 3504.6
rupture Energy 20.6 514.7 25.0 25.0 72214.7
rupture Combo Points 20.6 118.2 5.7 5.7 314402.2
Resource Gains Type Count Total Average Overflow
kingsbane Combo Points 6.82 6.82 (2.44%) 1.00 0.00 0.00%
mutilate Combo Points 92.25 181.53 (64.94%) 1.97 2.97 1.61%
garrote Combo Points 19.98 19.98 (7.15%) 1.00 0.00 0.00%
energy_regen Energy 1827.18 3582.54 (46.98%) 1.96 31.33 0.87%
seal_fate Combo Points 95.74 71.23 (25.48%) 0.74 24.51 25.61%
Venomous Vim Energy 380.75 3752.61 (49.21%) 9.86 54.89 1.44%
Urge to Kill Energy 3.65 290.66 (3.81%) 79.70 146.98 33.59%
Resource RPS-Gain RPS-Loss
Energy 25.35 25.62
Combo Points 0.93 0.92
Combat End Resource Mean Min Max
Energy 38.63 0.01 120.00
Combo Points 2.91 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
Seal Fate 95.7 4.1sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Assassination_Exsg_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Rogue_Assassination_Exsg_T19M Damage Per Second
Count 7499
Mean 408862.43
Minimum 348856.43
Maximum 468740.16
Spread ( max - min ) 119883.73
Range [ ( max - min ) / 2 * 100% ] 14.66%
Standard Deviation 13931.6372
5th Percentile 386885.56
95th Percentile 432651.05
( 95th Percentile - 5th Percentile ) 45765.50
Mean Distribution
Standard Deviation 160.8794
95.00% Confidence Intervall ( 408547.11 - 409177.75 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4460
0.1 Scale Factor Error with Delta=300 1656868
0.05 Scale Factor Error with Delta=300 6627473
0.01 Scale Factor Error with Delta=300 165686826
Priority Target DPS
Sample Data Rogue_Assassination_Exsg_T19M Priority Target Damage Per Second
Count 7499
Mean 408862.43
Minimum 348856.43
Maximum 468740.16
Spread ( max - min ) 119883.73
Range [ ( max - min ) / 2 * 100% ] 14.66%
Standard Deviation 13931.6372
5th Percentile 386885.56
95th Percentile 432651.05
( 95th Percentile - 5th Percentile ) 45765.50
Mean Distribution
Standard Deviation 160.8794
95.00% Confidence Intervall ( 408547.11 - 409177.75 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4460
0.1 Scale Factor Error with Delta=300 1656868
0.05 Scale Factor Error with Delta=300 6627473
0.01 Scale Factor Error with Delta=300 165686826
DPS(e)
Sample Data Rogue_Assassination_Exsg_T19M Damage Per Second (Effective)
Count 7499
Mean 408862.43
Minimum 348856.43
Maximum 468740.16
Spread ( max - min ) 119883.73
Range [ ( max - min ) / 2 * 100% ] 14.66%
Damage
Sample Data Rogue_Assassination_Exsg_T19M Damage
Count 7499
Mean 122805489.17
Minimum 88706494.65
Maximum 156270344.19
Spread ( max - min ) 67563849.54
Range [ ( max - min ) / 2 * 100% ] 27.51%
DTPS
Sample Data Rogue_Assassination_Exsg_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Assassination_Exsg_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Assassination_Exsg_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Assassination_Exsg_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Assassination_Exsg_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Assassination_Exsg_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Assassination_Exsg_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Assassination_Exsg_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=old_war
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
9 2.01 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
A 0.00 call_action_list,name=cds
B 4.26 rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
0.00 pool_resource,for_next=1
C 6.82 kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
D 0.00 run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
E 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
F 0.00 call_action_list,name=exsang,if=dot.rupture.exsanguinated
G 6.53 rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
H 0.00 call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
I 0.00 call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
J 0.00 call_action_list,name=build_ex,if=talent.exsanguinate.enabled
K 0.00 call_action_list,name=build_noex,if=!talent.exsanguinate.enabled
actions.build_ex
# count action,conditions
0.00 hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
0.00 hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
0.00 fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
0.00 fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
0.00 hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&((dot.rupture.exsanguinated&dot.rupture.remains<=2)|cooldown.exsanguinate.remains<=2))
L 2.44 mutilate,if=combo_points.deficit<=1&energy.deficit<=30
M 89.81 mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2
actions.cds
# count action,conditions
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
N 0.16 vendetta,if=target.time_to_die<20
O 3.48 vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
0.00 vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
0.00 vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25
actions.exsang
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die>6
P 2.94 rupture,if=combo_points>=cp_max_spend&ticks_remain<2
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
Q 16.77 envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang_combo
# count action,conditions
R 2.62 vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
S 6.86 rupture,if=combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)
T 6.84 exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
U 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
0.00 hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
V 0.00 call_action_list,name=build_ex
actions.finish_ex
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
0.00 rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
W 9.55 envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
X 1.69 envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.garrote
# count action,conditions
0.00 pool_resource,for_next=1
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
0.00 pool_resource,for_next=1
Y 19.99 garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

Sample Sequence

012456YMBO9MMLRSTCMMQYMQMMQMMBYMMGMMWMYMWMMLSTCYMQMMQMMBYMMGMMWYMMWMO8MLSTCYMQMMQMM9PYMGMMWMYMWMMRSTCMYQMMQMMPMYMGMMWMYMWMOMSTCMQMYMQMMQMMBYMMGMMWYMMLSTCMMQYMMQMMPMYMGMMWMYMWN9MMRSTCMMQYMMQM

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Assassination_Exsg_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Assassination_Exsg_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Assassination_Exsg_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.004 mutilate Fluffy_Pillow 90.8/120: 76% energy | 1.0/6: 17% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:02.009 rupture Fluffy_Pillow 61.5/120: 51% energy | 4.0/6: 67% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:03.012 vendetta Fluffy_Pillow 52.3/120: 44% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:03.012 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:03.012 mutilate Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:04.016 mutilate Fluffy_Pillow 100.8/120: 84% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:05.020 Waiting 1.000 sec 61.5/120: 51% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:06.020 mutilate Fluffy_Pillow 97.2/120: 81% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:07.026 vanish Fluffy_Pillow 58.0/120: 48% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, blood_frenzy, potion_of_the_old_war
0:07.026 rupture Fluffy_Pillow 58.0/120: 48% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, vanish, blood_frenzy, potion_of_the_old_war
0:08.030 exsanguinate Fluffy_Pillow 68.8/120: 57% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:09.035 kingsbane Fluffy_Pillow 104.6/120: 87% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:10.039 mutilate Fluffy_Pillow 105.3/120: 88% energy | 2.0/6: 33% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:11.043 mutilate Fluffy_Pillow 84.8/120: 71% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:12.046 envenom Fluffy_Pillow 64.3/120: 54% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, potion_of_the_old_war
0:13.052 Waiting 1.700 sec 63.9/120: 53% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:14.752 garrote Fluffy_Pillow 98.5/120: 82% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:16.004 mutilate Fluffy_Pillow 81.6/120: 68% energy | 1.0/6: 17% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:17.009 envenom Fluffy_Pillow 61.2/120: 51% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:18.013 Waiting 0.100 sec 50.7/120: 42% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:18.113 mutilate Fluffy_Pillow 62.1/120: 52% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:19.118 Waiting 1.000 sec 41.7/120: 35% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:20.118 mutilate Fluffy_Pillow 66.2/120: 55% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:21.123 envenom Fluffy_Pillow 45.7/120: 38% energy | 6.0/6: 100% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:22.127 Waiting 0.900 sec 35.2/120: 29% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:23.027 mutilate Fluffy_Pillow 68.3/120: 57% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:24.031 Waiting 1.000 sec 37.8/120: 31% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning
0:25.031 mutilate Fluffy_Pillow 72.3/120: 60% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning
0:26.035 rupture Fluffy_Pillow 41.8/120: 35% energy | 6.0/6: 100% combo_points bloodlust, envenom, elaborate_planning
0:27.038 Waiting 2.800 sec 41.3/120: 34% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:29.838 garrote Fluffy_Pillow 104.2/120: 87% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, blood_frenzy
0:31.002 mutilate Fluffy_Pillow 97.5/120: 81% energy | 1.0/6: 17% combo_points bloodlust, elaborate_planning, blood_frenzy
0:32.006 mutilate Fluffy_Pillow 58.3/120: 49% energy | 4.0/6: 67% combo_points bloodlust, blood_frenzy
0:33.012 rupture Fluffy_Pillow 39.0/120: 33% energy | 6.0/6: 100% combo_points bloodlust, blood_frenzy
0:34.017 Waiting 1.000 sec 29.8/120: 25% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, blood_frenzy
0:35.017 mutilate Fluffy_Pillow 65.5/120: 55% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, blood_frenzy
0:36.022 Waiting 1.000 sec 26.3/120: 22% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning, blood_frenzy
0:37.022 mutilate Fluffy_Pillow 62.0/120: 52% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning, blood_frenzy
0:38.025 Waiting 2.042 sec 22.8/120: 19% energy | 6.0/6: 100% combo_points bloodlust, blood_frenzy
0:40.067 envenom Fluffy_Pillow 83.9/120: 70% energy | 6.0/6: 100% combo_points
0:41.071 mutilate Fluffy_Pillow 70.1/120: 58% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:42.076 Waiting 3.600 sec 36.3/120: 30% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
0:45.676 garrote Fluffy_Pillow 106.4/120: 89% energy | 2.0/6: 33% combo_points envenom
0:46.681 mutilate Fluffy_Pillow 82.6/120: 69% energy | 3.0/6: 50% combo_points envenom
0:47.684 Waiting 1.400 sec 49.7/120: 41% energy | 6.0/6: 100% combo_points blood_frenzy
0:49.084 envenom Fluffy_Pillow 86.6/120: 72% energy | 6.0/6: 100% combo_points blood_frenzy
0:50.089 mutilate Fluffy_Pillow 73.7/120: 61% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
0:51.093 Waiting 1.000 sec 40.9/120: 34% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
0:52.093 mutilate Fluffy_Pillow 62.9/120: 52% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
0:53.098 Waiting 3.000 sec 30.1/120: 25% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, blood_frenzy
0:56.098 mutilate Fluffy_Pillow 96.3/120: 80% energy | 5.0/6: 83% combo_points blood_frenzy
0:57.103 rupture Fluffy_Pillow 63.5/120: 53% energy | 6.0/6: 100% combo_points blood_frenzy
0:58.107 exsanguinate Fluffy_Pillow 60.4/120: 50% energy | 0.0/6: 0% combo_points elaborate_planning
0:59.110 kingsbane Fluffy_Pillow 91.6/120: 76% energy | 0.0/6: 0% combo_points elaborate_planning
1:00.113 Waiting 3.500 sec 87.7/120: 73% energy | 2.0/6: 33% combo_points elaborate_planning
1:03.613 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points
1:04.618 mutilate Fluffy_Pillow 96.2/120: 80% energy | 3.0/6: 50% combo_points
1:05.623 envenom Fluffy_Pillow 72.4/120: 60% energy | 6.0/6: 100% combo_points
1:06.628 mutilate Fluffy_Pillow 58.6/120: 49% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:07.632 Waiting 1.000 sec 34.7/120: 29% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
1:08.632 mutilate Fluffy_Pillow 55.9/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
1:09.637 Waiting 0.300 sec 32.1/120: 27% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
1:09.937 envenom Fluffy_Pillow 35.4/120: 30% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
1:10.941 Waiting 1.206 sec 21.6/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:12.147 mutilate Fluffy_Pillow 65.0/120: 54% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:13.153 Waiting 1.000 sec 31.2/120: 26% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
1:14.153 mutilate Fluffy_Pillow 62.3/120: 52% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
1:15.157 Waiting 0.700 sec 28.5/120: 24% energy | 4.0/6: 67% combo_points envenom
1:15.857 rupture Fluffy_Pillow 56.3/120: 47% energy | 4.0/6: 67% combo_points envenom
1:16.860 Waiting 1.600 sec 42.5/120: 35% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:18.460 garrote Fluffy_Pillow 80.3/120: 67% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:19.616 mutilate Fluffy_Pillow 58.2/120: 48% energy | 1.0/6: 17% combo_points elaborate_planning
1:20.621 Waiting 1.300 sec 24.4/120: 20% energy | 4.0/6: 67% combo_points elaborate_planning
1:21.921 mutilate Fluffy_Pillow 58.8/120: 49% energy | 4.0/6: 67% combo_points
1:22.927 Waiting 0.895 sec 15.0/120: 13% energy | 6.0/6: 100% combo_points
1:23.822 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points
1:24.827 Waiting 1.100 sec 31.2/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning
1:25.927 mutilate Fluffy_Pillow 63.4/120: 53% energy | 0.0/6: 0% combo_points elaborate_planning
1:26.931 Waiting 1.384 sec 19.6/120: 16% energy | 4.0/6: 67% combo_points elaborate_planning
1:28.315 mutilate Fluffy_Pillow 55.0/120: 46% energy | 4.0/6: 67% combo_points elaborate_planning
1:29.320 Waiting 2.639 sec 11.2/120: 9% energy | 6.0/6: 100% combo_points
1:31.959 envenom Fluffy_Pillow 80.6/120: 67% energy | 6.0/6: 100% combo_points
1:32.962 Waiting 1.300 sec 56.7/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:34.262 garrote Fluffy_Pillow 91.5/120: 76% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:35.266 mutilate Fluffy_Pillow 58.7/120: 49% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
1:36.271 Waiting 1.400 sec 35.8/120: 30% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, blood_frenzy
1:37.671 mutilate Fluffy_Pillow 62.7/120: 52% energy | 4.0/6: 67% combo_points envenom, blood_frenzy
1:38.675 Waiting 2.500 sec 29.8/120: 25% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
1:41.175 envenom Fluffy_Pillow 80.0/120: 67% energy | 6.0/6: 100% combo_points blood_frenzy
1:42.180 mutilate Fluffy_Pillow 77.2/120: 64% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:43.184 vendetta Fluffy_Pillow 34.3/120: 29% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
1:43.184 potion Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
1:43.184 mutilate Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:44.190 mutilate Fluffy_Pillow 96.9/120: 81% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:45.195 rupture Fluffy_Pillow 53.1/120: 44% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:46.198 exsanguinate Fluffy_Pillow 59.3/120: 49% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:47.203 kingsbane Fluffy_Pillow 90.5/120: 75% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:48.207 Waiting 3.700 sec 86.6/120: 72% energy | 2.0/6: 33% combo_points elaborate_planning, potion_of_the_old_war
1:51.907 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points potion_of_the_old_war
1:52.912 mutilate Fluffy_Pillow 96.2/120: 80% energy | 3.0/6: 50% combo_points potion_of_the_old_war
1:53.917 envenom Fluffy_Pillow 72.4/120: 60% energy | 6.0/6: 100% combo_points potion_of_the_old_war
1:54.922 mutilate Fluffy_Pillow 58.6/120: 49% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:55.926 Waiting 1.000 sec 34.7/120: 29% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:56.926 mutilate Fluffy_Pillow 55.9/120: 47% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:57.929 Waiting 0.100 sec 32.0/120: 27% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:58.029 envenom Fluffy_Pillow 43.2/120: 36% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:59.033 Waiting 1.000 sec 29.3/120: 24% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
2:00.033 mutilate Fluffy_Pillow 60.5/120: 50% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
2:01.037 Waiting 1.000 sec 26.6/120: 22% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, potion_of_the_old_war
2:02.037 mutilate Fluffy_Pillow 57.8/120: 48% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, potion_of_the_old_war
2:03.041 blood_fury Fluffy_Pillow 24.0/120: 20% energy | 6.0/6: 100% combo_points envenom, potion_of_the_old_war
2:03.041 Waiting 0.100 sec 24.0/120: 20% energy | 6.0/6: 100% combo_points blood_fury, envenom, potion_of_the_old_war
2:03.141 rupture Fluffy_Pillow 25.1/120: 21% energy | 6.0/6: 100% combo_points blood_fury, envenom, potion_of_the_old_war
2:04.146 Waiting 2.600 sec 31.3/120: 26% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, potion_of_the_old_war
2:06.746 garrote Fluffy_Pillow 80.2/120: 67% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, potion_of_the_old_war
2:07.914 mutilate Fluffy_Pillow 68.2/120: 57% energy | 1.0/6: 17% combo_points blood_fury, elaborate_planning, potion_of_the_old_war
2:08.917 Waiting 2.500 sec 24.4/120: 20% energy | 5.0/6: 83% combo_points blood_fury
2:11.417 rupture Fluffy_Pillow 73.3/120: 61% energy | 5.0/6: 83% combo_points blood_fury, blood_frenzy
2:12.423 mutilate Fluffy_Pillow 80.4/120: 67% energy | 0.0/6: 0% combo_points blood_fury, elaborate_planning, blood_frenzy
2:13.427 Waiting 0.500 sec 37.6/120: 31% energy | 3.0/6: 50% combo_points blood_fury, elaborate_planning, blood_frenzy
2:13.927 mutilate Fluffy_Pillow 63.6/120: 53% energy | 3.0/6: 50% combo_points blood_fury, elaborate_planning, blood_frenzy
2:14.930 Waiting 3.053 sec 20.7/120: 17% energy | 6.0/6: 100% combo_points blood_fury, elaborate_planning, blood_frenzy
2:17.983 envenom Fluffy_Pillow 97.6/120: 81% energy | 6.0/6: 100% combo_points blood_fury, blood_frenzy
2:18.986 mutilate Fluffy_Pillow 74.7/120: 62% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:19.990 Waiting 2.600 sec 51.8/120: 43% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
2:22.590 garrote Fluffy_Pillow 103.2/120: 86% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
2:23.594 mutilate Fluffy_Pillow 70.4/120: 59% energy | 4.0/6: 67% combo_points envenom, blood_frenzy
2:24.597 Waiting 1.400 sec 47.5/120: 40% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
2:25.997 envenom Fluffy_Pillow 84.4/120: 70% energy | 6.0/6: 100% combo_points blood_frenzy
2:27.001 mutilate Fluffy_Pillow 61.5/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:28.008 Waiting 1.400 sec 38.7/120: 32% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, blood_frenzy
2:29.408 mutilate Fluffy_Pillow 55.2/120: 46% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
2:30.411 vanish Fluffy_Pillow 31.4/120: 26% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:30.411 rupture Fluffy_Pillow 31.4/120: 26% energy | 6.0/6: 100% combo_points vanish, envenom, elaborate_planning
2:31.416 exsanguinate Fluffy_Pillow 17.5/120: 15% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:32.422 kingsbane Fluffy_Pillow 48.7/120: 41% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:33.426 Waiting 0.300 sec 44.9/120: 37% energy | 1.0/6: 17% combo_points elaborate_planning
2:33.726 mutilate Fluffy_Pillow 68.3/120: 57% energy | 1.0/6: 17% combo_points elaborate_planning
2:34.732 Waiting 4.000 sec 44.5/120: 37% energy | 4.0/6: 67% combo_points elaborate_planning
2:38.732 garrote Fluffy_Pillow 120.0/120: 100% energy | 4.0/6: 67% combo_points
2:39.737 envenom Fluffy_Pillow 96.2/120: 80% energy | 5.0/6: 83% combo_points
2:40.742 mutilate Fluffy_Pillow 92.4/120: 77% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:41.746 mutilate Fluffy_Pillow 58.6/120: 49% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:42.752 Waiting 0.100 sec 34.8/120: 29% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:42.852 envenom Fluffy_Pillow 35.9/120: 30% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:43.857 Waiting 1.164 sec 22.1/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:45.021 mutilate Fluffy_Pillow 55.0/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:46.026 Waiting 1.240 sec 21.2/120: 18% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:47.266 mutilate Fluffy_Pillow 55.0/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:48.270 Waiting 0.442 sec 21.2/120: 18% energy | 6.0/6: 100% combo_points envenom
2:48.712 rupture Fluffy_Pillow 36.1/120: 30% energy | 6.0/6: 100% combo_points envenom
2:49.719 Waiting 1.100 sec 42.3/120: 35% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:50.819 mutilate Fluffy_Pillow 64.6/120: 54% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:51.823 Waiting 1.700 sec 30.7/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:53.523 garrote Fluffy_Pillow 69.7/120: 58% energy | 3.0/6: 50% combo_points elaborate_planning
2:54.737 Waiting 0.400 sec 48.2/120: 40% energy | 4.0/6: 67% combo_points
2:55.137 mutilate Fluffy_Pillow 62.6/120: 52% energy | 4.0/6: 67% combo_points
2:56.142 Waiting 0.654 sec 18.8/120: 16% energy | 6.0/6: 100% combo_points
2:56.796 rupture Fluffy_Pillow 36.1/120: 30% energy | 6.0/6: 100% combo_points
2:57.802 Waiting 1.200 sec 32.3/120: 27% energy | 0.0/6: 0% combo_points elaborate_planning
2:59.002 mutilate Fluffy_Pillow 55.7/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
3:00.005 Waiting 1.184 sec 21.8/120: 18% energy | 3.0/6: 50% combo_points elaborate_planning
3:01.189 mutilate Fluffy_Pillow 55.1/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
3:02.195 Waiting 2.956 sec 12.2/120: 10% energy | 6.0/6: 100% combo_points blood_frenzy
3:05.151 envenom Fluffy_Pillow 87.9/120: 73% energy | 6.0/6: 100% combo_points blood_frenzy
3:06.156 mutilate Fluffy_Pillow 65.1/120: 54% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:07.158 Waiting 2.200 sec 42.2/120: 35% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
3:09.358 garrote Fluffy_Pillow 88.8/120: 74% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
3:10.362 mutilate Fluffy_Pillow 55.9/120: 47% energy | 4.0/6: 67% combo_points envenom, blood_frenzy
3:11.367 Waiting 2.300 sec 33.0/120: 28% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
3:13.667 envenom Fluffy_Pillow 80.5/120: 67% energy | 6.0/6: 100% combo_points
3:14.670 mutilate Fluffy_Pillow 56.7/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:15.675 vendetta Fluffy_Pillow 32.9/120: 27% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
3:15.675 mutilate Fluffy_Pillow 120.0/120: 100% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
3:16.679 rupture Fluffy_Pillow 76.2/120: 63% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
3:17.684 exsanguinate Fluffy_Pillow 82.4/120: 69% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:18.689 kingsbane Fluffy_Pillow 113.6/120: 95% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:19.693 mutilate Fluffy_Pillow 109.7/120: 91% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
3:20.699 envenom Fluffy_Pillow 85.9/120: 72% energy | 5.0/6: 83% combo_points elaborate_planning
3:21.704 mutilate Fluffy_Pillow 83.1/120: 69% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:22.706 Waiting 2.600 sec 60.2/120: 50% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy
3:25.306 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy
3:26.312 mutilate Fluffy_Pillow 97.2/120: 81% energy | 3.0/6: 50% combo_points envenom, blood_frenzy
3:27.317 envenom Fluffy_Pillow 74.3/120: 62% energy | 6.0/6: 100% combo_points blood_frenzy
3:28.321 mutilate Fluffy_Pillow 61.4/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:29.327 Waiting 0.600 sec 38.6/120: 32% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
3:29.927 mutilate Fluffy_Pillow 55.8/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
3:30.932 Waiting 0.403 sec 22.7/120: 19% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
3:31.335 envenom Fluffy_Pillow 37.2/120: 31% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
3:32.340 Waiting 1.043 sec 23.4/120: 20% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:33.383 mutilate Fluffy_Pillow 55.0/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:34.387 Waiting 1.041 sec 21.2/120: 18% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:35.428 mutilate Fluffy_Pillow 62.8/120: 52% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:36.433 Waiting 0.641 sec 19.0/120: 16% energy | 6.0/6: 100% combo_points envenom
3:37.074 rupture Fluffy_Pillow 26.1/120: 22% energy | 6.0/6: 100% combo_points envenom
3:38.079 Waiting 2.042 sec 22.3/120: 19% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:40.121 garrote Fluffy_Pillow 65.0/120: 54% energy | 0.0/6: 0% combo_points elaborate_planning
3:41.309 Waiting 0.100 sec 54.2/120: 45% energy | 1.0/6: 17% combo_points elaborate_planning, blood_frenzy
3:41.409 mutilate Fluffy_Pillow 55.4/120: 46% energy | 1.0/6: 17% combo_points elaborate_planning, blood_frenzy
3:42.413 Waiting 1.931 sec 12.5/120: 10% energy | 3.0/6: 50% combo_points blood_frenzy
3:44.344 mutilate Fluffy_Pillow 55.9/120: 47% energy | 3.0/6: 50% combo_points blood_frenzy
3:45.346 rupture Fluffy_Pillow 33.0/120: 27% energy | 6.0/6: 100% combo_points blood_frenzy
3:46.350 Waiting 1.306 sec 20.1/120: 17% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:47.656 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:48.661 Waiting 1.893 sec 13.0/120: 11% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
3:50.554 mutilate Fluffy_Pillow 55.6/120: 46% energy | 3.0/6: 50% combo_points
3:51.558 Waiting 2.600 sec 31.8/120: 27% energy | 5.0/6: 83% combo_points
3:54.158 envenom Fluffy_Pillow 80.8/120: 67% energy | 5.0/6: 83% combo_points blood_frenzy
3:55.162 Waiting 0.800 sec 67.9/120: 57% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:55.962 garrote Fluffy_Pillow 87.6/120: 73% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:56.967 Waiting 0.100 sec 54.7/120: 46% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
3:57.067 mutilate Fluffy_Pillow 55.9/120: 47% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
3:58.072 Waiting 1.100 sec 33.1/120: 28% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
3:59.172 mutilate Fluffy_Pillow 56.3/120: 47% energy | 3.0/6: 50% combo_points envenom, blood_frenzy
4:00.176 Waiting 3.027 sec 23.5/120: 20% energy | 5.0/6: 83% combo_points blood_frenzy
4:03.203 mutilate Fluffy_Pillow 90.0/120: 75% energy | 5.0/6: 83% combo_points blood_frenzy
4:04.206 rupture Fluffy_Pillow 57.1/120: 48% energy | 6.0/6: 100% combo_points blood_frenzy
4:05.212 exsanguinate Fluffy_Pillow 54.3/120: 45% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
4:06.216 kingsbane Fluffy_Pillow 86.4/120: 72% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
4:07.220 mutilate Fluffy_Pillow 83.5/120: 70% energy | 1.0/6: 17% combo_points elaborate_planning, blood_frenzy
4:08.224 mutilate Fluffy_Pillow 60.7/120: 51% energy | 4.0/6: 67% combo_points elaborate_planning, blood_frenzy
4:09.228 envenom Fluffy_Pillow 37.8/120: 31% energy | 6.0/6: 100% combo_points blood_frenzy
4:10.234 Waiting 2.100 sec 34.9/120: 29% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:12.334 garrote Fluffy_Pillow 110.3/120: 92% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:13.339 mutilate Fluffy_Pillow 87.2/120: 73% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
4:14.344 mutilate Fluffy_Pillow 63.4/120: 53% energy | 4.0/6: 67% combo_points envenom
4:15.350 Waiting 0.500 sec 29.6/120: 25% energy | 6.0/6: 100% combo_points envenom
4:15.850 envenom Fluffy_Pillow 35.1/120: 29% energy | 6.0/6: 100% combo_points envenom
4:16.856 Waiting 1.300 sec 31.3/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:18.156 mutilate Fluffy_Pillow 65.8/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:19.160 Waiting 1.000 sec 42.0/120: 35% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:20.160 mutilate Fluffy_Pillow 63.1/120: 53% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:21.165 Waiting 0.800 sec 39.3/120: 33% energy | 6.0/6: 100% combo_points envenom
4:21.965 rupture Fluffy_Pillow 48.2/120: 40% energy | 6.0/6: 100% combo_points envenom
4:22.970 Waiting 0.100 sec 54.4/120: 45% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:23.070 mutilate Fluffy_Pillow 55.5/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:24.075 Waiting 3.092 sec 11.7/120: 10% energy | 2.0/6: 33% combo_points elaborate_planning
4:27.167 garrote Fluffy_Pillow 86.1/120: 72% energy | 2.0/6: 33% combo_points
4:28.337 mutilate Fluffy_Pillow 74.2/120: 62% energy | 3.0/6: 50% combo_points
4:29.340 rupture Fluffy_Pillow 30.3/120: 25% energy | 6.0/6: 100% combo_points
4:30.344 Waiting 1.700 sec 36.5/120: 30% energy | 0.0/6: 0% combo_points elaborate_planning
4:32.044 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
4:33.049 Waiting 1.300 sec 31.6/120: 26% energy | 3.0/6: 50% combo_points elaborate_planning
4:34.349 mutilate Fluffy_Pillow 66.1/120: 55% energy | 3.0/6: 50% combo_points
4:35.352 Waiting 2.845 sec 22.3/120: 19% energy | 5.0/6: 83% combo_points
4:38.197 envenom Fluffy_Pillow 86.6/120: 72% energy | 5.0/6: 83% combo_points blood_frenzy
4:39.202 mutilate Fluffy_Pillow 73.8/120: 61% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:40.205 Waiting 2.800 sec 40.9/120: 34% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
4:43.005 garrote Fluffy_Pillow 104.7/120: 87% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
4:44.010 mutilate Fluffy_Pillow 71.8/120: 60% energy | 4.0/6: 67% combo_points envenom, blood_frenzy
4:45.014 Waiting 1.400 sec 49.0/120: 41% energy | 6.0/6: 100% combo_points blood_frenzy
4:46.414 envenom Fluffy_Pillow 84.9/120: 71% energy | 6.0/6: 100% combo_points
4:47.419 vendetta Fluffy_Pillow 61.1/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:47.419 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:47.419 mutilate Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:48.422 mutilate Fluffy_Pillow 96.2/120: 80% energy | 4.0/6: 67% combo_points blood_fury, envenom, elaborate_planning
4:49.427 vanish Fluffy_Pillow 52.4/120: 44% energy | 6.0/6: 100% combo_points blood_fury, envenom, elaborate_planning
4:49.427 rupture Fluffy_Pillow 52.4/120: 44% energy | 6.0/6: 100% combo_points blood_fury, vanish, envenom, elaborate_planning
4:50.430 exsanguinate Fluffy_Pillow 58.5/120: 49% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:51.435 kingsbane Fluffy_Pillow 89.7/120: 75% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:52.440 mutilate Fluffy_Pillow 85.9/120: 72% energy | 1.0/6: 17% combo_points blood_fury, envenom, elaborate_planning
4:53.445 mutilate Fluffy_Pillow 62.1/120: 52% energy | 4.0/6: 67% combo_points blood_fury, elaborate_planning
4:54.450 envenom Fluffy_Pillow 38.3/120: 32% energy | 6.0/6: 100% combo_points blood_fury
4:55.454 Waiting 3.000 sec 34.5/120: 29% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:58.454 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:59.460 mutilate Fluffy_Pillow 96.2/120: 80% energy | 1.0/6: 17% combo_points blood_fury, envenom
5:00.465 mutilate Fluffy_Pillow 72.4/120: 60% energy | 4.0/6: 67% combo_points blood_fury, envenom
5:01.467 envenom Fluffy_Pillow 38.5/120: 32% energy | 6.0/6: 100% combo_points blood_fury
5:02.472 Waiting 1.000 sec 34.7/120: 29% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:03.472 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
5:04.474 Waiting 0.300 sec 32.0/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8809 8484 0
Agility 29397 27691 17346 (13641)
Stamina 41360 41360 25556
Intellect 5322 4997 0
Spirit 2 2 0
Health 2481600 2481600 0
Energy 120 120 0
Combo Points 6 6 0
Crit 44.27% 44.27% 10245
Haste 11.33% 11.33% 3683
Damage / Heal Versatility 6.31% 5.38% 2151
Attack Power 29397 27691 0
Mastery 69.52% 69.52% 3284
Armor 2236 2236 2236
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +1012 Crit, +448 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Dragonspur Wristguards
ilevel: 880, stats: { 159 Armor, +1447 Sta, +965 AgiInt, +569 Crit, +252 Haste }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Ascended Glory
ilevel: 885, stats: { +1516 Sta, +1136 Haste, +957 Crit }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Hunger of the Pack
ilevel: 865, stats: { +1418 StrAgi, +986 Crit }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand The Kingslayers
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand The Kingslayers
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Assassination_Exsg_T19M"
level=110
race=orc
role=attack
position=back
talents=2110131
artifact=43:0:0:0:0:323:3:324:3:325:3:326:3:327:3:328:3:329:3:330:3:331:3:332:1:333:1:334:1:335:1:337:1:346:1:347:1:1276:1
spec=assassination

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions+=/blood_fury,if=debuff.vendetta.up
actions+=/berserking,if=debuff.vendetta.up
actions+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions+=/call_action_list,name=cds
actions+=/rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
actions+=/pool_resource,for_next=1
actions+=/kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
actions+=/run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
actions+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions+=/call_action_list,name=exsang,if=dot.rupture.exsanguinated
actions+=/rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
actions+=/call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
actions+=/call_action_list,name=build_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=build_noex,if=!talent.exsanguinate.enabled

actions.build_ex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_ex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_ex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_ex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_ex+=/hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&((dot.rupture.exsanguinated&dot.rupture.remains<=2)|cooldown.exsanguinate.remains<=2))
actions.build_ex+=/mutilate,if=combo_points.deficit<=1&energy.deficit<=30
actions.build_ex+=/mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2

actions.build_noex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_noex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_noex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_noex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_noex+=/hemorrhage,if=combo_points.deficit>=1&refreshable
actions.build_noex+=/mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2

actions.cds=marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=target.time_to_die<20
actions.cds+=/vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
actions.cds+=/vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
actions.cds+=/vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25

actions.exsang=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die>6
actions.exsang+=/rupture,if=combo_points>=cp_max_spend&ticks_remain<2
actions.exsang+=/death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang+=/envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)

actions.exsang_combo=vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
actions.exsang_combo+=/rupture,if=combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)
actions.exsang_combo+=/exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
actions.exsang_combo+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions.exsang_combo+=/hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
actions.exsang_combo+=/call_action_list,name=build_ex

actions.finish_ex=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_ex+=/rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
actions.finish_ex+=/death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)

actions.finish_noex=variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_noex+=/rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_noex+=/rupture,if=combo_points>=cp_max_spend&((dot.rupture.refreshable|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
actions.finish_noex+=/death_from_above,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
actions.finish_noex+=/envenom,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)

actions.garrote=pool_resource,for_next=1
actions.garrote+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
actions.garrote+=/pool_resource,for_next=1
actions.garrote+=/garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=grove_keepers_robe,id=139207,bonus_id=1806
wrists=dragonspur_wristguards,id=138219,bonus_id=1806
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=ring_of_ascended_glory,id=142520,bonus_id=3469,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=hunger_of_the_pack,id=136975,bonus_id=1517
main_hand=the_kingslayers,id=128870,bonus_id=741,gem_id=139268/139261/139260,relic_id=1806/1806/1806
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=882.63
# gear_agility=17346
# gear_stamina=25556
# gear_crit_rating=10245
# gear_haste_rating=3683
# gear_mastery_rating=3284
# gear_versatility_rating=2151
# gear_armor=2236

Rogue_Assassination_T19M : 399888 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
399888.3 399888.3 322.9 / 0.081% 55348.5 / 13.8% 17628.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
22.7 22.7 Energy 49.92% 31.9 100.0% 100%
Talents
  • 15: Elaborate Planning
  • 30: Nightstalker
  • 45: Deeper Stratagem
  • 75: Thuggee (Assassination Rogue)
  • 90: Agonizing Poison (Assassination Rogue)
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Assassination_T19M 399888
auto_attack_mh 21176 5.3% 199.0 1.52sec 31988 21422 Direct 199.0 26257 52525 31988 40.8% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.95 198.95 0.00 0.00 1.4932 0.0000 6363976.39 9355648.11 31.98 21421.83 21421.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.10 40.26% 26256.72 16209 33994 26257.89 24526 28174 2103102 3091759 31.98
crit 81.12 40.77% 52524.76 32417 67988 52521.59 49290 55938 4260875 6263889 31.98
miss 37.73 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 10486 2.6% 197.2 1.53sec 15983 10600 Direct 197.2 13131 26257 15983 40.7% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 197.15 197.15 0.00 0.00 1.5079 0.0000 3151146.25 4632483.47 31.98 10599.71 10599.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.35 40.25% 13130.66 8104 16997 13130.53 12240 14016 1041924 1531727 31.98
crit 80.33 40.74% 26256.93 16209 33994 26257.12 24756 27954 2109222 3100756 31.98
miss 37.47 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Envenom 59991 15.0% 33.2 8.91sec 543333 540907 Direct 33.2 386016 770778 543333 40.9% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.19 33.19 0.00 0.00 1.0045 0.0000 18032213.93 18032213.93 0.00 540906.92 540906.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.62 59.11% 386016.02 189924 609182 386339.82 307268 466958 7573404 7573404 0.00
crit 13.57 40.89% 770778.16 379847 1218365 771288.77 582525 1001447 10458810 10458810 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
From the Shadows 17501 4.4% 204.1 2.77sec 25791 0 Direct 204.1 18326 36647 25791 40.7% 0.0%  

Stats details: from_the_shadows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 204.11 204.11 0.00 0.00 0.0000 0.0000 5264293.51 5264293.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.95 59.26% 18326.10 12072 19855 18328.07 17411 18747 2216499 2216499 0.00
crit 83.17 40.74% 36647.08 24144 39711 36651.89 35198 37832 3047795 3047795 0.00
 
 

Action details: from_the_shadows

Static Values
  • id:192434
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192434
  • name:From the Shadows
  • school:nature
  • tooltip:
  • description:{$@spelldesc192428=Declaring your Vendetta unleashes a barrage of poisoned daggers at the target for ${20*{$192434s1=10}*$m1} Nature damage over {$192432d=20 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.350000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10.00
  • base_dd_max:10.00
 
Garrote 36150 9.1% 17.5 17.84sec 620800 618044 Periodic 149.9 51521 103040 72514 40.7% 0.0% 99.7%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.51 0.00 149.89 149.89 1.0045 2.0000 10868925.66 10868925.66 0.00 34247.83 618044.22
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.8 59.25% 51520.68 31011 99469 51545.77 48234 55259 4575595 4575595 0.00
crit 61.1 40.75% 103040.15 62023 198939 103081.04 94502 112206 6293330 6293330 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Horrific Slam 20170 5.1% 119.2 2.18sec 50899 0 Direct 119.2 36145 72308 50899 40.8% 0.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.21 119.21 0.00 0.00 0.0000 0.0000 6067495.24 6067495.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.57 59.20% 36144.74 24898 37886 36144.54 33963 37531 2550774 2550774 0.00
crit 48.64 40.80% 72307.63 49795 75772 72304.03 67187 75422 3516721 3516721 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Kingsbane 14645 (21913) 3.7% (5.5%) 6.9 46.48sec 956658 952492 Periodic 46.9 66551 133204 93738 40.8% 0.0% 31.2%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 0.00 46.89 46.89 1.0045 2.0000 4395787.80 4395787.80 0.00 65333.24 952491.80
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.8 59.21% 66550.69 23555 172407 66688.56 51111 89674 1847926 1847926 0.00
crit 19.1 40.79% 133204.12 47109 356438 133441.70 94844 182903 2547862 2547862 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 4849 1.2% 6.9 46.48sec 211805 0 Direct 6.9 150194 300074 211800 41.1% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 1456568.79 1456568.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.05 58.89% 150193.66 104058 167734 149797.29 0 167734 608289 608289 0.00
crit 2.83 41.11% 300073.66 220927 335469 292589.34 0 335469 848280 848280 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 2419 0.6% 6.9 46.48sec 105644 0 Direct 6.9 75205 150282 105641 40.5% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 0.0000 0.0000 726504.26 726504.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.09 59.46% 75204.82 59833 83867 75022.89 0 83867 307498 307498 0.00
crit 2.79 40.54% 150282.39 104058 167734 146317.49 0 167734 419007 419007 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mark of the Hidden Satyr 7029 1.8% 17.0 17.59sec 124326 0 Direct 17.0 88373 176739 124327 40.7% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.01 17.01 0.00 0.00 0.0000 0.0000 2114327.15 2114327.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.09 59.31% 88373.17 61572 93693 88359.18 74207 93693 891412 891412 0.00
crit 6.92 40.69% 176739.39 123145 187385 176569.57 0 187385 1222915 1222915 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Mutilate 0 (60576) 0.0% (15.2%) 78.7 3.83sec 231416 230380

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.67 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 230379.55 230379.55
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit<=1&energy.deficit<=30
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage.{$?s1329=true}|!c1[][ Replaces Sinister Strike.] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 40364 10.1% 78.7 3.83sec 154198 0 Direct 78.7 105100 210113 154198 46.8% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.67 78.67 0.00 0.00 0.0000 0.0000 12130496.56 17832978.98 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.89 53.25% 105099.75 64335 134814 105108.46 96841 115105 4402326 6471836 31.98
crit 36.78 46.75% 210112.85 128669 269628 210100.87 188182 229269 7728171 11361143 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 20213 5.1% 78.7 3.83sec 77217 0 Direct 78.7 52557 105156 77217 46.9% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.67 78.67 0.00 0.00 0.0000 0.0000 6074556.45 8930173.38 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.79 53.12% 52557.17 32166 67404 52557.85 47905 56927 2196121 3228505 31.98
crit 36.88 46.88% 105155.70 64331 134807 105151.36 94970 115345 3878436 5701668 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Poison Bomb 23629 5.9% 38.0 5.96sec 186614 0 Direct 38.0 132605 265213 186616 40.7% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.04 38.04 0.00 0.00 0.0000 0.0000 7098409.56 7098409.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.55 59.27% 132605.34 97470 141997 132632.90 118736 141997 2989728 2989728 0.00
crit 15.49 40.73% 265212.59 198551 283993 265256.18 244658 283993 4108681 4108681 0.00
 
 

Action details: poison_bomb

Static Values
  • id:192660
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192660
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc192657=Envenom has a chance to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$192660s1=1}*6} Nature damage over {$192661d=3 seconds} to all enemies within it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Potion of the Old War 23452 5.8% 24.1 4.09sec 287425 0 Direct 24.1 204310 408815 287425 40.6% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.13 24.13 0.00 0.00 0.0000 0.0000 6936343.53 10197082.01 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.32 59.36% 204310.49 143757 218750 204270.82 177858 218750 2926705 4302534 31.98
crit 9.81 40.64% 408815.19 287514 437500 408816.82 334712 437500 4009638 5894548 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rupture 97816 24.5% 11.8 26.12sec 2487583 2476561 Periodic 146.9 132837 265906 200270 50.7% 0.0% 97.3%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.82 0.00 146.88 146.88 1.0045 1.9926 29414117.25 29414117.25 0.00 96585.08 2476561.19
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.4 49.33% 132836.97 61 401178 132895.84 108271 168337 9623470 9623470 0.00
crit 74.4 50.67% 265905.70 164 802356 266002.21 216930 334221 19790648 19790648 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${{$s1=0}*1*8/2} over 8 sec 2 points: ${{$s1=0}*2*12/2} over 12 sec 3 points: ${{$s1=0}*3*16/2} over 16 sec 4 points: ${{$s1=0}*4*20/2} over 20 sec 5 points: ${{$s1=0}*5*24/2} over 24 sec{$?s193531=false}[ 6 points: ${{$s1=0}*6*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Rogue_Assassination_T19M
Agonizing Poison 200.2 1.60sec

Stats details: agonizing_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: agonizing_poison

Static Values
  • id:200803
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200803
  • name:Agonizing Poison
  • school:nature
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=20}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${{$200803s1=4}}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T19M
  • harmful:false
  • if_expr:
 
Blood Fury 2.9 124.14sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.vendetta.up
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.9 122.66sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 5.3 62.05sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<20
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 10.6 6.6 28.5sec 17.0sec 45.17% 45.17% 6.6(6.6) 10.2

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 124.1sec 124.1sec 14.03% 14.03% 0.0(0.0) 2.7

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:14.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 12.42% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elaborate Planning 33.1 11.9 9.1sec 6.7sec 70.18% 56.88% 11.9(11.9) 32.4

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.15

Stack Uptimes

  • elaborate_planning_1:70.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Increases damage done by {$s1=15}%.
  • description:Increases damage done by {$s1=15}% for {$d=5 seconds}.
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom 18.6 14.6 16.1sec 8.9sec 63.33% 60.75% 14.6(14.6) 18.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:63.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Horrific Appendages 6.2 2.2 47.2sec 33.6sec 30.34% 30.34% 121.4(121.4) 5.9

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:30.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 69.0sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Vanish 2.9 0.0 122.7sec 122.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Assassination_T19M
envenom Energy 33.2 1161.6 35.0 35.0 15523.6
envenom Combo Points 33.2 167.3 5.0 5.0 107797.8
garrote Energy 17.5 787.9 45.0 45.0 13795.7
kingsbane Energy 6.9 240.7 35.0 35.0 27333.0
mutilate Energy 78.7 4326.7 55.0 55.0 4207.6
rupture Energy 11.8 295.6 25.0 25.0 99504.0
rupture Combo Points 11.8 70.9 6.0 6.0 414600.2
Resource Gains Type Count Total Average Overflow
kingsbane Combo Points 6.88 6.16 (2.56%) 0.90 0.72 10.40%
mutilate Combo Points 78.67 153.48 (63.81%) 1.95 3.85 2.45%
garrote Combo Points 17.51 17.51 (7.28%) 1.00 0.00 0.00%
energy_regen Energy 2112.15 3433.24 (50.99%) 1.63 113.13 3.19%
seal_fate Combo Points 76.48 63.37 (26.35%) 0.83 13.11 17.14%
Venomous Vim Energy 296.21 2853.88 (42.38%) 9.63 108.21 3.65%
Urge to Kill Energy 5.28 446.45 (6.63%) 84.58 186.96 29.52%
Resource RPS-Gain RPS-Loss
Energy 22.39 22.65
Combo Points 0.80 0.79
Combat End Resource Mean Min Max
Energy 41.09 0.07 120.00
Combo Points 2.32 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 3.1%

Procs

Count Interval
Seal Fate 76.5 5.1sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Assassination_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Rogue_Assassination_T19M Damage Per Second
Count 7499
Mean 399888.34
Minimum 354000.50
Maximum 460117.71
Spread ( max - min ) 106117.20
Range [ ( max - min ) / 2 * 100% ] 13.27%
Standard Deviation 14267.3059
5th Percentile 377688.80
95th Percentile 424161.97
( 95th Percentile - 5th Percentile ) 46473.17
Mean Distribution
Standard Deviation 164.7556
95.00% Confidence Intervall ( 399565.43 - 400211.26 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4889
0.1 Scale Factor Error with Delta=300 1737671
0.05 Scale Factor Error with Delta=300 6950684
0.01 Scale Factor Error with Delta=300 173767124
Priority Target DPS
Sample Data Rogue_Assassination_T19M Priority Target Damage Per Second
Count 7499
Mean 399888.34
Minimum 354000.50
Maximum 460117.71
Spread ( max - min ) 106117.20
Range [ ( max - min ) / 2 * 100% ] 13.27%
Standard Deviation 14267.3059
5th Percentile 377688.80
95th Percentile 424161.97
( 95th Percentile - 5th Percentile ) 46473.17
Mean Distribution
Standard Deviation 164.7556
95.00% Confidence Intervall ( 399565.43 - 400211.26 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4889
0.1 Scale Factor Error with Delta=300 1737671
0.05 Scale Factor Error with Delta=300 6950684
0.01 Scale Factor Error with Delta=300 173767124
DPS(e)
Sample Data Rogue_Assassination_T19M Damage Per Second (Effective)
Count 7499
Mean 399888.34
Minimum 354000.50
Maximum 460117.71
Spread ( max - min ) 106117.20
Range [ ( max - min ) / 2 * 100% ] 13.27%
Damage
Sample Data Rogue_Assassination_T19M Damage
Count 7499
Mean 120095162.32
Minimum 84829872.05
Maximum 156490755.13
Spread ( max - min ) 71660883.07
Range [ ( max - min ) / 2 * 100% ] 29.84%
DTPS
Sample Data Rogue_Assassination_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Assassination_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Assassination_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Assassination_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Assassination_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Assassination_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Assassination_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Assassination_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=old_war
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
9 2.87 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
A 0.00 call_action_list,name=cds
0.00 rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
0.00 pool_resource,for_next=1
B 6.88 kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
C 0.00 run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
D 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
E 0.00 call_action_list,name=exsang,if=dot.rupture.exsanguinated
0.00 rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
F 0.00 call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
G 0.00 call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
H 0.00 call_action_list,name=build_ex,if=talent.exsanguinate.enabled
I 0.00 call_action_list,name=build_noex,if=!talent.exsanguinate.enabled
actions.build_noex
# count action,conditions
0.00 hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
0.00 hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
0.00 fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
0.00 fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
0.00 hemorrhage,if=combo_points.deficit>=1&refreshable
J 78.67 mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2
actions.cds
# count action,conditions
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
K 0.32 vendetta,if=target.time_to_die<20
L 4.96 vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
0.00 vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
M 2.90 vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25
actions.finish_noex
# count action,conditions
0.00 variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
P 11.82 rupture,if=combo_points>=cp_max_spend&((dot.rupture.refreshable|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
0.00 death_from_above,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
Q 33.19 envenom,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
actions.garrote
# count action,conditions
0.00 pool_resource,for_next=1
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
0.00 pool_resource,for_next=1
R 17.51 garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

Sample Sequence

012456RJJMPL9BJJQJJQRJQJJPJRQJJQJJQJRBQJJPJJQRJL8QJJQJJQRJJPJJQBRJQJJPJJQRJJMPJL9JQJJQRJQBJQJQRJJPJJQJRJQJJPJQRJQLBJJQJJQRJJPJQJQRJQJJQJBRJMPJQJL9JQJJQRJQJJPJRQJBQJJQRJJP

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Assassination_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Assassination_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Assassination_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.004 mutilate Fluffy_Pillow 89.2/120: 74% energy | 1.0/6: 17% combo_points bloodlust, potion_of_the_old_war
0:02.010 mutilate Fluffy_Pillow 58.5/120: 49% energy | 4.0/6: 67% combo_points bloodlust, potion_of_the_old_war
0:03.013 Waiting 0.610 sec 17.8/120: 15% energy | 6.0/6: 100% combo_points bloodlust, potion_of_the_old_war
0:03.623 vanish Fluffy_Pillow 26.4/120: 22% energy | 6.0/6: 100% combo_points bloodlust, potion_of_the_old_war
0:03.623 rupture Fluffy_Pillow 26.4/120: 22% energy | 6.0/6: 100% combo_points bloodlust, vanish, potion_of_the_old_war
0:04.627 vendetta Fluffy_Pillow 25.7/120: 21% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:04.627 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:04.627 kingsbane Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:05.630 mutilate Fluffy_Pillow 109.2/120: 91% energy | 1.0/6: 17% combo_points bloodlust, blood_fury, elaborate_planning, horrific_appendages, potion_of_the_old_war
0:06.635 mutilate Fluffy_Pillow 79.1/120: 66% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:07.640 envenom Fluffy_Pillow 49.6/120: 41% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:08.646 Waiting 1.000 sec 40.1/120: 33% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:09.646 mutilate Fluffy_Pillow 65.5/120: 55% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:10.651 Waiting 1.000 sec 36.0/120: 30% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:11.651 mutilate Fluffy_Pillow 61.4/120: 51% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:12.656 Waiting 0.200 sec 31.9/120: 27% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, envenom, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:12.856 envenom Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, envenom, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:13.860 Waiting 0.900 sec 25.5/120: 21% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:14.760 garrote Fluffy_Pillow 49.4/120: 41% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:16.005 Waiting 0.800 sec 43.6/120: 36% energy | 1.0/6: 17% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:16.805 mutilate Fluffy_Pillow 55.1/120: 46% energy | 1.0/6: 17% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, potion_of_the_old_war
0:17.810 Waiting 0.200 sec 24.4/120: 20% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, potion_of_the_old_war
0:18.010 envenom Fluffy_Pillow 37.2/120: 31% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, envenom, horrific_appendages, potion_of_the_old_war
0:19.014 Waiting 1.402 sec 16.5/120: 14% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, potion_of_the_old_war
0:20.416 mutilate Fluffy_Pillow 56.4/120: 47% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages, potion_of_the_old_war
0:21.420 Waiting 1.362 sec 15.6/120: 13% energy | 3.0/6: 50% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages, potion_of_the_old_war
0:22.782 mutilate Fluffy_Pillow 56.2/120: 47% energy | 3.0/6: 50% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:23.788 rupture Fluffy_Pillow 26.7/120: 22% energy | 6.0/6: 100% combo_points bloodlust, envenom, horrific_appendages, blood_frenzy
0:24.792 Waiting 1.200 sec 27.2/120: 23% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, horrific_appendages, blood_frenzy
0:25.992 mutilate Fluffy_Pillow 55.7/120: 46% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, horrific_appendages, blood_frenzy
0:26.997 Waiting 3.700 sec 26.2/120: 22% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning, horrific_appendages, blood_frenzy
0:30.697 garrote Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points bloodlust, horrific_appendages, blood_frenzy
0:31.701 envenom Fluffy_Pillow 100.5/120: 84% energy | 4.0/6: 67% combo_points bloodlust, horrific_appendages, blood_frenzy
0:32.705 mutilate Fluffy_Pillow 90.5/120: 75% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:33.710 mutilate Fluffy_Pillow 59.8/120: 50% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:34.715 Waiting 0.500 sec 29.1/120: 24% energy | 5.0/6: 83% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:35.215 envenom Fluffy_Pillow 36.2/120: 30% energy | 5.0/6: 83% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:36.221 Waiting 1.400 sec 35.4/120: 30% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:37.621 mutilate Fluffy_Pillow 55.3/120: 46% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:38.625 Waiting 1.000 sec 34.6/120: 29% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:39.625 mutilate Fluffy_Pillow 58.7/120: 49% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:40.629 Waiting 0.800 sec 26.5/120: 22% energy | 5.0/6: 83% combo_points envenom, horrific_appendages, blood_frenzy
0:41.429 envenom Fluffy_Pillow 36.0/120: 30% energy | 5.0/6: 83% combo_points envenom, horrific_appendages, blood_frenzy
0:42.436 Waiting 1.200 sec 32.9/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:43.636 mutilate Fluffy_Pillow 57.2/120: 48% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:44.641 Waiting 4.000 sec 24.1/120: 20% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:48.641 garrote Fluffy_Pillow 111.5/120: 93% energy | 2.0/6: 33% combo_points envenom, horrific_appendages, blood_frenzy
0:49.646 kingsbane Fluffy_Pillow 88.4/120: 74% energy | 3.0/6: 50% combo_points horrific_appendages
0:50.648 envenom Fluffy_Pillow 75.3/120: 63% energy | 5.0/6: 83% combo_points horrific_appendages, blood_frenzy
0:51.652 mutilate Fluffy_Pillow 62.2/120: 52% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:52.657 Waiting 1.400 sec 29.1/120: 24% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:54.057 mutilate Fluffy_Pillow 65.7/120: 55% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:55.061 Waiting 0.297 sec 22.7/120: 19% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:55.358 rupture Fluffy_Pillow 26.2/120: 22% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:56.363 Waiting 1.300 sec 33.1/120: 28% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:57.663 mutilate Fluffy_Pillow 58.5/120: 49% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
0:58.668 Waiting 1.400 sec 25.4/120: 21% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy
1:00.068 mutilate Fluffy_Pillow 62.0/120: 52% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy
1:01.074 Waiting 0.607 sec 19.0/120: 16% energy | 5.0/6: 83% combo_points blood_frenzy
1:01.681 envenom Fluffy_Pillow 36.2/120: 30% energy | 5.0/6: 83% combo_points blood_frenzy
1:02.684 Waiting 3.962 sec 23.1/120: 19% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:06.646 garrote Fluffy_Pillow 110.1/120: 92% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:07.650 mutilate Fluffy_Pillow 86.6/120: 72% energy | 1.0/6: 17% combo_points envenom
1:08.653 vendetta Fluffy_Pillow 52.6/120: 44% energy | 4.0/6: 67% combo_points
1:08.653 potion Fluffy_Pillow 120.0/120: 100% energy | 4.0/6: 67% combo_points
1:08.653 envenom Fluffy_Pillow 120.0/120: 100% energy | 4.0/6: 67% combo_points potion_of_the_old_war
1:09.658 mutilate Fluffy_Pillow 106.0/120: 88% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:10.663 mutilate Fluffy_Pillow 71.9/120: 60% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:11.665 Waiting 0.500 sec 37.9/120: 32% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:12.165 envenom Fluffy_Pillow 53.3/120: 44% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:13.170 Waiting 0.900 sec 29.6/120: 25% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:14.070 mutilate Fluffy_Pillow 60.3/120: 50% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:15.076 Waiting 1.557 sec 17.2/120: 14% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:16.633 mutilate Fluffy_Pillow 55.7/120: 46% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:17.638 Waiting 0.403 sec 22.6/120: 19% energy | 6.0/6: 100% combo_points envenom, blood_frenzy, potion_of_the_old_war
1:18.041 envenom Fluffy_Pillow 37.4/120: 31% energy | 6.0/6: 100% combo_points envenom, blood_frenzy, potion_of_the_old_war
1:19.045 Waiting 5.604 sec 14.3/120: 12% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:24.649 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, potion_of_the_old_war
1:25.653 mutilate Fluffy_Pillow 96.0/120: 80% energy | 1.0/6: 17% combo_points envenom, potion_of_the_old_war
1:26.659 mutilate Fluffy_Pillow 61.9/120: 52% energy | 4.0/6: 67% combo_points envenom, potion_of_the_old_war
1:27.663 rupture Fluffy_Pillow 27.9/120: 23% energy | 6.0/6: 100% combo_points potion_of_the_old_war
1:28.667 Waiting 1.404 sec 23.9/120: 20% energy | 0.0/6: 0% combo_points elaborate_planning, potion_of_the_old_war
1:30.071 mutilate Fluffy_Pillow 59.9/120: 50% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy, potion_of_the_old_war
1:31.076 Waiting 1.589 sec 16.8/120: 14% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy, potion_of_the_old_war
1:32.665 mutilate Fluffy_Pillow 55.7/120: 46% energy | 2.0/6: 33% combo_points blood_frenzy, potion_of_the_old_war
1:33.669 Waiting 0.403 sec 22.6/120: 19% energy | 4.0/6: 67% combo_points blood_frenzy
1:34.072 envenom Fluffy_Pillow 37.4/120: 31% energy | 4.0/6: 67% combo_points blood_frenzy
1:36.097 kingsbane Fluffy_Pillow 46.4/120: 39% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:37.104 Waiting 5.541 sec 23.3/120: 19% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
1:42.645 garrote Fluffy_Pillow 120.0/120: 100% energy | 1.0/6: 17% combo_points
1:43.648 mutilate Fluffy_Pillow 85.9/120: 72% energy | 2.0/6: 33% combo_points
1:44.652 envenom Fluffy_Pillow 61.9/120: 52% energy | 4.0/6: 67% combo_points
1:45.658 Waiting 0.400 sec 37.9/120: 32% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:46.058 mutilate Fluffy_Pillow 62.3/120: 52% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:47.062 Waiting 1.621 sec 18.2/120: 15% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
1:48.683 mutilate Fluffy_Pillow 55.9/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
1:49.688 Waiting 0.385 sec 21.9/120: 18% energy | 6.0/6: 100% combo_points
1:50.073 rupture Fluffy_Pillow 36.1/120: 30% energy | 6.0/6: 100% combo_points
1:51.078 Waiting 1.269 sec 22.1/120: 18% energy | 0.0/6: 0% combo_points elaborate_planning
1:52.347 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning
1:53.352 Waiting 2.201 sec 11.9/120: 10% energy | 3.0/6: 50% combo_points elaborate_planning
1:55.553 mutilate Fluffy_Pillow 55.9/120: 47% energy | 3.0/6: 50% combo_points
1:56.559 Waiting 0.300 sec 31.9/120: 27% energy | 6.0/6: 100% combo_points
1:56.859 envenom Fluffy_Pillow 35.2/120: 29% energy | 6.0/6: 100% combo_points
1:57.865 Waiting 2.752 sec 21.2/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:00.617 garrote Fluffy_Pillow 81.2/120: 68% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:01.622 Waiting 0.100 sec 47.2/120: 39% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
2:01.722 mutilate Fluffy_Pillow 58.3/120: 49% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
2:02.727 Waiting 1.300 sec 24.2/120: 20% energy | 3.0/6: 50% combo_points envenom
2:04.027 mutilate Fluffy_Pillow 58.4/120: 49% energy | 3.0/6: 50% combo_points
2:05.032 Waiting 0.971 sec 14.4/120: 12% energy | 6.0/6: 100% combo_points
2:06.003 vanish Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points
2:06.003 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points vanish
2:07.006 Waiting 1.000 sec 30.9/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning
2:08.006 mutilate Fluffy_Pillow 61.9/120: 52% energy | 0.0/6: 0% combo_points elaborate_planning
2:09.010 vendetta Fluffy_Pillow 17.8/120: 15% energy | 4.0/6: 67% combo_points elaborate_planning
2:09.010 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 4.0/6: 67% combo_points elaborate_planning
2:09.010 mutilate Fluffy_Pillow 120.0/120: 100% energy | 4.0/6: 67% combo_points blood_fury, elaborate_planning
2:10.015 envenom Fluffy_Pillow 96.0/120: 80% energy | 6.0/6: 100% combo_points blood_fury, elaborate_planning
2:11.019 mutilate Fluffy_Pillow 71.9/120: 60% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
2:12.025 Waiting 0.700 sec 47.9/120: 40% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning
2:12.725 mutilate Fluffy_Pillow 55.6/120: 46% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning
2:13.729 Waiting 0.419 sec 21.5/120: 18% energy | 5.0/6: 83% combo_points blood_fury, envenom, elaborate_planning
2:14.148 envenom Fluffy_Pillow 36.1/120: 30% energy | 5.0/6: 83% combo_points blood_fury, envenom, elaborate_planning
2:15.154 Waiting 3.484 sec 12.1/120: 10% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
2:18.638 garrote Fluffy_Pillow 90.4/120: 75% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:19.640 mutilate Fluffy_Pillow 57.2/120: 48% energy | 1.0/6: 17% combo_points blood_fury, envenom, horrific_appendages, blood_frenzy
2:20.644 Waiting 0.100 sec 34.2/120: 28% energy | 4.0/6: 67% combo_points blood_fury, envenom, horrific_appendages, blood_frenzy
2:20.744 envenom Fluffy_Pillow 35.3/120: 29% energy | 4.0/6: 67% combo_points blood_fury, envenom, horrific_appendages, blood_frenzy
2:22.006 kingsbane Fluffy_Pillow 35.3/120: 29% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:23.011 Waiting 1.976 sec 12.2/120: 10% energy | 2.0/6: 33% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:24.987 mutilate Fluffy_Pillow 55.7/120: 46% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:25.990 Waiting 0.304 sec 22.6/120: 19% energy | 4.0/6: 67% combo_points envenom, horrific_appendages, blood_frenzy
2:26.294 envenom Fluffy_Pillow 36.2/120: 30% energy | 4.0/6: 67% combo_points envenom, horrific_appendages, blood_frenzy
2:27.299 Waiting 2.003 sec 13.1/120: 11% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:29.302 mutilate Fluffy_Pillow 56.0/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
2:30.306 Waiting 0.300 sec 31.9/120: 27% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, horrific_appendages
2:30.606 envenom Fluffy_Pillow 35.2/120: 29% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
2:31.609 Waiting 4.993 sec 12.0/120: 10% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:36.602 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, blood_frenzy
2:37.606 mutilate Fluffy_Pillow 86.9/120: 72% energy | 1.0/6: 17% combo_points blood_frenzy
2:38.610 mutilate Fluffy_Pillow 63.8/120: 53% energy | 3.0/6: 50% combo_points blood_frenzy
2:39.615 Waiting 0.359 sec 20.7/120: 17% energy | 6.0/6: 100% combo_points blood_frenzy
2:39.974 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points blood_frenzy
2:40.979 Waiting 1.100 sec 31.6/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning
2:42.079 mutilate Fluffy_Pillow 63.6/120: 53% energy | 0.0/6: 0% combo_points elaborate_planning
2:43.081 Waiting 1.496 sec 19.6/120: 16% energy | 2.0/6: 33% combo_points elaborate_planning
2:44.577 mutilate Fluffy_Pillow 55.9/120: 47% energy | 2.0/6: 33% combo_points elaborate_planning
2:45.582 Waiting 1.201 sec 11.9/120: 10% energy | 5.0/6: 83% combo_points
2:46.783 envenom Fluffy_Pillow 45.0/120: 37% energy | 5.0/6: 83% combo_points
2:47.787 Waiting 1.300 sec 31.0/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:49.087 mutilate Fluffy_Pillow 55.1/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:50.091 Waiting 4.600 sec 31.1/120: 26% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
2:54.691 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points
2:55.697 mutilate Fluffy_Pillow 96.0/120: 80% energy | 3.0/6: 50% combo_points
2:56.701 envenom Fluffy_Pillow 61.9/120: 52% energy | 6.0/6: 100% combo_points
2:57.705 Waiting 0.300 sec 47.9/120: 40% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:58.005 mutilate Fluffy_Pillow 61.2/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:59.011 Waiting 1.718 sec 17.2/120: 14% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
3:00.729 mutilate Fluffy_Pillow 55.9/120: 47% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
3:01.734 Waiting 0.285 sec 21.9/120: 18% energy | 6.0/6: 100% combo_points envenom
3:02.019 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points envenom
3:03.024 Waiting 1.220 sec 21.2/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:04.244 mutilate Fluffy_Pillow 55.7/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:05.248 Waiting 1.047 sec 12.6/120: 10% energy | 4.0/6: 67% combo_points elaborate_planning, blood_frenzy
3:06.295 envenom Fluffy_Pillow 45.0/120: 37% energy | 4.0/6: 67% combo_points elaborate_planning, blood_frenzy
3:07.300 Waiting 5.359 sec 21.9/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:12.659 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points blood_frenzy
3:13.664 mutilate Fluffy_Pillow 96.1/120: 80% energy | 1.0/6: 17% combo_points
3:14.670 envenom Fluffy_Pillow 62.1/120: 52% energy | 4.0/6: 67% combo_points
3:15.675 vendetta Fluffy_Pillow 48.0/120: 40% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:15.675 kingsbane Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:16.679 mutilate Fluffy_Pillow 106.0/120: 88% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
3:17.684 mutilate Fluffy_Pillow 71.9/120: 60% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
3:18.689 envenom Fluffy_Pillow 37.9/120: 32% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
3:19.694 Waiting 2.003 sec 23.9/120: 20% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:21.697 mutilate Fluffy_Pillow 65.7/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:22.703 Waiting 1.300 sec 31.7/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:24.003 mutilate Fluffy_Pillow 65.9/120: 55% energy | 3.0/6: 50% combo_points envenom
3:25.007 Waiting 0.686 sec 21.9/120: 18% energy | 5.0/6: 83% combo_points envenom
3:25.693 envenom Fluffy_Pillow 39.4/120: 33% energy | 5.0/6: 83% combo_points envenom
3:26.699 Waiting 4.000 sec 25.3/120: 21% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:30.699 garrote Fluffy_Pillow 109.0/120: 91% energy | 0.0/6: 0% combo_points envenom
3:31.704 mutilate Fluffy_Pillow 85.0/120: 71% energy | 1.0/6: 17% combo_points envenom
3:32.707 Waiting 0.400 sec 50.9/120: 42% energy | 5.0/6: 83% combo_points
3:33.107 mutilate Fluffy_Pillow 55.3/120: 46% energy | 5.0/6: 83% combo_points
3:34.113 rupture Fluffy_Pillow 31.3/120: 26% energy | 6.0/6: 100% combo_points
3:35.117 Waiting 1.710 sec 17.2/120: 14% energy | 0.0/6: 0% combo_points elaborate_planning
3:36.827 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning
3:37.832 Waiting 0.385 sec 21.9/120: 18% energy | 4.0/6: 67% combo_points elaborate_planning
3:38.217 envenom Fluffy_Pillow 36.1/120: 30% energy | 4.0/6: 67% combo_points elaborate_planning
3:39.222 Waiting 2.185 sec 12.1/120: 10% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:41.407 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:42.413 Waiting 0.300 sec 31.9/120: 27% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
3:42.713 envenom Fluffy_Pillow 35.2/120: 29% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
3:43.718 Waiting 4.954 sec 21.1/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:48.672 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points horrific_appendages
3:49.678 mutilate Fluffy_Pillow 96.9/120: 81% energy | 1.0/6: 17% combo_points horrific_appendages, blood_frenzy
3:50.681 envenom Fluffy_Pillow 63.8/120: 53% energy | 4.0/6: 67% combo_points horrific_appendages, blood_frenzy
3:51.685 Waiting 0.400 sec 50.7/120: 42% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:52.085 mutilate Fluffy_Pillow 65.5/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:53.091 Waiting 1.117 sec 22.4/120: 19% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:54.208 mutilate Fluffy_Pillow 55.7/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:55.213 Waiting 1.046 sec 12.6/120: 10% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:56.259 envenom Fluffy_Pillow 45.0/120: 37% energy | 5.0/6: 83% combo_points horrific_appendages, blood_frenzy
3:57.263 Waiting 1.161 sec 21.9/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:58.424 mutilate Fluffy_Pillow 55.7/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:59.430 Waiting 1.201 sec 11.9/120: 10% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:00.631 kingsbane Fluffy_Pillow 45.0/120: 37% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:01.682 Waiting 5.000 sec 31.5/120: 26% energy | 4.0/6: 67% combo_points envenom
4:06.682 garrote Fluffy_Pillow 120.0/120: 100% energy | 4.0/6: 67% combo_points
4:07.688 mutilate Fluffy_Pillow 86.0/120: 72% energy | 5.0/6: 83% combo_points
4:08.693 vanish Fluffy_Pillow 52.0/120: 43% energy | 6.0/6: 100% combo_points
4:08.693 rupture Fluffy_Pillow 52.0/120: 43% energy | 6.0/6: 100% combo_points vanish
4:09.698 Waiting 0.700 sec 37.9/120: 32% energy | 0.0/6: 0% combo_points elaborate_planning
4:10.398 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
4:11.402 Waiting 0.873 sec 21.8/120: 18% energy | 4.0/6: 67% combo_points elaborate_planning, blood_frenzy
4:12.275 envenom Fluffy_Pillow 42.1/120: 35% energy | 4.0/6: 67% combo_points elaborate_planning, blood_frenzy
4:13.278 Waiting 1.400 sec 29.0/120: 24% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:14.678 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:15.683 vendetta Fluffy_Pillow 22.5/120: 19% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
4:15.683 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
4:15.683 mutilate Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
4:16.688 envenom Fluffy_Pillow 86.9/120: 72% energy | 6.0/6: 100% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
4:17.694 mutilate Fluffy_Pillow 73.9/120: 62% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
4:18.699 Waiting 0.400 sec 50.8/120: 42% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
4:19.099 mutilate Fluffy_Pillow 55.5/120: 46% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
4:20.103 Waiting 0.616 sec 22.4/120: 19% energy | 6.0/6: 100% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
4:20.719 envenom Fluffy_Pillow 39.7/120: 33% energy | 6.0/6: 100% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
4:21.720 Waiting 2.916 sec 16.1/120: 13% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:24.636 garrote Fluffy_Pillow 77.9/120: 65% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:25.641 Waiting 0.200 sec 53.9/120: 45% energy | 1.0/6: 17% combo_points blood_fury, envenom, elaborate_planning
4:25.841 mutilate Fluffy_Pillow 56.1/120: 47% energy | 1.0/6: 17% combo_points blood_fury, envenom
4:26.846 Waiting 0.300 sec 32.0/120: 27% energy | 5.0/6: 83% combo_points blood_fury, envenom
4:27.146 envenom Fluffy_Pillow 35.3/120: 29% energy | 5.0/6: 83% combo_points blood_fury, envenom
4:28.150 Waiting 1.941 sec 21.3/120: 18% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:30.091 mutilate Fluffy_Pillow 62.5/120: 52% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:31.096 Waiting 1.600 sec 28.4/120: 24% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:32.696 mutilate Fluffy_Pillow 65.9/120: 55% energy | 2.0/6: 33% combo_points envenom
4:33.700 Waiting 0.338 sec 22.2/120: 18% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
4:34.038 rupture Fluffy_Pillow 36.2/120: 30% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
4:35.044 Waiting 1.100 sec 33.1/120: 28% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
4:36.144 mutilate Fluffy_Pillow 56.2/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
4:37.147 Waiting 5.463 sec 23.1/120: 19% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
4:42.610 garrote Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points blood_frenzy
4:43.614 envenom Fluffy_Pillow 96.7/120: 81% energy | 4.0/6: 67% combo_points
4:44.619 mutilate Fluffy_Pillow 82.7/120: 69% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:45.622 kingsbane Fluffy_Pillow 48.6/120: 41% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, horrific_appendages
4:46.680 Waiting 0.500 sec 35.2/120: 29% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, horrific_appendages
4:47.180 envenom Fluffy_Pillow 50.6/120: 42% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, horrific_appendages
4:48.185 Waiting 0.800 sec 36.6/120: 30% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
4:48.985 mutilate Fluffy_Pillow 55.3/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
4:49.990 Waiting 2.056 sec 11.3/120: 9% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages
4:52.046 mutilate Fluffy_Pillow 63.7/120: 53% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages
4:53.051 Waiting 0.500 sec 29.7/120: 25% energy | 5.0/6: 83% combo_points envenom, horrific_appendages
4:53.551 envenom Fluffy_Pillow 35.2/120: 29% energy | 5.0/6: 83% combo_points envenom, horrific_appendages
4:54.554 Waiting 6.056 sec 21.1/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
5:00.610 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom
5:01.614 mutilate Fluffy_Pillow 96.0/120: 80% energy | 1.0/6: 17% combo_points
5:02.619 mutilate Fluffy_Pillow 61.9/120: 52% energy | 4.0/6: 67% combo_points
5:03.624 rupture Fluffy_Pillow 27.9/120: 23% energy | 6.0/6: 100% combo_points
5:04.628 Waiting 0.200 sec 24.8/120: 21% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8809 8484 0
Agility 27700 25994 15730 (12223)
Stamina 40654 40654 25013
Intellect 5322 4997 0
Spirit 2 2 0
Health 2439240 2439240 0
Energy 120 120 0
Combo Points 6 6 0
Crit 40.78% 40.78% 9023
Haste 9.17% 9.17% 2979
Damage / Heal Versatility 6.31% 5.38% 2151
Attack Power 27700 25994 0
Mastery 89.80% 89.80% 5057
Armor 2236 2236 2236
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 881.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Soultrapper's Pendant
ilevel: 860, stats: { +1201 Sta, +1144 Crit, +762 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +1012 Crit, +448 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Dragonspur Wristguards
ilevel: 880, stats: { 159 Armor, +1447 Sta, +965 AgiInt, +569 Crit, +252 Haste }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Ascended Glory
ilevel: 885, stats: { +1516 Sta, +1136 Haste, +957 Crit }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand The Kingslayers
ilevel: 894, weapon: { 3437 - 6384, 1.8 }, stats: { +838 Agi, +1257 Sta, +335 Crit, +321 Mastery }, relics: { +48 ilevels, +48 ilevels, +48 ilevels }
Local Off Hand The Kingslayers
ilevel: 894, weapon: { 3437 - 6384, 1.8 }, stats: { +838 Agi, +1257 Sta, +335 Crit, +321 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Assassination_T19M"
level=110
race=orc
role=attack
position=back
talents=2110111
artifact=43:0:0:0:0:323:3:324:3:325:3:326:3:327:3:328:3:329:3:330:3:331:3:332:1:333:1:334:1:335:1:337:1:346:1:347:1:1276:1
spec=assassination

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions+=/blood_fury,if=debuff.vendetta.up
actions+=/berserking,if=debuff.vendetta.up
actions+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions+=/call_action_list,name=cds
actions+=/rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
actions+=/pool_resource,for_next=1
actions+=/kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
actions+=/run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
actions+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions+=/call_action_list,name=exsang,if=dot.rupture.exsanguinated
actions+=/rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
actions+=/call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
actions+=/call_action_list,name=build_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=build_noex,if=!talent.exsanguinate.enabled

actions.build_ex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_ex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_ex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_ex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_ex+=/hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&((dot.rupture.exsanguinated&dot.rupture.remains<=2)|cooldown.exsanguinate.remains<=2))
actions.build_ex+=/mutilate,if=combo_points.deficit<=1&energy.deficit<=30
actions.build_ex+=/mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2

actions.build_noex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_noex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_noex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_noex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_noex+=/hemorrhage,if=combo_points.deficit>=1&refreshable
actions.build_noex+=/mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2

actions.cds=marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=target.time_to_die<20
actions.cds+=/vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
actions.cds+=/vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
actions.cds+=/vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25

actions.exsang=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die>6
actions.exsang+=/rupture,if=combo_points>=cp_max_spend&ticks_remain<2
actions.exsang+=/death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang+=/envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)

actions.exsang_combo=vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
actions.exsang_combo+=/rupture,if=combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)
actions.exsang_combo+=/exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
actions.exsang_combo+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions.exsang_combo+=/hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
actions.exsang_combo+=/call_action_list,name=build_ex

actions.finish_ex=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_ex+=/rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
actions.finish_ex+=/death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)

actions.finish_noex=variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_noex+=/rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_noex+=/rupture,if=combo_points>=cp_max_spend&((dot.rupture.refreshable|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
actions.finish_noex+=/death_from_above,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
actions.finish_noex+=/envenom,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)

actions.garrote=pool_resource,for_next=1
actions.garrote+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
actions.garrote+=/pool_resource,for_next=1
actions.garrote+=/garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=soultrappers_pendant,id=141506,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=grove_keepers_robe,id=139207,bonus_id=1806
wrists=dragonspur_wristguards,id=138219,bonus_id=1806
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=ring_of_ascended_glory,id=142520,bonus_id=3469,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=spontaneous_appendages,id=139325,bonus_id=1806
main_hand=the_kingslayers,id=128870,bonus_id=741,gem_id=137549/137543/136718,relic_id=1517:1727/1517:1727/1517:1727
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=880.81
# gear_agility=15730
# gear_stamina=25013
# gear_crit_rating=9023
# gear_haste_rating=2979
# gear_mastery_rating=5057
# gear_versatility_rating=2151
# gear_armor=2236

Rogue_Outlaw_T19M : 424239 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
424238.6 424238.6 652.7 / 0.154% 113150.6 / 26.7% 13468.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
31.4 31.4 Energy 11.36% 64.5 100.0% 100%
Talents
  • 15: Ghostly Strike (Outlaw Rogue)
  • 30: Hit and Run (Outlaw Rogue)
  • 45: Deeper Stratagem
  • 90: Alacrity
  • 100: Marked for Death
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Outlaw_T19M 424239
Ambush 3852 0.9% 6.0 56.68sec 192640 191799 Direct 6.0 133223 265846 192643 44.8% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.0045 0.0000 1154247.95 1696853.82 31.98 191799.26 191799.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.31 55.20% 133222.76 124239 136663 130412.49 0 136663 440618 647750 31.35
crit 2.68 44.80% 265846.41 248479 273327 255293.25 0 273327 713630 1049103 30.74
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=2} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
auto_attack_mh 27848 6.6% 203.4 1.48sec 41153 28431 Direct 203.4 32296 64577 41153 46.4% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.40 203.40 0.00 0.00 1.4475 0.0000 8370447.11 12305350.13 31.98 28430.78 28430.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.46 34.64% 32296.03 29431 32375 32295.01 31777 32375 2275687 3345476 31.98
crit 94.38 46.40% 64577.30 58863 64749 64578.85 63582 64749 6094760 8959875 31.98
miss 38.56 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 13653 3.2% 199.5 1.51sec 20569 13906 Direct 199.5 16147 32286 20569 46.4% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 199.51 199.51 0.00 0.00 1.4792 0.0000 4103756.54 6032910.83 31.98 13905.57 13905.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.95 34.56% 16147.01 14716 16187 16146.38 15893 16187 1113315 1636678 31.98
crit 92.62 46.43% 32285.59 29431 32375 32286.17 31711 32375 2990442 4396233 31.98
miss 37.94 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Darkstrikes 9552 2.2% 36.5 7.79sec 78375 0 Direct 36.5 53412 106817 78376 46.7% 0.0%  

Stats details: darkstrikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.51 36.51 0.00 0.00 0.0000 0.0000 2861839.75 2861839.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.45 53.26% 53412.10 48583 53441 53411.86 51706 53441 1038683 1038683 0.00
crit 17.07 46.74% 106817.20 97166 106882 106818.62 103349 106882 1823157 1823157 0.00
 
 

Action details: darkstrikes

Static Values
  • id:215659
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215659
  • name:Darkstrikes
  • school:shadow
  • tooltip:Absorbs up to $w2 damage.
  • description:{$@spelldesc215658=Empower yourself with dark energy, causing your attacks to have a chance to inflict {$215659s1=26007 to 28745} additional Shadow damage and grant you a shield for {$215659s2=30418}. Lasts {$d=15 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:43412.05
  • base_dd_max:47981.74
 
Ghostly Strike 5848 1.4% 20.8 14.79sec 84727 90234 Direct 20.8 57940 115777 84728 46.3% 0.0%  

Stats details: ghostly_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.75 20.75 97.82 0.00 0.9390 2.9825 1758121.94 2584605.78 31.98 5649.15 90234.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.14 53.69% 57939.57 53562 58919 57924.97 54634 58919 645448 948869 31.98
crit 9.61 46.31% 115777.24 107125 117837 115754.10 107125 117837 1112674 1635737 31.98
 
 

Action details: ghostly_strike

Static Values
  • id:196937
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
Spelldata
  • id:196937
  • name:Ghostly Strike
  • school:physical
  • tooltip:Taking {$s5=10}% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take {$s5=10}% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.94
 
Greed 15361 (23046) 3.6% (5.4%) 29.7 9.91sec 232995 0 Direct 29.7 106089 212135 155296 46.4% 0.0%  

Stats details: greed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.70 29.70 0.00 0.00 0.0000 0.0000 4612758.82 6781192.40 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.92 53.60% 106088.60 96631 106294 106088.92 100925 106294 1688987 2482970 31.98
crit 13.78 46.40% 212134.54 193261 212587 212127.86 0 212587 2923772 4298222 31.97
 
 

Action details: greed

Static Values
  • id:202822
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202822
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
    Greed (_oh) 7685 1.8% 29.7 9.91sec 77704 0 Direct 29.7 53044 106068 77706 46.5% 0.0%  

Stats details: greed_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.70 29.70 0.00 0.00 0.0000 0.0000 2307932.15 3392878.87 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.89 53.49% 53044.09 48315 53147 53044.24 51113 53147 842756 1238932 31.98
crit 13.81 46.51% 106067.79 96631 106294 106078.48 102428 106294 1465176 2153947 31.98
 
 

Action details: greed_oh

Static Values
  • id:202823
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202823
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Main Gauche 33166 7.8% 164.6 1.82sec 60562 0 Direct 164.6 41378 82738 60563 46.4% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 164.58 164.58 0.00 0.00 0.0000 0.0000 9967415.51 14653044.95 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.24 53.62% 41377.77 37688 41457 41376.97 40663 41457 3651193 5367600 31.98
crit 76.34 46.38% 82737.54 75376 82913 82739.43 81226 82913 6316222 9285445 31.98
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Mark of the Hidden Satyr 5736 1.4% 20.4 14.59sec 84390 0 Direct 20.4 57610 115226 84390 46.5% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.43 20.43 0.00 0.00 0.0000 0.0000 1724253.10 1724253.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.94 53.52% 57610.12 52626 57889 57602.31 55257 57889 629978 629978 0.00
crit 9.50 46.48% 115226.48 105252 115777 115205.22 0 115777 1094275 1094275 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Pistol Shot 7008 (18658) 1.7% (4.4%) 22.2 12.04sec 253120 160353 Direct 22.2 57813 115616 95073 64.5% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.19 22.19 0.00 0.00 1.5785 0.0000 2109735.56 3101511.11 31.98 160352.99 160352.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.89 35.54% 57812.59 52630 57893 57779.00 0 57893 455910 670230 31.96
crit 14.30 64.46% 115616.29 105259 115785 115617.34 111838 115785 1653826 2431281 31.98
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&(energy.time_to_max>2-talent.quick_draw.enabled|(buff.blunderbuss.up&buff.greenskins_waterlogged_wristcuffs.up))
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$s1=0} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
    Blunderbuss 11650 2.8% 14.4 18.67sec 243341 0 Direct 57.6 37128 74139 60850 64.1% 0.0%  

Stats details: blunderbuss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.41 57.64 0.00 0.00 0.0000 0.0000 3507109.07 5155782.53 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.69 35.91% 37128.35 19298 42455 37132.97 26534 42455 768355 1129555 31.98
crit 36.94 64.09% 74138.95 38595 84909 74128.56 63682 84909 2738754 4026228 31.98
 
 

Action details: blunderbuss

Static Values
  • id:202895
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202895
  • name:Blunderbuss
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draws a concealed blunderbuss and fires a quick shot at the target, dealing ${$m1*7} damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Potion of the Old War 18503 4.3% 27.8 4.21sec 196822 0 Direct 27.8 134100 268227 196822 46.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.80 27.80 0.00 0.00 0.0000 0.0000 5470896.90 8042736.67 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.80 53.24% 134099.73 122869 135156 134084.75 126965 135156 1984371 2917213 31.98
crit 13.00 46.76% 268226.60 245738 270312 268220.66 253929 270312 3486526 5125524 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Run Through 169725 40.0% 85.0 3.52sec 599581 654219 Direct 85.0 409232 818682 599590 46.5% 0.0%  

Stats details: run_through

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.03 85.03 0.00 0.00 0.9165 0.0000 50984562.12 74952135.70 31.98 654218.58 654218.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.50 53.51% 409232.10 284986 427479 409549.11 378823 427479 18620728 27374234 31.98
crit 39.53 46.49% 818681.85 569973 854959 819657.32 755645 854959 32363834 47577902 31.98
 
 

Action details: run_through

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Run Through
  • school:physical
  • tooltip:Rooted.
  • description:Lunging finishing move that causes damage per combo point and has increased range: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
 
Saber Slash 94653 22.3% 184.6 1.62sec 154114 242115 Direct 184.6 105321 210611 154114 46.3% 0.0%  

Stats details: saber_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 184.58 184.58 0.00 0.00 0.6365 0.0000 28446838.31 41819546.88 31.98 242115.18 242115.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.04 53.66% 105320.79 95885 105474 105319.26 103935 105474 10431396 15335140 31.98
crit 85.54 46.34% 210610.91 191770 210947 210618.41 207267 210947 18015443 26484407 31.98
 
 

Action details: saber_slash

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.ss_useable
Spelldata
  • id:193315
  • name:Saber Slash
  • school:physical
  • tooltip:
  • description:Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.02
 
Simple Action Stats Execute Interval
Rogue_Outlaw_T19M
Adrenaline Rush 6.1 49.89sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.14 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:155.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.adrenaline_rush.up&energy.deficit>0
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:false
  • if_expr:
 
Curse of the Dreadblades 3.9 87.10sec

Stats details: curse_of_the_dreadblades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: curse_of_the_dreadblades

Static Values
  • id:202665
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
Spelldata
  • id:202665
  • name:Curse of the Dreadblades
  • school:shadow
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
 
Darkstrikes (_absorb) 36.5 7.79sec

Stats details: darkstrikes_absorb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 36.51 36.51 0.00 0.00 0.0000 0.0000 0.00 1971000.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.51 100.00% 0.00 0 0 0.00 0 0 0 1971000 100.00
 
 

Action details: darkstrikes_absorb

Static Values
  • id:215659
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:true
  • if_expr:
Spelldata
  • id:215659
  • name:Darkstrikes
  • school:shadow
  • tooltip:Absorbs up to $w2 damage.
  • description:{$@spelldesc215658=Empower yourself with dark energy, causing your attacks to have a chance to inflict {$215659s1=26007 to 28745} additional Shadow damage and grant you a shield for {$215659s2=30418}. Lasts {$d=15 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:50774.29
  • base_dd_max:50774.29
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:false
  • if_expr:
 
Marked for Death 14.2 20.30sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.16 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:raid_event.adds.in>40
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=5} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 12.3 24.72sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.29 0.00 0.00 0.00 0.8721 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.slice_and_dice.enabled
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Shadowmeld 2.3 139.56sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.stealth_condition
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Vanish 5.0 56.68sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:variable.stealth_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 6.1 0.0 49.9sec 49.9sec 30.12% 28.35% 0.0(0.0) 5.9

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:30.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 96.3 0.0sec 3.1sec 100.00% 100.00% 80.1(91.4) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_alacrity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • alacrity_1:0.80%
  • alacrity_2:0.44%
  • alacrity_3:0.46%
  • alacrity_4:0.42%
  • alacrity_5:0.41%
  • alacrity_6:0.43%
  • alacrity_7:0.44%
  • alacrity_8:0.44%
  • alacrity_9:0.43%
  • alacrity_10:0.48%
  • alacrity_11:0.62%
  • alacrity_12:0.80%
  • alacrity_13:0.92%
  • alacrity_14:0.98%
  • alacrity_15:0.98%
  • alacrity_16:1.02%
  • alacrity_17:1.05%
  • alacrity_18:1.05%
  • alacrity_19:1.06%
  • alacrity_20:86.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=1}% for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blood Frenzy 10.7 6.6 28.4sec 17.0sec 45.10% 45.10% 6.6(6.6) 10.2

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 21.25% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blunderbuss 15.6 3.2 18.6sec 15.3sec 17.70% 39.50% 3.2(3.2) 1.1

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_blunderbuss
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:33.00%
  • default_value:-0.00

Stack Uptimes

  • blunderbuss_1:17.70%

Trigger Attempt Success

  • trigger_pct:33.04%

Spelldata details

  • id:202848
  • name:Blunderbuss
  • tooltip:
  • description:{$@spelldesc202897=When Saber Slash strikes an additional time, there is a {$s2=33}% chance that your next Pistol Shot will be replaced with Blunderbuss. |Tinterface\icons\inv_weapon_rifle_07.blp:24|t |cFFFFFFFFBlunderbuss|r {$@spelldesc202895=Draws a concealed blunderbuss and fires a quick shot at the target, dealing ${$m1*7} damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Blurred Time 6.1 0.0 49.9sec 49.9sec 30.12% 29.55% 0.0(0.0) 5.9

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_blurred_time
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • blurred_time_1:30.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202776
  • name:Blurred Time
  • tooltip:Ability cooldowns are recovering {$s1=15}% faster.
  • description:{$@spelldesc202769=During Adrenaline Rush, your ability cooldowns recover {$202776s1=15}% faster.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Broadsides 3.1 0.0 67.3sec 65.6sec 27.99% 25.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_broadsides
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • broadsides_1:27.99%

Trigger Attempt Success

  • trigger_pct:96.51%

Spelldata details

  • id:193356
  • name:Broadsides
  • tooltip:Your attacks generate {$s1=1} additional combo point.
  • description:Your combo-generating abilities generate {$s1=1} additional combo point for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 3.1 0.0 67.2sec 65.5sec 28.66% 27.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • buried_treasure_1:28.66%

Trigger Attempt Success

  • trigger_pct:96.81%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by {$s1=25}%.
  • description:Your base Energy regeneration is increased by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Curse of the Dreadblades 3.9 0.0 87.1sec 87.1sec 15.19% 14.98% 0.0(0.0) 3.7

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_curse_of_the_dreadblades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • curse_of_the_dreadblades_1:15.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202665
  • name:Curse of the Dreadblades
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:101.00%
Darkstrikes 4.5 0.0 76.2sec 76.2sec 21.95% 21.95% 0.0(0.0) 4.3

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_darkstrikes
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • darkstrikes_1:21.95%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:215658
  • name:Darkstrikes
  • tooltip:Your attacks have a chance to deal {$215659s1=26007 to 28745} additional Shadow damage and grant you an absorption shield for {$215659s2=30418}.
  • description:Empower yourself with dark energy, causing your attacks to have a chance to inflict {$215659s1=26007 to 28745} additional Shadow damage and grant you a shield for {$215659s2=30418}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:75.00
  • default_chance:101.00%
Darkstrikes (_absorb) 4.5 32.1 76.1sec 7.8sec 33.29% 33.29% 32.1(32.1) 4.1

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_darkstrikes_absorb
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:30418.02

Stack Uptimes

  • darkstrikes_absorb_1:33.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215659
  • name:Darkstrikes
  • tooltip:Absorbs up to $w2 damage.
  • description:{$@spelldesc215658=Empower yourself with dark energy, causing your attacks to have a chance to inflict {$215659s1=26007 to 28745} additional Shadow damage and grant you a shield for {$215659s2=30418}. Lasts {$d=15 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Grand Melee 3.1 0.0 67.5sec 65.6sec 28.63% 27.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.67

Stack Uptimes

  • grand_melee_1:28.63%

Trigger Attempt Success

  • trigger_pct:96.65%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=50}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=50}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hidden Blade 6.0 0.0 50.5sec 56.6sec 4.24% 5.13% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_hidden_blade
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hidden_blade_1:4.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202754
  • name:Hidden Blade
  • tooltip:Your next Saber Slash has 100% chance to strike a second time.
  • description:{$@spelldesc202753=Successfully using Ambush guarantees your next Saber Slash will strike an additional time.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Jolly Roger 3.1 0.0 67.4sec 65.8sec 28.19% 27.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_jolly_roger
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • jolly_roger_1:28.19%

Trigger Attempt Success

  • trigger_pct:96.47%

Spelldata details

  • id:199603
  • name:Jolly Roger
  • tooltip:Saber Slash has an additional {$s1=25}% chance of striking an additional time.
  • description:Causes Saber Slash to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Opportunity 37.3 16.1 8.0sec 5.5sec 40.38% 40.38% 16.1(16.1) 0.4

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • opportunity_1:40.38%

Trigger Attempt Success

  • trigger_pct:41.98%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot is free.
  • description:{$@spelldesc193315=Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 86.7sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Roll the Bones 2.4 9.9 113.7sec 24.8sec 99.51% 99.51% 9.9(9.9) 1.4

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roll_the_bones_1:99.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 2.3 0.0 139.3sec 139.3sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Shark Infested Waters 3.1 0.0 68.7sec 66.7sec 30.51% 45.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_shark_infested_waters
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shark_infested_waters_1:30.51%

Trigger Attempt Success

  • trigger_pct:96.77%

Spelldata details

  • id:193357
  • name:Shark Infested Waters
  • tooltip:Critical Strike chance increased by {$s1=25}%.
  • description:Increases Critical Strike chance by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
True Bearing 3.1 0.0 76.2sec 75.6sec 43.14% 45.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • true_bearing_1:43.14%

Trigger Attempt Success

  • trigger_pct:98.16%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishers reduce the remaining cooldown on many of your abilities by {$s1=2} sec per combo point.
  • description:For the duration of Roll the Bones, each time you use a finishing move, you reduce the remaining cooldown on Adrenaline Rush, Sprint, Between the Eyes, Vanish, Blind, Cloak of Shadows, Riposte, Grappling Hook, Cannonball Barrage, Killing Spree, Marked for Death, and Death from Above by {$s1=2} sec per combo point spent.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 5.0 0.0 56.6sec 56.6sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Outlaw_T19M
ambush Energy 6.0 359.5 60.0 60.0 3210.6
ghostly_strike Energy 20.8 622.5 30.0 30.0 2824.2
roll_the_bones Energy 12.3 146.8 11.9 11.9 0.0
roll_the_bones Combo Points 12.3 67.6 5.5 5.5 0.0
run_through Energy 85.0 1955.7 23.0 23.0 26069.5
run_through Combo Points 85.0 489.5 5.8 5.8 104162.9
saber_slash Energy 184.6 6373.0 34.5 34.5 4463.6
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 14.16 68.49 (12.23%) 4.84 2.32 3.27%
ghostly_strike Combo Points 20.75 20.75 (3.70%) 1.00 0.00 0.00%
pistol_shot Combo Points 22.19 22.19 (3.96%) 1.00 0.00 0.00%
blunderbuss Combo Points 14.41 14.41 (2.57%) 1.00 0.00 0.00%
saber_slash Combo Points 184.58 170.97 (30.52%) 0.93 13.61 7.37%
adrenaline_rush Energy 297.21 1512.34 (16.10%) 5.09 149.18 8.98%
ambush Combo Points 5.99 11.98 (2.14%) 2.00 0.00 0.00%
energy_regen Energy 1055.85 5399.99 (57.49%) 5.11 88.97 1.62%
combat_potency Energy 139.35 2481.18 (26.41%) 17.81 27.15 1.08%
Broadsides Combo Points 60.93 54.14 (9.67%) 0.89 6.79 11.14%
Ruthlessness Combo Points 97.30 111.39 (19.89%) 1.14 0.00 0.00%
Curse of the Dreadblades Combo Points 24.36 85.82 (15.32%) 3.52 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 31.23 31.45
Combo Points 1.86 1.85
Combat End Resource Mean Min Max
Energy 36.13 0.01 100.00
Combo Points 3.10 1.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
Roll the Bones: 1 buff 7.3 35.7sec
Roll the Bones: 2 buffs 4.4 62.3sec
Roll the Bones: 3 buffs 0.5 110.1sec
Roll the Bones: 6 buffs 0.2 125.8sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Outlaw_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Rogue_Outlaw_T19M Damage Per Second
Count 7499
Mean 424238.55
Minimum 325982.49
Maximum 580245.13
Spread ( max - min ) 254262.65
Range [ ( max - min ) / 2 * 100% ] 29.97%
Standard Deviation 28838.1085
5th Percentile 383927.17
95th Percentile 477346.78
( 95th Percentile - 5th Percentile ) 93419.61
Mean Distribution
Standard Deviation 333.0160
95.00% Confidence Intervall ( 423585.86 - 424891.25 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 177
0.1% Error 17750
0.1 Scale Factor Error with Delta=300 7099327
0.05 Scale Factor Error with Delta=300 28397310
0.01 Scale Factor Error with Delta=300 709932750
Priority Target DPS
Sample Data Rogue_Outlaw_T19M Priority Target Damage Per Second
Count 7499
Mean 424238.55
Minimum 325982.49
Maximum 580245.13
Spread ( max - min ) 254262.65
Range [ ( max - min ) / 2 * 100% ] 29.97%
Standard Deviation 28838.1085
5th Percentile 383927.17
95th Percentile 477346.78
( 95th Percentile - 5th Percentile ) 93419.61
Mean Distribution
Standard Deviation 333.0160
95.00% Confidence Intervall ( 423585.86 - 424891.25 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 177
0.1% Error 17750
0.1 Scale Factor Error with Delta=300 7099327
0.05 Scale Factor Error with Delta=300 28397310
0.01 Scale Factor Error with Delta=300 709932750
DPS(e)
Sample Data Rogue_Outlaw_T19M Damage Per Second (Effective)
Count 7499
Mean 424238.55
Minimum 325982.49
Maximum 580245.13
Spread ( max - min ) 254262.65
Range [ ( max - min ) / 2 * 100% ] 29.97%
Damage
Sample Data Rogue_Outlaw_T19M Damage
Count 7499
Mean 127379914.84
Minimum 86700411.41
Maximum 190887830.66
Spread ( max - min ) 104187419.25
Range [ ( max - min ) / 2 * 100% ] 40.90%
DTPS
Sample Data Rogue_Outlaw_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Outlaw_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Outlaw_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Outlaw_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Outlaw_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Outlaw_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Outlaw_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Outlaw_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 roll_the_bones,if=!talent.slice_and_dice.enabled
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
0.00 variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
0.00 variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
8 0.00 call_action_list,name=bf
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
0.00 death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
0.00 slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
B 11.29 roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
0.00 killing_spree,if=energy.time_to_max>5|energy<15
C 0.00 call_action_list,name=build
D 0.00 call_action_list,name=finish,if=!variable.ss_useable
0.00 gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1
actions.build
# count action,conditions
E 20.75 ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
F 36.60 pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&(energy.time_to_max>2-talent.quick_draw.enabled|(buff.blunderbuss.up&buff.greenskins_waterlogged_wristcuffs.up))
G 127.46 saber_slash,if=variable.ss_useable
actions.cds
# count action,conditions
H 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
I 4.47 use_item,slot=trinket2,if=buff.bloodlust.react|target.time_to_die<=20|combo_points.deficit<=2
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=energy.deficit>40
0.00 cannonball_barrage,if=spell_targets.cannonball_barrage>=1
J 6.14 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
K 13.16 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
0.00 sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
L 3.89 curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
actions.finish
# count action,conditions
0.00 between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&!buff.greenskins_waterlogged_wristcuffs.up
M 85.03 run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5
actions.stealth
# count action,conditions
0.00 variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
N 5.99 ambush
O 4.99 vanish,if=variable.stealth_condition
P 2.33 shadowmeld,if=variable.stealth_condition

Sample Sequence

0124567NIJEMLGMGMGMGMGMGMGMGMONEMGMPGGMFGMGEMGGMGBGGMFGMFEMGGMFGMGGMKMGEMGGMGGMGBFGEIGMFGFMGFMKMGGEFMJHLGMGMKMFMGMGMKMGMGMGEGBFGGGBJKMONFGMGGEFGMGGGMKMGGGMGFEGMGGFGMKMFGEJGMFONIGMFPGGGMKMFGGMFGEGGBGFGBEGBLGMKMGMJFMGMKMGMFONMGMKMGEMGMFGMFGMJKMGMFONMGMGMKMGMGEMGBGGGBGFGIBKMGMJONEMFGMGMKMGFMGMGMGEMKMFONMGMJGEMLGMKMFMGMGMKMFMGMGMJKBONEMGMPGGMKMGGMGGMGGMKMGEMGMJFGMGONIMKM

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Outlaw_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Outlaw_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Outlaw_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
Pre marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points stealth, potion_of_the_old_war
Pre roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:00.000 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:01.004 use_item_tirathons_betrayal Fluffy_Pillow 57.5/100: 58% energy | 4.0/6: 67% combo_points bloodlust, alacrity, roll_the_bones, hidden_blade, potion_of_the_old_war
0:01.004 adrenaline_rush Fluffy_Pillow 57.5/100: 58% energy | 4.0/6: 67% combo_points bloodlust, alacrity, roll_the_bones, hidden_blade, potion_of_the_old_war
0:01.004 ghostly_strike Fluffy_Pillow 57.5/100: 58% energy | 4.0/6: 67% combo_points bloodlust, adrenaline_rush, alacrity, roll_the_bones, hidden_blade, blurred_time, potion_of_the_old_war
0:01.810 run_through Fluffy_Pillow 73.7/100: 74% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity, roll_the_bones, hidden_blade, blurred_time, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:02.616 curse_of_the_dreadblades Fluffy_Pillow 79.1/100: 79% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, alacrity(2), roll_the_bones, hidden_blade, blurred_time, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:02.616 saber_slash Fluffy_Pillow 79.1/100: 79% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, alacrity(2), roll_the_bones, hidden_blade, curse_of_the_dreadblades, blurred_time, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:03.422 run_through Fluffy_Pillow 75.6/100: 76% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(2), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:04.225 saber_slash Fluffy_Pillow 99.2/100: 99% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(3), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:05.030 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(3), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:05.835 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(4), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:06.639 run_through Fluffy_Pillow 78.9/100: 79% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(4), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:07.443 saber_slash Fluffy_Pillow 85.4/100: 85% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(6), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:08.247 run_through Fluffy_Pillow 82.9/100: 83% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(6), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:09.052 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:09.856 run_through Fluffy_Pillow 79.8/100: 80% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:10.662 saber_slash Fluffy_Pillow 86.9/100: 87% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:11.468 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:12.272 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:13.074 run_through Fluffy_Pillow 80.2/100: 80% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:13.878 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:14.681 run_through Fluffy_Pillow 98.5/100: 99% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), roll_the_bones, blurred_time, blunderbuss, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:15.484 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(11), roll_the_bones, blurred_time, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:15.484 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, vanish, alacrity(11), roll_the_bones, blurred_time, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
0:16.488 ghostly_strike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, opportunity, alacrity(11), roll_the_bones, hidden_blade, potion_of_the_old_war, darkstrikes_absorb
0:17.491 run_through Fluffy_Pillow 89.3/100: 89% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(11), roll_the_bones, hidden_blade, potion_of_the_old_war, darkstrikes_absorb
0:18.496 saber_slash Fluffy_Pillow 85.7/100: 86% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(12), roll_the_bones, hidden_blade, potion_of_the_old_war, darkstrikes_absorb
0:19.502 run_through Fluffy_Pillow 73.2/100: 73% energy | 5.0/6: 83% combo_points bloodlust, opportunity, alacrity(12), roll_the_bones, blunderbuss, potion_of_the_old_war, darkstrikes_absorb
0:20.506 shadowmeld Fluffy_Pillow 69.8/100: 70% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(13), roll_the_bones, blunderbuss, potion_of_the_old_war, darkstrikes_absorb
0:20.506 saber_slash Fluffy_Pillow 69.8/100: 70% energy | 1.0/6: 17% combo_points bloodlust, shadowmeld, opportunity, alacrity(13), roll_the_bones, blunderbuss, potion_of_the_old_war, darkstrikes_absorb
0:21.511 saber_slash Fluffy_Pillow 57.5/100: 57% energy | 3.0/6: 50% combo_points bloodlust, alacrity(13), roll_the_bones, blunderbuss, potion_of_the_old_war, darkstrikes_absorb
0:22.515 run_through Fluffy_Pillow 27.9/100: 28% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(13), roll_the_bones, blunderbuss, blood_frenzy, potion_of_the_old_war
0:23.521 pistol_shot Fluffy_Pillow 26.4/100: 26% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(14), roll_the_bones, blunderbuss, blood_frenzy
0:24.527 saber_slash Fluffy_Pillow 66.0/100: 66% energy | 3.0/6: 50% combo_points bloodlust, alacrity(14), roll_the_bones, blood_frenzy
0:25.532 run_through Fluffy_Pillow 55.5/100: 55% energy | 5.0/6: 83% combo_points bloodlust, alacrity(14), roll_the_bones, blood_frenzy
0:26.537 saber_slash Fluffy_Pillow 72.1/100: 72% energy | 1.0/6: 17% combo_points bloodlust, alacrity(15), roll_the_bones, blood_frenzy
0:27.543 ghostly_strike Fluffy_Pillow 61.9/100: 62% energy | 3.0/6: 50% combo_points bloodlust, alacrity(15), roll_the_bones, blood_frenzy
0:28.548 run_through Fluffy_Pillow 53.5/100: 54% energy | 5.0/6: 83% combo_points bloodlust, alacrity(15), roll_the_bones, blood_frenzy
0:29.551 saber_slash Fluffy_Pillow 52.4/100: 52% energy | 1.0/6: 17% combo_points bloodlust, alacrity(16), roll_the_bones, blood_frenzy
0:30.555 Waiting 0.400 sec 42.2/100: 42% energy | 3.0/6: 50% combo_points bloodlust, alacrity(16), roll_the_bones, blood_frenzy
0:30.955 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 3.0/6: 50% combo_points bloodlust, alacrity(16), roll_the_bones, blood_frenzy
0:31.958 run_through Fluffy_Pillow 40.8/100: 41% energy | 5.0/6: 83% combo_points bloodlust, alacrity(16), roll_the_bones, blood_frenzy
0:32.963 saber_slash Fluffy_Pillow 56.2/100: 56% energy | 1.0/6: 17% combo_points bloodlust, alacrity(17), roll_the_bones
0:33.967 roll_the_bones Fluffy_Pillow 80.5/100: 81% energy | 5.0/6: 83% combo_points bloodlust, opportunity, alacrity(17), roll_the_bones
0:34.971 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(18), grand_melee, broadsides, roll_the_bones
0:35.975 saber_slash Fluffy_Pillow 88.5/100: 88% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(18), grand_melee, broadsides, roll_the_bones
0:36.979 run_through Fluffy_Pillow 59.0/100: 59% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(18), grand_melee, broadsides, roll_the_bones
0:37.984 pistol_shot Fluffy_Pillow 56.7/100: 57% energy | 2.0/6: 33% combo_points bloodlust, opportunity, alacrity(19), grand_melee, broadsides, roll_the_bones
0:38.989 saber_slash Fluffy_Pillow 77.3/100: 77% energy | 4.0/6: 67% combo_points bloodlust, alacrity(19), grand_melee, broadsides, roll_the_bones
0:39.994 run_through Fluffy_Pillow 48.0/100: 48% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(19), grand_melee, broadsides, roll_the_bones
0:41.000 pistol_shot Fluffy_Pillow 41.1/100: 41% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:42.004 ghostly_strike Fluffy_Pillow 57.1/100: 57% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:43.009 run_through Fluffy_Pillow 43.1/100: 43% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:44.014 saber_slash Fluffy_Pillow 54.2/100: 54% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:45.020 Waiting 0.800 sec 38.2/100: 38% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:45.820 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:46.825 run_through Fluffy_Pillow 35.0/100: 35% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:47.831 pistol_shot Fluffy_Pillow 46.1/100: 46% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
0:48.837 saber_slash Fluffy_Pillow 62.2/100: 62% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:49.843 run_through Fluffy_Pillow 46.2/100: 46% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:50.847 Waiting 0.700 sec 39.2/100: 39% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:51.547 saber_slash Fluffy_Pillow 68.4/100: 68% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:52.552 Waiting 1.000 sec 34.5/100: 34% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:53.552 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:54.556 Waiting 0.535 sec 16.4/100: 16% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:55.091 run_through Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:56.097 Waiting 1.035 sec 18.0/100: 18% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
0:57.132 marked_for_death Fluffy_Pillow 35.1/100: 35% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
0:57.352 run_through Fluffy_Pillow 56.9/100: 57% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
0:58.355 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
0:59.361 ghostly_strike Fluffy_Pillow 36.7/100: 37% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
1:00.365 run_through Fluffy_Pillow 24.1/100: 24% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
1:01.369 Waiting 1.375 sec 18.5/100: 19% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
1:02.744 saber_slash Fluffy_Pillow 60.3/100: 60% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
1:03.748 Waiting 0.300 sec 27.7/100: 28% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
1:04.048 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
1:05.051 Waiting 0.387 sec 18.3/100: 18% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
1:05.438 run_through Fluffy_Pillow 43.0/100: 43% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
1:06.443 saber_slash Fluffy_Pillow 73.4/100: 73% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
1:07.447 Waiting 0.200 sec 39.8/100: 40% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
1:07.647 saber_slash Fluffy_Pillow 61.0/100: 61% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
1:08.652 run_through Fluffy_Pillow 27.1/100: 27% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
1:09.656 Waiting 0.800 sec 38.1/100: 38% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
1:10.456 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
1:11.462 roll_the_bones Fluffy_Pillow 16.9/100: 17% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
1:12.467 pistol_shot Fluffy_Pillow 37.9/100: 38% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:13.471 saber_slash Fluffy_Pillow 54.0/100: 54% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:14.476 ghostly_strike Fluffy_Pillow 38.0/100: 38% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:15.479 Waiting 0.300 sec 24.0/100: 24% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:15.779 use_item_tirathons_betrayal Fluffy_Pillow 28.8/100: 29% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:16.004 Waiting 0.500 sec 32.4/100: 32% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:16.504 saber_slash Fluffy_Pillow 58.4/100: 58% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:17.509 run_through Fluffy_Pillow 42.4/100: 42% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:18.514 pistol_shot Fluffy_Pillow 35.5/100: 35% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:19.518 saber_slash Fluffy_Pillow 69.5/100: 69% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:20.523 pistol_shot Fluffy_Pillow 35.5/100: 36% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:21.528 run_through Fluffy_Pillow 69.6/100: 70% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:22.532 saber_slash Fluffy_Pillow 62.6/100: 63% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:23.536 pistol_shot Fluffy_Pillow 46.6/100: 47% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blunderbuss, darkstrikes, darkstrikes_absorb
1:24.541 run_through Fluffy_Pillow 62.7/100: 63% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:25.546 marked_for_death Fluffy_Pillow 73.7/100: 74% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:25.546 run_through Fluffy_Pillow 73.7/100: 74% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:26.550 saber_slash Fluffy_Pillow 66.7/100: 67% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:27.553 Waiting 1.100 sec 32.7/100: 33% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:28.653 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:29.656 ghostly_strike Fluffy_Pillow 34.3/100: 34% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:30.662 pistol_shot Fluffy_Pillow 20.4/100: 20% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
1:31.666 run_through Fluffy_Pillow 54.4/100: 54% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes_absorb
1:32.670 adrenaline_rush Fluffy_Pillow 47.4/100: 47% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, darkstrikes_absorb
1:32.670 potion Fluffy_Pillow 47.4/100: 47% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blurred_time, darkstrikes_absorb
1:32.670 curse_of_the_dreadblades Fluffy_Pillow 47.4/100: 47% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:32.670 Waiting 0.100 sec 47.4/100: 47% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:32.770 saber_slash Fluffy_Pillow 50.6/100: 51% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:33.576 run_through Fluffy_Pillow 44.3/100: 44% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:34.382 Waiting 0.100 sec 47.1/100: 47% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:34.482 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:35.285 run_through Fluffy_Pillow 61.9/100: 62% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:36.090 marked_for_death Fluffy_Pillow 64.6/100: 65% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:36.090 run_through Fluffy_Pillow 64.6/100: 65% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:36.895 pistol_shot Fluffy_Pillow 67.3/100: 67% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:37.700 run_through Fluffy_Pillow 93.0/100: 93% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:38.506 saber_slash Fluffy_Pillow 95.7/100: 96% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:39.311 run_through Fluffy_Pillow 89.4/100: 89% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war, darkstrikes_absorb
1:40.115 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war
1:40.920 run_through Fluffy_Pillow 75.7/100: 76% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war
1:41.725 marked_for_death Fluffy_Pillow 96.4/100: 96% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war
1:41.725 run_through Fluffy_Pillow 96.4/100: 96% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war
1:42.529 saber_slash Fluffy_Pillow 99.1/100: 99% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war
1:43.334 run_through Fluffy_Pillow 92.8/100: 93% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war
1:44.139 saber_slash Fluffy_Pillow 95.5/100: 95% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war
1:44.943 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:45.746 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:46.551 ghostly_strike Fluffy_Pillow 75.7/100: 76% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:47.356 saber_slash Fluffy_Pillow 72.9/100: 73% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blurred_time, blunderbuss, blood_frenzy, potion_of_the_old_war
1:48.160 roll_the_bones Fluffy_Pillow 60.3/100: 60% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), blunderbuss, blood_frenzy, potion_of_the_old_war
1:49.165 pistol_shot Fluffy_Pillow 64.7/100: 65% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, roll_the_bones, blunderbuss, blood_frenzy, potion_of_the_old_war
1:50.169 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:51.174 saber_slash Fluffy_Pillow 67.4/100: 67% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:52.177 saber_slash Fluffy_Pillow 52.8/100: 53% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:53.181 roll_the_bones Fluffy_Pillow 56.2/100: 56% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:54.188 adrenaline_rush Fluffy_Pillow 60.6/100: 61% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:54.188 marked_for_death Fluffy_Pillow 60.6/100: 61% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy, potion_of_the_old_war
1:54.188 run_through Fluffy_Pillow 60.6/100: 61% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy, potion_of_the_old_war
1:54.992 vanish Fluffy_Pillow 65.5/100: 65% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy, potion_of_the_old_war
1:54.992 ambush Fluffy_Pillow 65.5/100: 65% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, vanish, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy, potion_of_the_old_war
1:55.997 pistol_shot Fluffy_Pillow 58.3/100: 58% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blurred_time, blood_frenzy, potion_of_the_old_war
1:56.802 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blurred_time, potion_of_the_old_war
1:57.605 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, potion_of_the_old_war
1:58.410 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time
1:59.214 saber_slash Fluffy_Pillow 75.7/100: 76% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:00.020 ghostly_strike Fluffy_Pillow 51.4/100: 51% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:00.824 pistol_shot Fluffy_Pillow 65.1/100: 65% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:01.629 saber_slash Fluffy_Pillow 90.8/100: 91% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:02.433 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:03.237 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:04.041 saber_slash Fluffy_Pillow 75.7/100: 76% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:04.845 saber_slash Fluffy_Pillow 69.3/100: 69% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:05.650 run_through Fluffy_Pillow 63.0/100: 63% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:06.456 marked_for_death Fluffy_Pillow 66.4/100: 66% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy
2:06.456 run_through Fluffy_Pillow 66.4/100: 66% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy
2:07.261 saber_slash Fluffy_Pillow 89.3/100: 89% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy
2:08.066 saber_slash Fluffy_Pillow 85.1/100: 85% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy
2:08.869 saber_slash Fluffy_Pillow 81.0/100: 81% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy
2:09.673 run_through Fluffy_Pillow 68.4/100: 68% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
2:10.677 saber_slash Fluffy_Pillow 80.8/100: 81% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
2:11.681 pistol_shot Fluffy_Pillow 48.2/100: 48% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
2:12.686 ghostly_strike Fluffy_Pillow 65.6/100: 66% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
2:13.691 saber_slash Fluffy_Pillow 53.0/100: 53% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
2:14.696 run_through Fluffy_Pillow 38.4/100: 38% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
2:15.701 Waiting 1.100 sec 32.8/100: 33% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
2:16.801 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
2:17.805 Waiting 2.092 sec 17.1/100: 17% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
2:19.897 saber_slash Fluffy_Pillow 50.5/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
2:20.901 pistol_shot Fluffy_Pillow 34.6/100: 35% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
2:21.905 saber_slash Fluffy_Pillow 50.6/100: 51% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
2:22.910 run_through Fluffy_Pillow 34.6/100: 35% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blunderbuss
2:23.915 marked_for_death Fluffy_Pillow 27.7/100: 28% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blunderbuss
2:23.915 run_through Fluffy_Pillow 27.7/100: 28% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blunderbuss
2:24.920 pistol_shot Fluffy_Pillow 20.7/100: 21% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blunderbuss
2:25.924 saber_slash Fluffy_Pillow 54.7/100: 55% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
2:26.927 Waiting 0.366 sec 20.7/100: 21% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
2:27.293 ghostly_strike Fluffy_Pillow 44.6/100: 45% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
2:28.297 adrenaline_rush Fluffy_Pillow 30.6/100: 31% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
2:28.297 Waiting 0.700 sec 30.6/100: 31% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:28.997 saber_slash Fluffy_Pillow 53.0/100: 53% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time
2:29.800 run_through Fluffy_Pillow 29.4/100: 29% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy
2:30.604 pistol_shot Fluffy_Pillow 34.3/100: 34% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy
2:31.411 vanish Fluffy_Pillow 62.2/100: 62% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy
2:31.411 ambush Fluffy_Pillow 62.2/100: 62% energy | 3.0/6: 50% combo_points adrenaline_rush, vanish, alacrity(20), true_bearing, roll_the_bones, blurred_time, blood_frenzy
2:32.415 use_item_tirathons_betrayal Fluffy_Pillow 55.0/100: 55% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blurred_time, blood_frenzy
2:32.415 saber_slash Fluffy_Pillow 55.0/100: 55% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blurred_time, blood_frenzy
2:33.220 run_through Fluffy_Pillow 50.9/100: 51% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:34.024 pistol_shot Fluffy_Pillow 55.8/100: 56% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:34.829 shadowmeld Fluffy_Pillow 83.6/100: 84% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:34.829 saber_slash Fluffy_Pillow 83.6/100: 84% energy | 3.0/6: 50% combo_points shadowmeld, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:35.633 saber_slash Fluffy_Pillow 79.5/100: 80% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:36.438 saber_slash Fluffy_Pillow 57.4/100: 57% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:37.241 run_through Fluffy_Pillow 53.2/100: 53% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:38.046 marked_for_death Fluffy_Pillow 58.1/100: 58% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:38.046 run_through Fluffy_Pillow 58.1/100: 58% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:38.850 pistol_shot Fluffy_Pillow 63.0/100: 63% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:39.656 saber_slash Fluffy_Pillow 90.4/100: 90% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:40.462 saber_slash Fluffy_Pillow 84.2/100: 84% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:41.265 run_through Fluffy_Pillow 59.8/100: 60% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:42.070 pistol_shot Fluffy_Pillow 62.5/100: 63% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:42.875 saber_slash Fluffy_Pillow 88.2/100: 88% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:43.681 ghostly_strike Fluffy_Pillow 57.8/100: 58% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
2:44.685 Waiting 0.400 sec 43.8/100: 44% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
2:45.085 saber_slash Fluffy_Pillow 50.2/100: 50% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
2:46.089 Waiting 1.048 sec 16.2/100: 16% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
2:47.137 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, darkstrikes, darkstrikes_absorb
2:48.140 roll_the_bones Fluffy_Pillow 17.0/100: 17% energy | 6.0/6: 100% combo_points alacrity(20), darkstrikes_absorb
2:49.145 Waiting 0.400 sec 24.0/100: 24% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones, darkstrikes_absorb
2:49.545 saber_slash Fluffy_Pillow 50.0/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones, darkstrikes_absorb
2:50.550 pistol_shot Fluffy_Pillow 38.1/100: 38% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones, darkstrikes_absorb
2:51.553 saber_slash Fluffy_Pillow 76.1/100: 76% energy | 4.0/6: 67% combo_points alacrity(20), buried_treasure, roll_the_bones, darkstrikes_absorb
2:52.556 roll_the_bones Fluffy_Pillow 46.1/100: 46% energy | 5.0/6: 83% combo_points alacrity(20), buried_treasure, roll_the_bones, darkstrikes_absorb
2:53.561 ghostly_strike Fluffy_Pillow 67.1/100: 67% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, roll_the_bones, darkstrikes_absorb
2:54.566 saber_slash Fluffy_Pillow 53.2/100: 53% energy | 3.0/6: 50% combo_points alacrity(20), broadsides, roll_the_bones, darkstrikes_absorb
2:55.571 roll_the_bones Fluffy_Pillow 19.2/100: 19% energy | 5.0/6: 83% combo_points alacrity(20), broadsides, roll_the_bones
2:56.577 curse_of_the_dreadblades Fluffy_Pillow 22.3/100: 22% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
2:56.577 Waiting 1.770 sec 22.3/100: 22% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
2:58.347 saber_slash Fluffy_Pillow 50.5/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
2:59.351 run_through Fluffy_Pillow 34.5/100: 35% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
3:00.357 marked_for_death Fluffy_Pillow 27.6/100: 28% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
3:00.357 run_through Fluffy_Pillow 27.6/100: 28% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
3:01.363 Waiting 1.871 sec 20.7/100: 21% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
3:03.234 saber_slash Fluffy_Pillow 50.5/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
3:04.237 Waiting 0.530 sec 16.5/100: 17% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
3:04.767 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
3:05.773 adrenaline_rush Fluffy_Pillow 18.1/100: 18% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
3:05.773 pistol_shot Fluffy_Pillow 18.1/100: 18% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
3:06.576 run_through Fluffy_Pillow 43.7/100: 44% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
3:07.383 Waiting 0.200 sec 46.5/100: 46% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
3:07.583 saber_slash Fluffy_Pillow 52.8/100: 53% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
3:08.388 run_through Fluffy_Pillow 28.8/100: 29% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy
3:09.191 marked_for_death Fluffy_Pillow 33.6/100: 34% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:09.191 run_through Fluffy_Pillow 33.6/100: 34% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:09.994 Waiting 0.400 sec 38.4/100: 38% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:10.394 saber_slash Fluffy_Pillow 52.3/100: 52% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:11.196 run_through Fluffy_Pillow 30.1/100: 30% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:12.001 pistol_shot Fluffy_Pillow 35.0/100: 35% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:12.806 vanish Fluffy_Pillow 80.9/100: 81% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:12.806 ambush Fluffy_Pillow 80.9/100: 81% energy | 3.0/6: 50% combo_points adrenaline_rush, vanish, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:13.811 run_through Fluffy_Pillow 55.7/100: 56% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, blood_frenzy
3:14.615 saber_slash Fluffy_Pillow 78.5/100: 79% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, blood_frenzy
3:15.422 run_through Fluffy_Pillow 56.5/100: 56% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:16.227 marked_for_death Fluffy_Pillow 61.4/100: 61% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:16.227 run_through Fluffy_Pillow 61.4/100: 61% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:17.032 saber_slash Fluffy_Pillow 84.3/100: 84% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:17.836 ghostly_strike Fluffy_Pillow 62.1/100: 62% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blood_frenzy
3:18.640 run_through Fluffy_Pillow 77.0/100: 77% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:19.446 saber_slash Fluffy_Pillow 79.8/100: 80% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:20.250 run_through Fluffy_Pillow 55.4/100: 55% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:21.054 pistol_shot Fluffy_Pillow 53.6/100: 54% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones
3:22.058 saber_slash Fluffy_Pillow 87.6/100: 88% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
3:23.059 run_through Fluffy_Pillow 53.6/100: 54% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones
3:24.064 pistol_shot Fluffy_Pillow 64.6/100: 65% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones
3:25.070 saber_slash Fluffy_Pillow 98.7/100: 99% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
3:26.073 run_through Fluffy_Pillow 64.7/100: 65% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blunderbuss
3:27.079 adrenaline_rush Fluffy_Pillow 57.8/100: 58% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blunderbuss
3:27.079 marked_for_death Fluffy_Pillow 57.8/100: 58% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:27.079 run_through Fluffy_Pillow 57.8/100: 58% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:27.884 saber_slash Fluffy_Pillow 78.5/100: 78% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:28.689 run_through Fluffy_Pillow 54.2/100: 54% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:29.493 pistol_shot Fluffy_Pillow 56.8/100: 57% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:30.298 vanish Fluffy_Pillow 82.5/100: 83% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:30.298 ambush Fluffy_Pillow 82.5/100: 83% energy | 3.0/6: 50% combo_points adrenaline_rush, vanish, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:31.301 run_through Fluffy_Pillow 72.6/100: 73% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time
3:32.105 saber_slash Fluffy_Pillow 75.2/100: 75% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time
3:32.908 run_through Fluffy_Pillow 50.9/100: 51% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:33.712 saber_slash Fluffy_Pillow 71.5/100: 72% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:34.516 run_through Fluffy_Pillow 65.2/100: 65% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:35.318 marked_for_death Fluffy_Pillow 67.8/100: 68% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:35.318 run_through Fluffy_Pillow 67.8/100: 68% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:36.122 saber_slash Fluffy_Pillow 88.5/100: 88% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
3:36.925 run_through Fluffy_Pillow 82.1/100: 82% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:37.729 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:38.531 ghostly_strike Fluffy_Pillow 75.6/100: 76% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:39.335 run_through Fluffy_Pillow 71.3/100: 71% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:40.141 saber_slash Fluffy_Pillow 92.0/100: 92% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:40.946 roll_the_bones Fluffy_Pillow 67.7/100: 68% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
3:41.750 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
3:42.555 saber_slash Fluffy_Pillow 92.6/100: 93% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:43.558 saber_slash Fluffy_Pillow 82.3/100: 82% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:44.561 roll_the_bones Fluffy_Pillow 72.0/100: 72% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:45.566 saber_slash Fluffy_Pillow 76.4/100: 76% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, roll_the_bones, blunderbuss, blood_frenzy
3:46.569 pistol_shot Fluffy_Pillow 61.8/100: 62% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), grand_melee, roll_the_bones, blunderbuss, blood_frenzy
3:47.575 saber_slash Fluffy_Pillow 97.2/100: 97% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, roll_the_bones, blood_frenzy
3:48.578 use_item_tirathons_betrayal Fluffy_Pillow 82.6/100: 83% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, roll_the_bones, blood_frenzy
3:48.578 roll_the_bones Fluffy_Pillow 82.6/100: 83% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, roll_the_bones, blood_frenzy
3:49.581 marked_for_death Fluffy_Pillow 86.9/100: 87% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes, blood_frenzy
3:49.581 run_through Fluffy_Pillow 86.9/100: 87% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes, blood_frenzy
3:50.585 saber_slash Fluffy_Pillow 99.3/100: 99% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:51.591 run_through Fluffy_Pillow 84.8/100: 85% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:52.595 adrenaline_rush Fluffy_Pillow 77.9/100: 78% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes, darkstrikes_absorb
3:52.595 vanish Fluffy_Pillow 77.9/100: 78% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
3:52.595 ambush Fluffy_Pillow 77.9/100: 78% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, vanish, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
3:53.600 ghostly_strike Fluffy_Pillow 50.0/100: 50% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, darkstrikes, darkstrikes_absorb
3:54.405 run_through Fluffy_Pillow 45.7/100: 46% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, darkstrikes, darkstrikes_absorb
3:55.209 pistol_shot Fluffy_Pillow 66.4/100: 66% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, darkstrikes, darkstrikes_absorb
3:56.012 saber_slash Fluffy_Pillow 92.0/100: 92% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, darkstrikes, darkstrikes_absorb
3:56.816 run_through Fluffy_Pillow 85.7/100: 86% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, darkstrikes, darkstrikes_absorb
3:57.621 saber_slash Fluffy_Pillow 88.4/100: 88% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, darkstrikes, darkstrikes_absorb
3:58.425 run_through Fluffy_Pillow 64.0/100: 64% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, darkstrikes, darkstrikes_absorb
3:59.230 marked_for_death Fluffy_Pillow 66.7/100: 67% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, darkstrikes, darkstrikes_absorb
3:59.230 run_through Fluffy_Pillow 66.7/100: 67% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, darkstrikes, darkstrikes_absorb
4:00.034 saber_slash Fluffy_Pillow 87.4/100: 87% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, darkstrikes, darkstrikes_absorb
4:00.838 pistol_shot Fluffy_Pillow 63.1/100: 63% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, darkstrikes, darkstrikes_absorb
4:01.643 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
4:02.449 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
4:03.255 run_through Fluffy_Pillow 75.7/100: 76% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
4:04.058 saber_slash Fluffy_Pillow 78.4/100: 78% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes_absorb
4:04.865 run_through Fluffy_Pillow 72.1/100: 72% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes_absorb
4:05.668 saber_slash Fluffy_Pillow 74.8/100: 75% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes_absorb
4:06.472 ghostly_strike Fluffy_Pillow 50.4/100: 50% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes_absorb
4:07.278 run_through Fluffy_Pillow 46.2/100: 46% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes_absorb
4:08.084 marked_for_death Fluffy_Pillow 41.1/100: 41% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes_absorb
4:08.084 run_through Fluffy_Pillow 41.1/100: 41% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes_absorb
4:09.091 pistol_shot Fluffy_Pillow 52.2/100: 52% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes_absorb
4:10.096 vanish Fluffy_Pillow 68.2/100: 68% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes_absorb
4:10.096 ambush Fluffy_Pillow 68.2/100: 68% energy | 3.0/6: 50% combo_points vanish, alacrity(20), true_bearing, broadsides, roll_the_bones, darkstrikes_absorb
4:11.102 run_through Fluffy_Pillow 24.3/100: 24% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, darkstrikes_absorb
4:12.107 Waiting 2.082 sec 17.3/100: 17% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, darkstrikes_absorb
4:14.189 saber_slash Fluffy_Pillow 50.5/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade
4:15.194 run_through Fluffy_Pillow 34.6/100: 35% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, blunderbuss
4:16.198 adrenaline_rush Fluffy_Pillow 27.6/100: 28% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, blunderbuss
4:16.198 Waiting 0.700 sec 27.6/100: 28% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
4:16.898 saber_slash Fluffy_Pillow 67.9/100: 68% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
4:17.703 ghostly_strike Fluffy_Pillow 43.6/100: 44% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
4:18.510 run_through Fluffy_Pillow 39.4/100: 39% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
4:19.315 curse_of_the_dreadblades Fluffy_Pillow 42.1/100: 42% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
4:19.315 Waiting 0.300 sec 42.1/100: 42% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
4:19.615 saber_slash Fluffy_Pillow 51.7/100: 52% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
4:20.419 run_through Fluffy_Pillow 45.3/100: 45% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
4:21.224 marked_for_death Fluffy_Pillow 48.0/100: 48% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
4:21.224 run_through Fluffy_Pillow 48.0/100: 48% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
4:22.028 pistol_shot Fluffy_Pillow 50.7/100: 51% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
4:22.834 run_through Fluffy_Pillow 76.4/100: 76% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:23.639 saber_slash Fluffy_Pillow 79.1/100: 79% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:24.444 run_through Fluffy_Pillow 54.8/100: 55% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:25.248 saber_slash Fluffy_Pillow 57.5/100: 58% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:26.054 run_through Fluffy_Pillow 51.2/100: 51% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:26.860 marked_for_death Fluffy_Pillow 54.0/100: 54% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:26.860 run_through Fluffy_Pillow 54.0/100: 54% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:27.664 pistol_shot Fluffy_Pillow 56.6/100: 57% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:28.469 run_through Fluffy_Pillow 82.3/100: 82% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:29.274 saber_slash Fluffy_Pillow 85.0/100: 85% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time
4:30.080 run_through Fluffy_Pillow 78.8/100: 79% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
4:30.884 saber_slash Fluffy_Pillow 81.4/100: 81% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
4:31.688 run_through Fluffy_Pillow 67.3/100: 67% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blunderbuss
4:32.693 adrenaline_rush Fluffy_Pillow 78.3/100: 78% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blunderbuss
4:32.693 marked_for_death Fluffy_Pillow 78.3/100: 78% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
4:32.693 roll_the_bones Fluffy_Pillow 78.3/100: 78% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
4:33.497 vanish Fluffy_Pillow 91.0/100: 91% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
4:33.497 ambush Fluffy_Pillow 91.0/100: 91% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, vanish, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss
4:34.500 ghostly_strike Fluffy_Pillow 63.0/100: 63% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, blunderbuss
4:35.305 run_through Fluffy_Pillow 58.7/100: 59% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, blunderbuss
4:36.109 saber_slash Fluffy_Pillow 79.4/100: 79% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, blunderbuss
4:36.913 run_through Fluffy_Pillow 73.9/100: 74% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:37.718 shadowmeld Fluffy_Pillow 78.8/100: 79% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:37.718 saber_slash Fluffy_Pillow 78.8/100: 79% energy | 1.0/6: 17% combo_points shadowmeld, adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:38.522 saber_slash Fluffy_Pillow 74.6/100: 75% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:39.326 run_through Fluffy_Pillow 52.5/100: 52% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:40.131 marked_for_death Fluffy_Pillow 75.3/100: 75% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:40.131 run_through Fluffy_Pillow 75.3/100: 75% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:40.936 saber_slash Fluffy_Pillow 80.2/100: 80% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:41.741 saber_slash Fluffy_Pillow 76.1/100: 76% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:42.546 run_through Fluffy_Pillow 72.0/100: 72% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:43.351 saber_slash Fluffy_Pillow 76.9/100: 77% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:44.155 saber_slash Fluffy_Pillow 54.8/100: 55% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:44.960 run_through Fluffy_Pillow 50.6/100: 51% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:45.764 saber_slash Fluffy_Pillow 55.5/100: 55% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:46.570 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
4:47.373 run_through Fluffy_Pillow 27.2/100: 27% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
4:48.177 Waiting 0.981 sec 22.1/100: 22% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:49.158 marked_for_death Fluffy_Pillow 37.8/100: 38% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:49.384 run_through Fluffy_Pillow 41.4/100: 41% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:50.388 saber_slash Fluffy_Pillow 52.4/100: 52% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:51.393 Waiting 0.811 sec 18.4/100: 18% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:52.204 ghostly_strike Fluffy_Pillow 31.4/100: 31% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:53.207 Waiting 0.476 sec 17.4/100: 17% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:53.683 run_through Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:54.687 Waiting 0.937 sec 18.0/100: 18% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:55.624 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
4:56.628 Waiting 0.501 sec 17.0/100: 17% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones
4:57.129 run_through Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones
4:58.132 adrenaline_rush Fluffy_Pillow 18.0/100: 18% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones
4:58.132 pistol_shot Fluffy_Pillow 18.0/100: 18% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
4:58.937 Waiting 0.200 sec 43.7/100: 44% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
4:59.137 saber_slash Fluffy_Pillow 50.1/100: 50% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
4:59.942 run_through Fluffy_Pillow 43.8/100: 44% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
5:00.746 Waiting 0.200 sec 46.5/100: 46% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
5:00.946 saber_slash Fluffy_Pillow 52.8/100: 53% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
5:01.750 Waiting 0.600 sec 28.5/100: 29% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
5:02.350 vanish Fluffy_Pillow 65.7/100: 66% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
5:02.350 ambush Fluffy_Pillow 65.7/100: 66% energy | 3.0/6: 50% combo_points adrenaline_rush, vanish, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
5:03.354 use_item_tirathons_betrayal Fluffy_Pillow 55.7/100: 56% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time
5:03.578 run_through Fluffy_Pillow 62.9/100: 63% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time
5:04.381 marked_for_death Fluffy_Pillow 65.5/100: 65% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, darkstrikes, darkstrikes_absorb
5:04.381 run_through Fluffy_Pillow 65.5/100: 65% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time, darkstrikes, darkstrikes_absorb

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8802 8477 0
Agility 29404 27698 17346 (12223)
Stamina 41359 41359 25556
Intellect 5325 5000 0
Spirit 0 0 0
Health 2481540 2481540 0
Energy 100 100 0
Combo Points 6 6 0
Crit 38.86% 38.86% 8001
Haste 10.85% 10.85% 3525
Damage / Heal Versatility 6.31% 5.38% 2151
Attack Power 44106 41547 0
Mastery 47.15% 47.15% 4701
Armor 2236 2236 2236
Run Speed 9 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Scarred Ragefang Chestpiece
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +918 Mastery, +542 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Wristwraps of Broken Trust
ilevel: 880, stats: { 159 Armor, +1447 Sta, +965 AgiInt, +499 Mastery, +323 Crit }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Ascended Glory
ilevel: 885, stats: { +1516 Sta, +1136 Haste, +957 Crit }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Tirathon's Betrayal
ilevel: 865, stats: { +1418 Agi }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand The Dreadblades
ilevel: 906, weapon: { 5552 - 10313, 2.6 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand The Dreadblades
ilevel: 906, weapon: { 5552 - 10313, 2.6 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }

Talents

Level
15 Ghostly Strike (Outlaw Rogue) Swordmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue)
30 Grappling Hook (Outlaw Rogue) Acrobatic Strikes (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Deeper Stratagem Anticipation Vigor
60 Iron Stomach (Outlaw Rogue) Elusiveness Cheat Death
75 Parley (Outlaw Rogue) Prey on the Weak Dirty Tricks (Outlaw Rogue)
90 Cannonball Barrage (Outlaw Rogue) Alacrity Killing Spree (Outlaw Rogue)
100 Slice and Dice (Outlaw Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Outlaw_T19M"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=1310022
artifact=44:0:0:0:0:1052:1:1053:1:1054:1:1055:1:1056:1:1057:1:1058:1:1059:3:1060:3:1061:3:1062:3:1063:3:1064:3:1065:3:1066:3:1067:3:1348:1
spec=outlaw

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,if=!talent.slice_and_dice.enabled

# Executed every time the actor is available.
actions=variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
actions+=/variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
actions+=/variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
actions+=/call_action_list,name=bf
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
actions+=/death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
actions+=/slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions+=/roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
actions+=/killing_spree,if=energy.time_to_max>5|energy<15
actions+=/call_action_list,name=build
actions+=/call_action_list,name=finish,if=!variable.ss_useable
actions+=/gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1

actions.bf=cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
actions.bf+=/blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up

actions.build=ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
actions.build+=/pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&(energy.time_to_max>2-talent.quick_draw.enabled|(buff.blunderbuss.up&buff.greenskins_waterlogged_wristcuffs.up))
actions.build+=/saber_slash,if=variable.ss_useable

actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
actions.cds+=/use_item,slot=trinket2,if=buff.bloodlust.react|target.time_to_die<=20|combo_points.deficit<=2
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/arcane_torrent,if=energy.deficit>40
actions.cds+=/cannonball_barrage,if=spell_targets.cannonball_barrage>=1
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.cds+=/sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
actions.cds+=/curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)

actions.finish=between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&!buff.greenskins_waterlogged_wristcuffs.up
actions.finish+=/run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5

actions.stealth=variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
actions.stealth+=/ambush
actions.stealth+=/vanish,if=variable.stealth_condition
actions.stealth+=/shadowmeld,if=variable.stealth_condition

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1806
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1806
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=ring_of_ascended_glory,id=142520,bonus_id=3469,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=tirathons_betrayal,id=137537,bonus_id=1517
main_hand=the_dreadblades,id=128872,bonus_id=742,gem_id=139260/139261/139262,relic_id=1806/1806/1806
off_hand=the_dreadblades,id=134552

# Gear Summary
# gear_ilvl=882.63
# gear_agility=17346
# gear_stamina=25556
# gear_crit_rating=8001
# gear_haste_rating=3525
# gear_mastery_rating=4701
# gear_versatility_rating=2151
# gear_armor=2236

Rogue_Subtlety_T19M : 418226 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
418226.4 418226.4 399.0 / 0.095% 68458.1 / 16.4% 15560.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
26.8 26.8 Energy 27.13% 52.0 100.0% 100%
Talents
  • 15: Weaponmaster (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Subtlety_T19M 418226
auto_attack_mh 11348 2.7% 162.4 1.86sec 21070 14106 Direct 162.4 18154 36307 21070 35.1% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.45 162.45 0.00 0.00 1.4936 0.0000 3422725.50 5031730.70 31.98 14106.25 14106.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.62 45.94% 18153.98 15138 18166 18154.16 17914 18166 1354682 1991511 31.98
crit 56.96 35.06% 36307.37 30277 36332 36307.80 35782 36332 2068043 3040219 31.98
miss 30.87 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5578 1.3% 159.8 1.88sec 10529 6934 Direct 159.8 9077 18154 10529 35.0% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.81 159.81 0.00 0.00 1.5184 0.0000 1682596.95 2473576.90 31.98 6934.28 6934.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.60 46.05% 9076.69 7569 9083 9076.81 8944 9083 668021 982054 31.98
crit 55.89 34.97% 18154.09 15138 18166 18154.24 17880 18166 1014576 1491523 31.98
miss 30.32 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 19274 4.6% 44.1 6.13sec 131905 131316 Direct 46.7 92184 184362 124572 35.1% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.11 46.71 0.00 0.00 1.0045 0.0000 5818371.13 8553556.69 31.98 131316.49 131316.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.30 64.86% 92184.14 76883 92259 92185.78 89697 92259 2792789 4105664 31.98
crit 16.41 35.14% 184361.73 153766 184519 184365.45 177422 184519 3025582 4447892 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Eviscerate 123788 29.6% 52.5 5.68sec 706549 703396 Direct 55.6 445525 890682 667844 49.9% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.54 55.59 0.00 0.00 1.0045 0.0000 37123854.53 54575582.63 31.98 703396.39 703396.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.83 50.06% 445525.19 306283 546899 445704.26 405344 483315 12397200 18225059 31.98
crit 27.76 49.94% 890681.57 612567 1093799 891045.52 820349 987065 24726654 36350524 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (7988) 0.0% (1.9%) 4.9 63.75sec 494343 492207

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.86 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 492206.72 492206.72
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.shadow_dance.up&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 5367 1.3% 4.9 63.75sec 332420 0 Direct 5.1 230553 469276 314382 35.1% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.86 5.14 0.00 0.00 0.0000 0.0000 1615202.37 1615202.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.33 64.88% 230553.28 106809 2050727 214165.75 0 2050727 768555 768555 0.00
crit 1.80 35.12% 469276.15 213617 4101453 393598.01 0 4101453 846647 846647 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
    Goremaw's Bite (_oh) 2621 0.6% 4.9 63.75sec 161922 0 Direct 5.1 114341 226307 153522 35.0% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.86 5.13 0.00 0.00 0.0000 0.0000 786766.44 786766.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.33 65.01% 114341.41 53407 1025417 106049.36 0 1025417 380881 380881 0.00
crit 1.79 34.99% 226306.85 106814 2050834 191713.95 0 2050834 405886 405886 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Horrific Slam 14392 3.4% 119.1 2.18sec 36334 0 Direct 119.1 26916 53831 36334 35.0% 0.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.08 119.08 0.00 0.00 0.0000 0.0000 4326868.35 4326868.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.41 65.01% 26916.11 22443 26932 26916.03 26003 26932 2083671 2083671 0.00
crit 41.67 34.99% 53830.60 44886 53863 53830.08 50556 53863 2243197 2243197 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Mark of the Hidden Satyr 4881 1.2% 16.9 17.67sec 86527 0 Direct 16.9 64009 128009 86526 35.2% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.95 16.95 0.00 0.00 0.0000 0.0000 1466223.45 1466223.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.98 64.82% 64009.14 53367 64041 64009.45 61372 64041 703016 703016 0.00
crit 5.96 35.18% 128009.17 106734 128081 127787.60 0 128081 763207 763207 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Nightblade 84797 (89741) 20.3% (21.5%) 17.3 17.25sec 1558743 1551792 Periodic 144.2 131015 262051 176824 35.0% 0.0% 95.9%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.32 0.00 144.24 144.24 1.0045 2.0000 25504347.70 25504347.70 0.00 88247.67 1551792.26
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.8 65.04% 131014.59 97104 144495 131016.83 126386 135311 12290635 12290635 0.00
crit 50.4 34.96% 262050.92 194209 288990 262060.63 249546 274889 13213713 13213713 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=50}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Weaponmaster 4944 1.2% 8.4 30.71sec 176880 0 Direct 8.4 176885 0 176885 0.0% 0.0%  

Stats details: weaponmaster

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.41 8.41 0.00 0.00 0.0000 0.0000 1487526.85 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.41 100.00% 176884.92 97104 288990 176573.90 0 284325 1487527 0 0.00
 
 

Action details: weaponmaster

Static Values
  • id:193536
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193536
  • name:Weaponmaster
  • school:shadow
  • tooltip:
  • description:Deals Shadow damage to an enemy.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:116528.28
  • base_dd_max:116528.28
 
Potion of the Old War 17122 4.0% 24.1 9.30sec 210059 0 Direct 24.1 155498 310994 210060 35.1% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.11 24.11 0.00 0.00 0.0000 0.0000 5064337.92 7445056.45 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.65 64.91% 155497.84 129584 155500 155497.99 152045 155500 2433472 3577434 31.98
crit 8.46 35.09% 310994.45 259167 311001 310953.65 0 311001 2630866 3867622 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (6871) 0.0% (1.6%) 2.0 180.89sec 997558 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(stealthed|buff.shadowmeld.up)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 4580 1.1% 35.5 6.08sec 38137 29204 Direct 37.6 26706 53411 36038 34.9% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.52 37.59 0.00 0.00 1.3059 0.0000 1354587.72 1354587.72 0.00 29204.40 29204.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.45 65.05% 26705.60 22255 26706 26705.61 26319 26706 652989 652989 0.00
crit 13.14 34.95% 53410.83 44510 53412 53410.67 51631 53412 701599 701599 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 2291 0.5% 35.6 6.06sec 19049 14586 Direct 37.6 13353 26706 18033 35.1% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.58 37.59 0.00 0.00 1.3060 0.0000 677776.11 677776.11 0.00 14585.87 14585.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.41 64.95% 13352.74 11127 13353 13352.73 13075 13353 325957 325957 0.00
crit 13.17 35.05% 26705.51 22255 26706 26705.58 26211 26706 351819 351819 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 7897 1.9% 29.4 10.23sec 80484 0 Direct 31.1 56334 112668 76098 35.1% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.42 31.11 0.00 0.00 0.0000 0.0000 2367498.98 2367498.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.20 64.92% 56334.49 46950 56339 56334.74 55486 56339 1137778 1137778 0.00
crit 10.91 35.08% 112668.35 93899 112679 112668.69 109549 112679 1229721 1229721 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 87406 (109346) 20.9% (26.1%) 99.2 3.04sec 330331 328854 Direct 105.0 177824 355652 249458 40.3% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.23 105.03 0.00 0.00 1.0045 0.0000 26200593.60 38517354.39 31.98 328854.38 328854.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.72 59.72% 177824.40 148207 177848 177824.81 176260 177848 11153424 16396590 31.98
crit 42.31 40.28% 355651.85 296414 355697 355651.60 350890 355697 15047170 22120765 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 21939 5.2% 103.8 3.02sec 63383 0 Direct 103.8 46951 93901 63383 35.0% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.78 103.78 0.00 0.00 0.0000 0.0000 6577638.09 6577638.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.46 65.00% 46950.66 46951 46951 46950.66 46951 46951 3167125 3167125 0.00
crit 36.32 35.00% 93901.32 93901 93901 93901.32 93901 93901 3410513 3410513 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After you use Cheap Shot or Shadowstrike, Akaari's Soul appears $m1 sec later and Soul Rips the target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Rogue_Subtlety_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T19M
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 26.0 11.62sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.65
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=50}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for $31666d after deal {$31223s1=10}% more damage. ][]
 
Shadowmeld 2.6 122.67sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.63 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=40-variable.ssw_er&energy.deficit>10
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Symbols of Death 9.0 35.49sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.9 122.56sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 10.7 6.6 28.4sec 17.0sec 45.25% 45.25% 6.6(6.6) 10.2

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.01% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 9.0 0.0 34.2sec 35.5sec 3.41% 8.63% 0.0(0.0) 0.4

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:3.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Finality: Eviscerate 28.0 0.0 10.7sec 10.7sec 49.31% 49.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_finality_eviscerate
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:27.55%
  • finality_eviscerate_6:21.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.9 0.0 34.7sec 34.7sec 42.54% 39.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:23.88%
  • finality_nightblade_6:18.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.9 0.0 63.7sec 63.7sec 9.60% 9.60% 28.8(28.8) 4.8

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Horrific Appendages 6.2 2.2 47.0sec 33.6sec 30.33% 30.33% 121.3(121.3) 5.9

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:30.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 183.9sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 2.0 0.0 180.9sec 180.9sec 16.94% 19.02% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:16.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 26.0 0.0 11.6sec 11.6sec 42.97% 42.97% 0.0(0.0) 25.6

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:42.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=50}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for $31666d after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Shadowmeld 2.6 0.0 122.7sec 122.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowmeld_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Stealth 3.8 0.0 83.8sec 122.6sec 1.24% 1.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 3.9 0.0 83.1sec 122.6sec 3.86% 3.86% 0.0(0.0) 3.8

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:3.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=100}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.3 7.6 184.3sec 35.5sec 99.66% 98.53% 7.6(7.6) 0.4

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Vanish 2.9 0.0 122.6sec 122.6sec 2.85% 2.85% 0.0(0.0) 2.8

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:2.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Subtlety_T19M
backstab Energy 44.1 1543.9 35.0 35.0 3768.7
eviscerate Energy 52.5 1839.0 35.0 35.0 20187.0
eviscerate Combo Points 52.5 287.4 5.5 5.5 129186.3
nightblade Energy 17.3 432.9 25.0 25.0 62349.5
nightblade Combo Points 17.3 94.3 5.4 5.4 286353.6
shadowstrike Energy 99.2 3969.2 40.0 40.0 8258.2
symbols_of_death Energy 9.0 278.9 31.1 31.1 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 46.71 46.63 (12.13%) 1.00 0.08 0.16%
goremaws_bite Combo Points 4.86 14.35 (3.73%) 2.95 0.23 1.55%
shadowstrike Combo Points 105.03 207.44 (53.96%) 1.98 2.62 1.25%
energy_regen Energy 1568.35 3451.22 (43.10%) 2.20 79.56 2.25%
Shadow Techniques Combo Points 95.73 95.00 (24.71%) 0.99 15.15 13.75%
Master of Shadows Energy 28.80 641.47 (8.01%) 22.27 222.46 25.75%
Shadow Blades Combo Points 28.38 21.01 (5.47%) 0.74 7.37 25.96%
Energetic Stabbing Energy 26.21 654.47 (8.17%) 24.97 0.86 0.13%
Goremaw's Bite Energy 28.83 136.77 (1.71%) 4.74 7.36 5.10%
Relentless Strikes Energy 72.90 3122.72 (39.00%) 42.83 63.28 1.99%
Resource RPS-Gain RPS-Loss
Energy 26.62 26.81
Combo Points 1.28 1.27
Combat End Resource Mean Min Max
Energy 42.93 0.14 100.00
Combo Points 2.80 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.6%

Procs

Count Interval
Weaponmaster 26.2 11.1sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Subtlety_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Rogue_Subtlety_T19M Damage Per Second
Count 7499
Mean 418226.43
Minimum 361824.70
Maximum 487022.98
Spread ( max - min ) 125198.28
Range [ ( max - min ) / 2 * 100% ] 14.97%
Standard Deviation 17628.3519
5th Percentile 390651.24
95th Percentile 448407.93
( 95th Percentile - 5th Percentile ) 57756.69
Mean Distribution
Standard Deviation 203.5682
95.00% Confidence Intervall ( 417827.44 - 418625.42 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 68
0.1% Error 6824
0.1 Scale Factor Error with Delta=300 2652815
0.05 Scale Factor Error with Delta=300 10611263
0.01 Scale Factor Error with Delta=300 265281576
Priority Target DPS
Sample Data Rogue_Subtlety_T19M Priority Target Damage Per Second
Count 7499
Mean 418226.43
Minimum 361824.70
Maximum 487022.98
Spread ( max - min ) 125198.28
Range [ ( max - min ) / 2 * 100% ] 14.97%
Standard Deviation 17628.3519
5th Percentile 390651.24
95th Percentile 448407.93
( 95th Percentile - 5th Percentile ) 57756.69
Mean Distribution
Standard Deviation 203.5682
95.00% Confidence Intervall ( 417827.44 - 418625.42 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 68
0.1% Error 6824
0.1 Scale Factor Error with Delta=300 2652815
0.05 Scale Factor Error with Delta=300 10611263
0.01 Scale Factor Error with Delta=300 265281576
DPS(e)
Sample Data Rogue_Subtlety_T19M Damage Per Second (Effective)
Count 7499
Mean 418226.43
Minimum 361824.70
Maximum 487022.98
Spread ( max - min ) 125198.28
Range [ ( max - min ) / 2 * 100% ] 14.97%
Damage
Sample Data Rogue_Subtlety_T19M Damage
Count 7499
Mean 125476915.70
Minimum 92950099.96
Maximum 162036081.66
Spread ( max - min ) 69085981.69
Range [ ( max - min ) / 2 * 100% ] 27.53%
DTPS
Sample Data Rogue_Subtlety_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Subtlety_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Subtlety_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Subtlety_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Subtlety_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Subtlety_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Subtlety_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Subtlety_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=ssw_er,value=equipped.shadow_satyrs_walk*(10-floor(target.distance*0.5))
0.00 variable,name=ed_threshold,value=energy.deficit<=(20+talent.vigor.enabled*35+talent.master_of_shadows.enabled*25+variable.ssw_er)
8 0.00 call_action_list,name=cds
9 0.00 run_action_list,name=stealthed,if=stealthed|buff.shadowmeld.up
A 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
B 0.00 call_action_list,name=stealth_cds,if=combo_points.deficit>=2+talent.premeditation.enabled&(variable.ed_threshold|(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)|target.time_to_die<12)
C 0.00 call_action_list,name=build,if=variable.ed_threshold
actions.build
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
D 44.11 backstab
actions.cds
# count action,conditions
E 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
0.00 blood_fury,if=stealthed
0.00 berserking,if=stealthed
0.00 arcane_torrent,if=stealthed&energy.deficit>70
F 2.04 shadow_blades,if=!(stealthed|buff.shadowmeld.up)
G 4.86 goremaws_bite,if=!buff.shadow_dance.up&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
H 17.32 nightblade,target_if=max:target.time_to_die,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
I 52.54 eviscerate
actions.stealth_cds
# count action,conditions
J 2.03 shadow_dance,if=charges_fractional>=2.65
K 2.86 vanish
L 4.01 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40-variable.ssw_er
M 2.63 shadowmeld,if=energy>=40-variable.ssw_er&energy.deficit>10
N 19.93 shadow_dance,if=combo_points<=1
actions.stealthed
# count action,conditions
O 7.97 symbols_of_death,if=buff.shadowmeld.down&((buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|(equipped.shadow_satyrs_walk&energy.time_to_max<0.25))
P 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Q 99.23 shadowstrike

Sample Sequence

012457QQQFHJQQIQIKQQILQQIQQHLQIQIQDIGDIMQDIJOQQIQDHLQQIQDILQQQHQDDILOQQIQDINQQIQQHNQQIQQINQQIQDHGDDINOQQQIDDDHNQQIQDIDDDHNQQQOIKQQIDDDHNQQIQMQIGDHNQQIQQIDDDINOQQIDDFEDHNQQIQDIDDINQQHOQIDDINQQIQDHGDIDDINQQQHDDINOQQIDDDINQQHQQIKQQINQQIQQHDDMQINOQQIDGIDDDHNQQIQQIDDINQQ

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Subtlety_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Subtlety_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Subtlety_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
Pre symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, stealth, symbols_of_death, death, potion_of_the_old_war
0:01.004 shadowstrike Fluffy_Pillow 75.4/100: 75% energy | 2.0/6: 33% combo_points bloodlust, stealth, subterfuge, symbols_of_death, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:02.010 shadowstrike Fluffy_Pillow 75.9/100: 76% energy | 4.0/6: 67% combo_points bloodlust, stealth, subterfuge, symbols_of_death, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:03.016 shadow_blades Fluffy_Pillow 51.3/100: 51% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:03.016 nightblade Fluffy_Pillow 51.3/100: 51% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, shadow_blades, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:04.021 shadow_dance Fluffy_Pillow 81.7/100: 82% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:04.021 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:05.026 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:06.031 eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:07.035 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:08.040 eviscerate Fluffy_Pillow 75.4/100: 75% energy | 5.0/6: 83% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:09.044 vanish Fluffy_Pillow 95.9/100: 96% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:09.044 shadowstrike Fluffy_Pillow 95.9/100: 96% energy | 0.0/6: 0% combo_points bloodlust, vanish, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:10.049 shadowstrike Fluffy_Pillow 71.3/100: 71% energy | 3.0/6: 50% combo_points bloodlust, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:11.053 eviscerate Fluffy_Pillow 71.7/100: 72% energy | 6.0/6: 100% combo_points bloodlust, vanish, subterfuge, symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:12.058 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:12.058 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:13.063 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:14.067 eviscerate Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:15.071 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:16.074 shadowstrike Fluffy_Pillow 75.4/100: 75% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:17.078 nightblade Fluffy_Pillow 50.8/100: 51% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, potion_of_the_old_war
0:18.084 shadow_dance Fluffy_Pillow 80.0/100: 80% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, potion_of_the_old_war
0:18.084 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, potion_of_the_old_war
0:19.090 eviscerate Fluffy_Pillow 74.2/100: 74% energy | 5.0/6: 83% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, potion_of_the_old_war
0:20.094 shadowstrike Fluffy_Pillow 93.4/100: 93% energy | 2.0/6: 33% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
0:21.097 eviscerate Fluffy_Pillow 67.6/100: 68% energy | 5.0/6: 83% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
0:22.102 shadowstrike Fluffy_Pillow 86.8/100: 87% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), horrific_appendages, potion_of_the_old_war
0:23.105 backstab Fluffy_Pillow 60.9/100: 61% energy | 4.0/6: 67% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(5), horrific_appendages
0:24.111 eviscerate Fluffy_Pillow 40.2/100: 40% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(5)
0:25.118 goremaws_bite Fluffy_Pillow 59.4/100: 59% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, shadow_blades
0:26.125 backstab Fluffy_Pillow 78.6/100: 79% energy | 4.0/6: 67% combo_points bloodlust, symbols_of_death, shadow_blades, goremaws_bite
0:27.130 eviscerate Fluffy_Pillow 62.8/100: 63% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, shadow_blades, goremaws_bite
0:28.134 shadowmeld Fluffy_Pillow 87.0/100: 87% energy | 2.0/6: 33% combo_points bloodlust, symbols_of_death, goremaws_bite, finality_eviscerate(6)
0:28.134 shadowstrike Fluffy_Pillow 87.0/100: 87% energy | 2.0/6: 33% combo_points bloodlust, shadowmeld, symbols_of_death, goremaws_bite, finality_eviscerate(6)
0:29.137 backstab Fluffy_Pillow 91.2/100: 91% energy | 4.0/6: 67% combo_points bloodlust, symbols_of_death, goremaws_bite, finality_eviscerate(6)
0:30.142 eviscerate Fluffy_Pillow 75.4/100: 75% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, goremaws_bite, finality_eviscerate(6)
0:31.147 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death
0:31.147 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death
0:31.147 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, death
0:32.153 Waiting 0.100 sec 39.2/100: 39% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death
0:32.253 shadowstrike Fluffy_Pillow 40.6/100: 41% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death
0:33.256 Waiting 1.522 sec 14.8/100: 15% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death
0:34.778 eviscerate Fluffy_Pillow 36.3/100: 36% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death
0:35.782 shadowstrike Fluffy_Pillow 55.5/100: 55% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, finality_eviscerate(6)
0:36.787 Waiting 1.700 sec 30.1/100: 30% energy | 3.0/6: 50% combo_points bloodlust, symbols_of_death, finality_eviscerate(6), blood_frenzy
0:38.487 backstab Fluffy_Pillow 56.2/100: 56% energy | 4.0/6: 67% combo_points bloodlust, symbols_of_death, finality_eviscerate(6), blood_frenzy
0:39.491 nightblade Fluffy_Pillow 36.7/100: 37% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, finality_eviscerate(6), blood_frenzy
0:40.496 shadow_dance Fluffy_Pillow 65.1/100: 65% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
0:40.496 shadowstrike Fluffy_Pillow 95.1/100: 95% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
0:41.501 shadowstrike Fluffy_Pillow 67.0/100: 67% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
0:42.507 eviscerate Fluffy_Pillow 38.9/100: 39% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
0:43.512 shadowstrike Fluffy_Pillow 55.7/100: 56% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), blood_frenzy
0:44.516 Waiting 2.400 sec 27.6/100: 28% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), blood_frenzy
0:46.916 backstab Fluffy_Pillow 55.5/100: 55% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6)
0:47.919 Waiting 1.400 sec 31.4/100: 31% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(6)
0:49.319 eviscerate Fluffy_Pillow 46.6/100: 47% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6)
0:50.322 shadow_dance Fluffy_Pillow 62.5/100: 62% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
0:50.322 shadowstrike Fluffy_Pillow 92.5/100: 92% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
0:51.326 shadowstrike Fluffy_Pillow 88.4/100: 88% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
0:52.330 shadowstrike Fluffy_Pillow 84.3/100: 84% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
0:53.337 nightblade Fluffy_Pillow 80.2/100: 80% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
0:54.342 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
0:55.345 backstab Fluffy_Pillow 70.9/100: 71% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
0:56.350 Waiting 0.800 sec 46.8/100: 47% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
0:57.150 backstab Fluffy_Pillow 55.5/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
0:58.153 Waiting 0.400 sec 31.4/100: 31% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
0:58.553 eviscerate Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5)
0:59.557 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6)
0:59.557 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6)
0:59.557 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(6)
1:00.559 Waiting 0.400 sec 35.9/100: 36% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6)
1:00.959 shadowstrike Fluffy_Pillow 40.2/100: 40% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6)
1:01.963 eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6)
1:02.967 shadowstrike Fluffy_Pillow 52.1/100: 52% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death
1:03.972 Waiting 2.885 sec 23.0/100: 23% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death
1:06.857 backstab Fluffy_Pillow 55.3/100: 55% energy | 3.0/6: 50% combo_points symbols_of_death, blood_frenzy
1:07.862 Waiting 0.300 sec 32.2/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, blood_frenzy
1:08.162 eviscerate Fluffy_Pillow 35.7/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, blood_frenzy
1:09.166 Waiting 0.300 sec 52.6/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:09.466 shadow_dance Fluffy_Pillow 56.1/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:09.466 shadowstrike Fluffy_Pillow 86.1/100: 86% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), blood_frenzy
1:10.470 shadowstrike Fluffy_Pillow 83.0/100: 83% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), blood_frenzy
1:11.473 eviscerate Fluffy_Pillow 79.8/100: 80% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), blood_frenzy
1:12.479 shadowstrike Fluffy_Pillow 96.7/100: 97% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, blood_frenzy
1:13.483 shadowstrike Fluffy_Pillow 68.6/100: 69% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, blood_frenzy
1:14.487 nightblade Fluffy_Pillow 40.4/100: 40% energy | 5.0/6: 83% combo_points symbols_of_death, blood_frenzy
1:15.491 shadow_dance Fluffy_Pillow 67.3/100: 67% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
1:15.491 shadowstrike Fluffy_Pillow 97.3/100: 97% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
1:16.496 shadowstrike Fluffy_Pillow 69.2/100: 69% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
1:17.500 eviscerate Fluffy_Pillow 41.0/100: 41% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
1:18.504 shadowstrike Fluffy_Pillow 97.9/100: 98% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), blood_frenzy
1:19.508 shadowstrike Fluffy_Pillow 69.7/100: 70% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), blood_frenzy
1:20.513 eviscerate Fluffy_Pillow 41.6/100: 42% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5), blood_frenzy
1:21.518 shadow_dance Fluffy_Pillow 58.5/100: 58% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
1:21.518 shadowstrike Fluffy_Pillow 88.5/100: 88% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
1:22.523 shadowstrike Fluffy_Pillow 60.4/100: 60% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
1:23.528 Waiting 0.300 sec 32.2/100: 32% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
1:23.828 eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
1:24.833 shadowstrike Fluffy_Pillow 52.3/100: 52% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:25.838 Waiting 2.963 sec 23.2/100: 23% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:28.801 backstab Fluffy_Pillow 55.4/100: 55% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:29.805 nightblade Fluffy_Pillow 31.3/100: 31% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
1:30.809 goremaws_bite Fluffy_Pillow 57.2/100: 57% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
1:31.814 backstab Fluffy_Pillow 73.2/100: 73% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages
1:32.818 Waiting 0.100 sec 54.1/100: 54% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages
1:32.918 backstab Fluffy_Pillow 55.2/100: 55% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages
1:33.922 eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages
1:34.928 shadow_dance Fluffy_Pillow 57.0/100: 57% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, horrific_appendages
1:34.928 symbols_of_death Fluffy_Pillow 87.0/100: 87% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, horrific_appendages
1:34.928 shadowstrike Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, death, horrific_appendages
1:35.933 shadowstrike Fluffy_Pillow 52.9/100: 53% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, goremaws_bite, horrific_appendages
1:36.938 shadowstrike Fluffy_Pillow 53.9/100: 54% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, horrific_appendages
1:37.941 Waiting 1.000 sec 24.8/100: 25% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, horrific_appendages
1:38.941 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, horrific_appendages
1:39.944 Waiting 0.400 sec 51.5/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages
1:40.344 backstab Fluffy_Pillow 55.9/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages
1:41.349 Waiting 2.200 sec 31.8/100: 32% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages
1:43.549 backstab Fluffy_Pillow 55.7/100: 56% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(6)
1:44.554 Waiting 2.200 sec 31.6/100: 32% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6)
1:46.754 backstab Fluffy_Pillow 55.8/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages, blood_frenzy
1:47.759 nightblade Fluffy_Pillow 32.7/100: 33% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages, blood_frenzy
1:48.763 shadow_dance Fluffy_Pillow 59.6/100: 60% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy
1:48.763 shadowstrike Fluffy_Pillow 89.6/100: 90% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy
1:49.767 shadowstrike Fluffy_Pillow 61.4/100: 61% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy
1:50.771 Waiting 0.200 sec 33.3/100: 33% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy
1:50.971 eviscerate Fluffy_Pillow 35.7/100: 36% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy
1:51.974 shadowstrike Fluffy_Pillow 52.5/100: 53% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
1:52.978 Waiting 2.600 sec 24.4/100: 24% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
1:55.578 backstab Fluffy_Pillow 55.1/100: 55% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
1:56.582 Waiting 0.300 sec 31.8/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
1:56.882 eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
1:57.887 Waiting 0.400 sec 51.0/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), horrific_appendages
1:58.287 backstab Fluffy_Pillow 55.3/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), horrific_appendages
1:59.291 Waiting 2.200 sec 31.2/100: 31% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:01.491 backstab Fluffy_Pillow 55.1/100: 55% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:02.496 Waiting 2.300 sec 31.1/100: 31% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:04.796 backstab Fluffy_Pillow 56.1/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:05.801 nightblade Fluffy_Pillow 32.0/100: 32% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:06.804 shadow_dance Fluffy_Pillow 57.9/100: 58% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
2:06.804 shadowstrike Fluffy_Pillow 87.9/100: 88% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
2:07.810 shadowstrike Fluffy_Pillow 58.8/100: 59% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
2:08.813 shadowstrike Fluffy_Pillow 54.7/100: 55% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
2:09.818 Waiting 0.900 sec 25.6/100: 26% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
2:10.718 symbols_of_death Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
2:10.718 Waiting 3.261 sec 0.4/100: 0% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(5)
2:13.979 eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, death, finality_eviscerate(5)
2:14.984 Waiting 0.300 sec 51.8/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, death
2:15.284 vanish Fluffy_Pillow 55.0/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, death
2:15.284 shadowstrike Fluffy_Pillow 55.0/100: 55% energy | 0.0/6: 0% combo_points vanish, symbols_of_death, death
2:16.288 Waiting 1.300 sec 26.0/100: 26% energy | 3.0/6: 50% combo_points vanish, subterfuge, symbols_of_death
2:17.588 shadowstrike Fluffy_Pillow 40.1/100: 40% energy | 3.0/6: 50% combo_points vanish, subterfuge, symbols_of_death
2:18.592 eviscerate Fluffy_Pillow 66.0/100: 66% energy | 5.0/6: 83% combo_points symbols_of_death
2:19.597 backstab Fluffy_Pillow 81.9/100: 82% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
2:20.602 backstab Fluffy_Pillow 57.8/100: 58% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5)
2:21.607 Waiting 2.000 sec 33.8/100: 34% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
2:23.607 backstab Fluffy_Pillow 55.5/100: 56% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
2:24.613 nightblade Fluffy_Pillow 31.4/100: 31% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
2:25.618 shadow_dance Fluffy_Pillow 57.4/100: 57% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages
2:25.618 shadowstrike Fluffy_Pillow 87.4/100: 87% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages
2:26.622 shadowstrike Fluffy_Pillow 58.3/100: 58% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages
2:27.626 Waiting 0.600 sec 29.2/100: 29% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages
2:28.226 eviscerate Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages
2:29.231 shadowstrike Fluffy_Pillow 51.6/100: 52% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), horrific_appendages
2:30.235 Waiting 0.426 sec 22.5/100: 23% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), horrific_appendages
2:31.937 shadowmeld Fluffy_Pillow 41.0/100: 41% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages
2:31.937 shadowstrike Fluffy_Pillow 41.0/100: 41% energy | 3.0/6: 50% combo_points shadowmeld, symbols_of_death, finality_nightblade(6), horrific_appendages
2:32.941 Waiting 2.101 sec 11.9/100: 12% energy | 6.0/6: 100% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages
2:35.042 eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages, blood_frenzy
2:36.047 goremaws_bite Fluffy_Pillow 53.0/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy
2:37.050 backstab Fluffy_Pillow 69.9/100: 70% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
2:38.056 nightblade Fluffy_Pillow 51.7/100: 52% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
2:39.060 shadow_dance Fluffy_Pillow 83.6/100: 84% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), blood_frenzy
2:39.060 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), blood_frenzy
2:40.066 shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), blood_frenzy
2:41.070 eviscerate Fluffy_Pillow 78.7/100: 79% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), blood_frenzy
2:42.073 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, blood_frenzy
2:43.077 shadowstrike Fluffy_Pillow 71.9/100: 72% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, blood_frenzy
2:44.082 eviscerate Fluffy_Pillow 43.7/100: 44% energy | 5.0/6: 83% combo_points symbols_of_death, blood_frenzy
2:45.088 backstab Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points symbols_of_death, blood_frenzy
2:46.094 backstab Fluffy_Pillow 76.9/100: 77% energy | 2.0/6: 33% combo_points symbols_of_death, blood_frenzy
2:47.099 Waiting 0.200 sec 53.8/100: 54% energy | 3.0/6: 50% combo_points symbols_of_death, blood_frenzy
2:47.299 backstab Fluffy_Pillow 56.1/100: 56% energy | 3.0/6: 50% combo_points symbols_of_death, blood_frenzy
2:48.302 Waiting 0.200 sec 33.0/100: 33% energy | 5.0/6: 83% combo_points symbols_of_death, blood_frenzy
2:48.502 eviscerate Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, blood_frenzy
2:49.508 Waiting 0.300 sec 52.2/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
2:49.808 shadow_dance Fluffy_Pillow 55.8/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
2:49.808 symbols_of_death Fluffy_Pillow 85.8/100: 86% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
2:49.808 shadowstrike Fluffy_Pillow 50.8/100: 51% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(5), blood_frenzy
2:50.813 Waiting 1.500 sec 22.6/100: 23% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
2:52.313 shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
2:53.315 Waiting 1.985 sec 12.2/100: 12% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
2:55.300 eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5)
2:56.306 Waiting 0.400 sec 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death
2:56.706 backstab Fluffy_Pillow 55.6/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death
2:57.711 Waiting 2.200 sec 31.6/100: 32% energy | 2.0/6: 33% combo_points symbols_of_death
2:59.911 backstab Fluffy_Pillow 55.5/100: 55% energy | 2.0/6: 33% combo_points symbols_of_death
3:00.916 Waiting 1.900 sec 31.4/100: 31% energy | 4.0/6: 67% combo_points symbols_of_death
3:02.816 shadow_blades Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death
3:03.016 potion Fluffy_Pillow 54.2/100: 54% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades
3:03.016 Waiting 0.100 sec 54.2/100: 54% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:03.116 backstab Fluffy_Pillow 55.3/100: 55% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:04.120 nightblade Fluffy_Pillow 31.2/100: 31% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:05.123 shadow_dance Fluffy_Pillow 97.1/100: 97% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:05.123 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:06.126 shadowstrike Fluffy_Pillow 70.9/100: 71% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:07.130 eviscerate Fluffy_Pillow 41.8/100: 42% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:08.137 shadowstrike Fluffy_Pillow 57.8/100: 58% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:09.140 Waiting 2.500 sec 28.7/100: 29% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:11.640 backstab Fluffy_Pillow 55.8/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:12.645 Waiting 0.300 sec 31.7/100: 32% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:12.945 eviscerate Fluffy_Pillow 35.0/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:13.948 backstab Fluffy_Pillow 90.9/100: 91% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:14.953 backstab Fluffy_Pillow 66.8/100: 67% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:15.959 eviscerate Fluffy_Pillow 42.8/100: 43% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:16.962 shadow_dance Fluffy_Pillow 58.7/100: 59% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:16.962 shadowstrike Fluffy_Pillow 88.7/100: 89% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:17.969 shadowstrike Fluffy_Pillow 59.6/100: 60% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:18.973 nightblade Fluffy_Pillow 30.5/100: 31% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(6), potion_of_the_old_war
3:19.978 symbols_of_death Fluffy_Pillow 56.4/100: 56% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:19.978 Waiting 1.727 sec 21.4/100: 21% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), potion_of_the_old_war
3:21.705 shadowstrike Fluffy_Pillow 40.2/100: 40% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), potion_of_the_old_war
3:22.709 Waiting 2.276 sec 11.1/100: 11% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:24.985 eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:25.989 Waiting 0.300 sec 51.8/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:26.289 backstab Fluffy_Pillow 55.0/100: 55% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:27.294 Waiting 2.300 sec 31.0/100: 31% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:29.594 backstab Fluffy_Pillow 56.0/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death
3:30.597 Waiting 0.300 sec 31.9/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death
3:30.897 eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death
3:31.902 Waiting 0.400 sec 51.0/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
3:32.302 shadow_dance Fluffy_Pillow 55.4/100: 55% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5)
3:32.302 shadowstrike Fluffy_Pillow 85.4/100: 85% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
3:33.306 shadowstrike Fluffy_Pillow 56.3/100: 56% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
3:34.311 Waiting 0.700 sec 27.2/100: 27% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
3:35.011 eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
3:36.016 shadowstrike Fluffy_Pillow 52.0/100: 52% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, blood_frenzy
3:37.020 Waiting 2.700 sec 23.9/100: 24% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, blood_frenzy
3:39.720 backstab Fluffy_Pillow 55.8/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, blood_frenzy
3:40.726 nightblade Fluffy_Pillow 32.7/100: 33% energy | 5.0/6: 83% combo_points symbols_of_death, blood_frenzy
3:41.730 goremaws_bite Fluffy_Pillow 59.5/100: 60% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
3:42.735 backstab Fluffy_Pillow 76.4/100: 76% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_nightblade(5), horrific_appendages, blood_frenzy
3:43.739 eviscerate Fluffy_Pillow 58.3/100: 58% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_nightblade(5), horrific_appendages, blood_frenzy
3:44.743 backstab Fluffy_Pillow 80.0/100: 80% energy | 2.0/6: 33% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), horrific_appendages
3:45.747 backstab Fluffy_Pillow 60.9/100: 61% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), horrific_appendages
3:46.753 Waiting 0.300 sec 41.9/100: 42% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), horrific_appendages
3:47.053 eviscerate Fluffy_Pillow 45.1/100: 45% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5), horrific_appendages
3:48.058 shadow_dance Fluffy_Pillow 66.1/100: 66% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
3:48.058 shadowstrike Fluffy_Pillow 96.1/100: 96% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages
3:49.063 shadowstrike Fluffy_Pillow 67.0/100: 67% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages
3:50.068 Waiting 0.200 sec 37.9/100: 38% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages
3:50.268 shadowstrike Fluffy_Pillow 40.1/100: 40% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages
3:51.275 Waiting 1.385 sec 11.0/100: 11% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages
3:52.660 nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages
3:53.665 Waiting 0.300 sec 52.0/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, horrific_appendages
3:53.965 backstab Fluffy_Pillow 55.3/100: 55% energy | 1.0/6: 17% combo_points symbols_of_death, horrific_appendages
3:54.970 Waiting 2.200 sec 31.2/100: 31% energy | 2.0/6: 33% combo_points symbols_of_death, horrific_appendages
3:57.170 backstab Fluffy_Pillow 55.1/100: 55% energy | 4.0/6: 67% combo_points symbols_of_death, horrific_appendages
3:58.174 Waiting 0.400 sec 31.0/100: 31% energy | 5.0/6: 83% combo_points symbols_of_death, horrific_appendages
3:58.574 eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, horrific_appendages
3:59.580 Waiting 0.400 sec 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
3:59.980 shadow_dance Fluffy_Pillow 55.6/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
3:59.980 symbols_of_death Fluffy_Pillow 85.6/100: 86% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages
3:59.980 shadowstrike Fluffy_Pillow 50.6/100: 51% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(5), horrific_appendages
4:00.986 Waiting 1.716 sec 21.6/100: 22% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages
4:02.702 shadowstrike Fluffy_Pillow 40.2/100: 40% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages
4:03.707 Waiting 2.275 sec 11.1/100: 11% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
4:05.982 eviscerate Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5)
4:06.986 backstab Fluffy_Pillow 91.8/100: 92% energy | 1.0/6: 17% combo_points symbols_of_death
4:07.989 backstab Fluffy_Pillow 67.7/100: 68% energy | 2.0/6: 33% combo_points symbols_of_death, horrific_appendages
4:08.993 Waiting 1.100 sec 43.6/100: 44% energy | 3.0/6: 50% combo_points symbols_of_death, horrific_appendages
4:10.093 backstab Fluffy_Pillow 55.5/100: 56% energy | 3.0/6: 50% combo_points symbols_of_death, horrific_appendages
4:11.097 Waiting 0.400 sec 31.5/100: 31% energy | 5.0/6: 83% combo_points symbols_of_death, horrific_appendages
4:11.497 eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, horrific_appendages
4:12.504 Waiting 0.300 sec 51.7/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
4:12.804 shadow_dance Fluffy_Pillow 55.0/100: 55% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
4:12.804 shadowstrike Fluffy_Pillow 85.0/100: 85% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages
4:13.809 shadowstrike Fluffy_Pillow 80.9/100: 81% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages
4:14.813 nightblade Fluffy_Pillow 51.8/100: 52% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages
4:15.816 shadowstrike Fluffy_Pillow 77.7/100: 78% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), horrific_appendages
4:16.821 shadowstrike Fluffy_Pillow 49.6/100: 50% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), horrific_appendages, blood_frenzy
4:17.826 eviscerate Fluffy_Pillow 46.5/100: 46% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), horrific_appendages, blood_frenzy
4:18.831 vanish Fluffy_Pillow 63.4/100: 63% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
4:18.831 shadowstrike Fluffy_Pillow 63.4/100: 63% energy | 0.0/6: 0% combo_points vanish, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
4:19.836 shadowstrike Fluffy_Pillow 60.2/100: 60% energy | 4.0/6: 67% combo_points vanish, subterfuge, symbols_of_death, finality_nightblade(5), blood_frenzy
4:20.842 eviscerate Fluffy_Pillow 57.1/100: 57% energy | 6.0/6: 100% combo_points vanish, subterfuge, symbols_of_death, finality_nightblade(5), blood_frenzy
4:21.847 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5), blood_frenzy
4:21.847 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), blood_frenzy
4:22.850 shadowstrike Fluffy_Pillow 71.8/100: 72% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), blood_frenzy
4:23.853 eviscerate Fluffy_Pillow 43.7/100: 44% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), blood_frenzy
4:24.857 shadowstrike Fluffy_Pillow 60.6/100: 61% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
4:25.861 shadowstrike Fluffy_Pillow 57.4/100: 57% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
4:26.864 nightblade Fluffy_Pillow 28.3/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5)
4:27.869 Waiting 0.100 sec 54.2/100: 54% energy | 0.0/6: 0% combo_points symbols_of_death
4:27.969 backstab Fluffy_Pillow 55.3/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death
4:28.973 Waiting 2.200 sec 31.2/100: 31% energy | 2.0/6: 33% combo_points symbols_of_death
4:31.173 backstab Fluffy_Pillow 55.1/100: 55% energy | 2.0/6: 33% combo_points symbols_of_death
4:33.203 shadowmeld Fluffy_Pillow 42.2/100: 42% energy | 3.0/6: 50% combo_points symbols_of_death, horrific_appendages
4:33.203 shadowstrike Fluffy_Pillow 42.2/100: 42% energy | 3.0/6: 50% combo_points shadowmeld, symbols_of_death, horrific_appendages
4:34.207 eviscerate Fluffy_Pillow 38.1/100: 38% energy | 6.0/6: 100% combo_points symbols_of_death, horrific_appendages
4:35.213 shadow_dance Fluffy_Pillow 94.0/100: 94% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages
4:35.213 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), horrific_appendages
4:35.213 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(6), horrific_appendages
4:36.218 Waiting 0.400 sec 35.9/100: 36% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), horrific_appendages
4:36.618 shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), horrific_appendages
4:37.623 Waiting 2.270 sec 11.2/100: 11% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), horrific_appendages
4:39.893 eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), horrific_appendages
4:40.897 Waiting 0.300 sec 51.8/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, horrific_appendages
4:41.197 backstab Fluffy_Pillow 55.0/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, horrific_appendages
4:42.201 goremaws_bite Fluffy_Pillow 30.9/100: 31% energy | 1.0/6: 17% combo_points symbols_of_death, horrific_appendages
4:43.205 eviscerate Fluffy_Pillow 46.9/100: 47% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, horrific_appendages
4:44.210 backstab Fluffy_Pillow 67.8/100: 68% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages
4:45.213 Waiting 0.600 sec 48.7/100: 49% energy | 1.0/6: 17% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:45.813 backstab Fluffy_Pillow 55.2/100: 55% energy | 1.0/6: 17% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:46.817 Waiting 1.300 sec 36.1/100: 36% energy | 2.0/6: 33% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
4:48.117 backstab Fluffy_Pillow 56.0/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), blood_frenzy
4:49.124 nightblade Fluffy_Pillow 37.9/100: 38% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
4:50.129 shadow_dance Fluffy_Pillow 64.8/100: 65% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:50.129 shadowstrike Fluffy_Pillow 94.8/100: 95% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:51.133 shadowstrike Fluffy_Pillow 66.7/100: 67% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:52.138 eviscerate Fluffy_Pillow 63.5/100: 64% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:53.142 shadowstrike Fluffy_Pillow 80.4/100: 80% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
4:54.146 shadowstrike Fluffy_Pillow 52.3/100: 52% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
4:55.150 Waiting 1.000 sec 24.1/100: 24% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
4:56.150 eviscerate Fluffy_Pillow 35.9/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
4:57.154 Waiting 0.200 sec 52.8/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:57.354 backstab Fluffy_Pillow 55.1/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:58.359 Waiting 2.300 sec 31.0/100: 31% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
5:00.659 backstab Fluffy_Pillow 56.0/100: 56% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
5:01.663 Waiting 0.500 sec 31.9/100: 32% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
5:02.163 eviscerate Fluffy_Pillow 37.3/100: 37% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
5:03.167 shadow_dance Fluffy_Pillow 53.3/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
5:03.167 shadowstrike Fluffy_Pillow 83.3/100: 83% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
5:04.172 shadowstrike Fluffy_Pillow 79.2/100: 79% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8802 8477 0
Agility 27915 26209 15928 (12223)
Stamina 41038 41038 25309
Intellect 5325 5000 0
Spirit 0 0 0
Health 2462280 2462280 0
Energy 100 100 0
Combo Points 6 6 0
Crit 35.00% 35.00% 6651
Haste 8.68% 8.68% 2821
Damage / Heal Versatility 7.81% 6.88% 2750
Attack Power 27915 26209 0
Mastery 77.69% 77.69% 7051
Armor 2236 2236 2236
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Krakentooth Necklace
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Scarred Ragefang Chestpiece
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +918 Mastery, +542 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Wristwraps of Broken Trust
ilevel: 880, stats: { 159 Armor, +1447 Sta, +965 AgiInt, +499 Mastery, +323 Crit }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Ascended Glory
ilevel: 885, stats: { +1516 Sta, +1136 Haste, +957 Crit }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Subtlety_T19M"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=2210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1
spec=subtlety

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=variable,name=ssw_er,value=equipped.shadow_satyrs_walk*(10-floor(target.distance*0.5))
actions+=/variable,name=ed_threshold,value=energy.deficit<=(20+talent.vigor.enabled*35+talent.master_of_shadows.enabled*25+variable.ssw_er)
actions+=/call_action_list,name=cds
actions+=/run_action_list,name=stealthed,if=stealthed|buff.shadowmeld.up
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_cds,if=combo_points.deficit>=2+talent.premeditation.enabled&(variable.ed_threshold|(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)|target.time_to_die<12)
actions+=/call_action_list,name=build,if=variable.ed_threshold

actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/blood_fury,if=stealthed
actions.cds+=/berserking,if=stealthed
actions.cds+=/arcane_torrent,if=stealthed&energy.deficit>70
actions.cds+=/shadow_blades,if=!(stealthed|buff.shadowmeld.up)
actions.cds+=/goremaws_bite,if=!buff.shadow_dance.up&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,target_if=max:target.time_to_die,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

actions.stealth_cds=shadow_dance,if=charges_fractional>=2.65
actions.stealth_cds+=/vanish
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40-variable.ssw_er
actions.stealth_cds+=/shadowmeld,if=energy>=40-variable.ssw_er&energy.deficit>10
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

actions.stealthed=symbols_of_death,if=buff.shadowmeld.down&((buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|(equipped.shadow_satyrs_walk&energy.time_to_max<0.25))
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=krakentooth_necklace,id=141473,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1806
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1806
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=ring_of_ascended_glory,id=142520,bonus_id=3469,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=spontaneous_appendages,id=139325,bonus_id=1806
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/138226/139267,relic_id=1806/1806/1806
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=882.31
# gear_agility=15928
# gear_stamina=25309
# gear_crit_rating=6651
# gear_haste_rating=2821
# gear_mastery_rating=7051
# gear_versatility_rating=2750
# gear_armor=2236

Shaman_Elemental_T19M : 418838 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
418838.1 418838.1 337.3 / 0.081% 58142.0 / 13.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Elemental Mastery (Elemental Shaman)
  • 100: Lightning Rod (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Shaman_Elemental_T19M 418838
Deadly Grace 12563 2.9% 35.1 8.74sec 105700 0 Direct 34.6 80915 161830 107263 32.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.12 34.61 0.00 0.00 0.0000 0.0000 3711895.24 3711895.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.34 67.44% 80914.81 80915 80915 80914.81 80915 80915 1888242 1888242 0.00
crit 11.27 32.56% 161829.61 161830 161830 161829.61 161830 161830 1823653 1823653 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Earth Shock 55122 13.2% 26.2 11.41sec 632686 596295 Direct 26.2 425011 1062431 632685 32.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.18 26.18 0.00 0.00 1.0610 0.0000 16565679.66 16565679.66 0.00 596295.30 596295.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.65 67.42% 425011.10 365157 467061 425024.50 399267 452970 7502573 7502573 0.00
crit 8.53 32.58% 1062431.07 912893 1167654 1062623.01 944738 1167654 9063106 9063106 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:90.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (26698) 0.0% (6.4%) 12.2 23.49sec 656345 617515

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.22 0.00 0.00 0.00 1.0630 0.0000 0.00 0.00 0.00 617515.23 617515.23
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing ${$SPN*0.3*10*(1+{$170374m3=0}/100)} Physical damage over {$d=10 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 26698 6.4% 180.8 1.51sec 44365 0 Direct 180.8 29784 74459 44365 32.6%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 180.79 180.79 0.00 0.00 0.0000 0.0000 8020905.34 8020905.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.79 67.36% 29784.11 27607 30368 29785.73 28225 30368 3627330 3627330 0.00
crit 59.01 32.64% 74459.37 69018 75920 74462.31 70744 75920 4393575 4393575 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing ${$SPN*0.3*10*(1+{$170374m3=0}/100)} Physical damage over {$d=10 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Flame Shock 33454 8.0% 20.5 15.01sec 491227 460285 Direct 20.5 48879 122155 72619 32.4%  
Periodic 215.8 26652 66630 39692 32.6% 98.6%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.46 20.46 215.81 215.81 1.0672 1.3747 10052163.68 10052163.68 0.00 31559.47 460284.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.83 67.60% 48879.14 44810 49290 48876.61 47498 49290 676162 676162 0.00
crit 6.63 32.40% 122155.02 112024 123226 122031.20 0 123226 809896 809896 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 145.4 67.38% 26651.98 196 27111 26650.42 25796 27032 3875518 3875518 0.00
crit 70.4 32.62% 66630.38 490 67777 66625.40 63293 67777 4690587 4690587 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning=3&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 38749 (51738) 9.3% (12.4%) 41.2 7.31sec 377920 305692 Direct 41.1 0 283714 283714 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.15 41.05 0.00 0.00 1.2363 0.0000 11647490.89 11647490.89 0.00 305691.71 305691.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 41.05 100.00% 283713.73 264191 290611 283697.64 275199 289353 11647491 11647491 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lava_surge.up&spell_targets.chain_lightning=3
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 12989 3.1% 16.8 17.24sec 232275 0 Direct 16.8 0 232999 232999 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.81 16.76 0.00 0.00 0.0000 0.0000 3904574.63 3904574.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 16.76 100.00% 232998.71 216952 238648 232985.75 221292 238648 3904575 3904575 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lightning Bolt 67165 (103831) 16.0% (24.8%) 132.6 2.25sec 235185 174627 Direct 132.6 102096 255262 152122 32.7%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.60 132.60 0.00 0.00 1.3468 0.0000 20171572.76 20171572.76 0.00 174626.88 174626.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.29 67.34% 102096.22 75823 250215 102122.71 88972 116511 9116364 9116364 0.00
crit 43.31 32.66% 255261.70 189557 625539 255313.81 204023 319375 11055209 11055209 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 36666 8.8% 85.1 3.91sec 129452 0 Direct 85.1 86779 217401 129448 32.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.08 85.08 0.00 0.00 0.0000 0.0000 11014168.90 11014168.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.29 67.33% 86779.50 63691 210181 86767.30 68613 114644 4971455 4971455 0.00
crit 27.79 32.67% 217401.17 159228 525453 217286.47 169180 319841 6042714 6042714 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lightning Rod 33078 7.9% 175.7 1.74sec 56547 0 Direct 175.7 56545 0 56545 0.0%  

Stats details: lightning_rod

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.71 175.71 0.00 0.00 0.0000 0.0000 9935590.96 9935590.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 175.71 100.00% 56545.46 25476 250215 56541.82 45226 72270 9935591 9935591 0.00
 
 

Action details: lightning_rod

Static Values
  • id:197568
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197568
  • name:Lightning Rod
  • school:nature
  • tooltip:
  • description:{$@spelldesc210689=Your Lightning Bolt and Chain Lightning have a {$s1=30}% chance to make the primary target a Lightning Rod for {$197209d=10 seconds}. Lightning Rods take {$s2=40}% of all damage you deal with Lightning Bolt and Chain Lightning.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:33362.07
  • base_dd_max:33362.07
 
Mark of the Hidden Satyr 8362 2.0% 20.9 14.39sec 120201 0 Direct 20.9 90596 181192 120199 32.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.88 20.88 0.00 0.00 0.0000 0.0000 2509970.53 2509970.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.06 67.32% 90596.21 90596 90596 90596.21 90596 90596 1273590 1273590 0.00
crit 6.82 32.68% 181192.42 181192 181192 181071.61 0 181192 1236380 1236380 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Pepper Breath 4647 1.1% 16.6 18.06sec 84023 0 Periodic 82.3 16969 0 16969 0.0% 6.9%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.61 0.00 82.70 82.26 0.0000 0.2497 1395837.41 1395837.41 0.00 67604.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.3 100.00% 16968.55 136 16990 16969.70 16531 16990 1395837 1395837 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Plague Swarm 14308 3.4% 16.7 17.94sec 257927 0 Periodic 71.8 45087 90163 59865 32.8% 46.8%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.67 0.00 71.81 71.81 0.0000 1.9588 4298671.66 4298671.66 0.00 30562.03 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.3 67.21% 45087.26 23 46002 45105.07 41995 46002 2176072 2176072 0.00
crit 23.5 32.79% 90162.57 46 92005 90198.96 76923 92005 2122600 2122600 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Tormenting Cyclone 5922 1.4% 12.4 23.68sec 143086 0 Direct 85.5 15689 31377 20807 32.6%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.43 85.51 0.00 0.00 0.0000 0.0000 1779267.19 1779267.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.62 67.38% 15688.72 15689 15689 15688.72 15689 15689 903916 903916 0.00
crit 27.90 32.62% 31377.44 31377 31377 31377.44 31377 31377 875351 875351 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Volcanic Inferno 3236 0.8% 30.6 8.56sec 31829 0 Direct 30.6 24009 48019 31829 32.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.55 30.55 0.00 0.00 0.0000 0.0000 972428.63 972428.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.60 67.43% 24009.44 24009 24009 24006.24 0 24009 494609 494609 0.00
crit 9.95 32.57% 48018.87 48019 48019 47954.84 0 48019 477819 477819 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
pet - primal_fire_elemental 145547 / 50756
Fire Blast 126185 10.6% 51.5 5.36sec 257778 139240 Direct 51.5 194435 388870 257781 32.6%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.50 51.50 0.00 0.00 1.8513 0.0000 13275280.58 13275280.58 0.00 139240.00 139240.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.72 67.42% 194435.05 194435 194435 194435.05 194435 194435 6751089 6751089 0.00
crit 16.78 32.58% 388870.10 388870 388870 388870.10 388870 388870 6524192 6524192 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 19362 1.6% 5.4 60.18sec 377951 277706 Direct 5.4 57610 115221 76197 32.3%  
Periodic 60.2 20376 40728 27031 32.7% 35.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 5.39 60.18 60.18 1.3610 1.7918 2037528.41 2037528.41 0.00 17691.95 277705.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.65 67.74% 57610.39 57610 57610 57410.64 0 57610 210383 210383 0.00
crit 1.74 32.26% 115220.77 115221 115221 99395.01 0 115221 200388 200388 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 67.30% 20375.51 520 21604 20385.60 18939 21604 825178 825178 0.00
crit 19.7 32.70% 40728.45 1040 43208 40751.46 32121 43208 801580 801580 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 107892 / 15124
Lightning Blast 107892 3.6% 42.7 6.57sec 106091 113061 Direct 42.7 80014 160029 106091 32.6%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.75 42.75 0.00 0.00 0.9384 0.0000 4535107.44 4535107.44 0.00 113061.11 113061.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.82 67.41% 80014.42 80014 80014 80014.42 80014 80014 2305672 2305672 0.00
crit 13.93 32.59% 160028.85 160029 160029 160028.85 160029 160029 2229435 2229435 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Shaman_Elemental_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shaman_Elemental_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.46sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Elemental Mastery 3.0 120.48sec

Stats details: elemental_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:16166
  • name:Elemental Mastery
  • school:nature
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
 
Fire Elemental 2.0 236.12sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.98 0.00 0.00 0.00 1.0099 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shaman_Elemental_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.3 62.01sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 0.00 0.00 0.8357 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 111.66sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.24 0.00 0.00 0.00 0.5291 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.1 0.0 180.5sec 180.5sec 6.83% 6.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 21.07% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Echoes of the Great Sundering 12.3 0.0 23.5sec 23.5sec 5.68% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_echoes_of_the_great_sundering
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • echoes_of_the_great_sundering_1:5.68%

Trigger Attempt Success

  • trigger_pct:46.99%

Spelldata details

  • id:208723
  • name:Echoes of the Great Sundering
  • tooltip:Your next Earthquake Totem is free and deals {$s2=100}% increased damage.
  • description:{$@spelldesc208722=Earth Shock has up to a {$s1=50}% chance, based on Maelstrom spent, to cause your next Earthquake Totem to be free and deal {$208723s2=100}% increased damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Elemental Focus 64.7 82.7 4.6sec 2.0sec 82.28% 79.14% 82.7(112.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:20.75%
  • elemental_focus_2:61.53%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Elemental Mastery 3.0 0.0 120.5sec 120.5sec 19.30% 26.85% 0.0(0.0) 2.8

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_elemental_mastery
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.83

Stack Uptimes

  • elemental_mastery_1:19.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:16166
  • name:Elemental Mastery
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Ember Totem 1.0 2.2 0.0sec 111.7sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.6 0.9 14.2sec 13.5sec 8.76% 54.13% 0.9(0.9) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.76%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 272.9sec 0.0sec 18.81% 18.81% 0.0(0.0) 1.2

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:18.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power of the Maelstrom 5.8 0.3 44.2sec 41.5sec 12.69% 13.28% 0.3(0.6) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:3.78%
  • power_of_the_maelstrom_2:3.69%
  • power_of_the_maelstrom_3:5.22%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 111.7sec 100.00% 100.00% 301.5(301.5) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 111.7sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.3 0.0 62.1sec 62.0sec 6.23% 6.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:2.47%
  • stormkeeper_2:2.39%
  • stormkeeper_3:1.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 111.7sec 100.00% 95.98% 2.2(2.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper1.2550.0017.6084.7710.00017.219
Fire Elemental0.5070.0011.9110.0980.0001.911
Elemental Mastery0.5900.0012.4240.9640.0004.074
Lava Burst0.9250.0016.65435.30315.80163.531

Resources

Resource Usage Type Count Total Average RPE APR
Shaman_Elemental_T19M
earth_shock Maelstrom 26.2 2452.1 93.7 93.7 6755.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 41.15 486.84 (19.54%) 11.83 6.98 1.41%
Lava Burst Overload Maelstrom 16.81 142.84 (5.73%) 8.50 8.45 5.58%
Lightning Bolt Maelstrom 132.60 1058.78 (42.49%) 7.98 2.03 0.19%
Lightning Bolt Overload Maelstrom 85.08 506.23 (20.31%) 5.95 4.28 0.84%
Resonance Totem Maelstrom 299.25 297.37 (11.93%) 0.99 1.88 0.63%
Resource RPS-Gain RPS-Loss
Maelstrom 8.29 8.15
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 40.44 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Lava Surge 21.4 13.5sec
Lava Surge: Wasted 0.9 86.9sec
Lava Surge: During Lava Burst 2.1 76.9sec

Statistics & Data Analysis

Fight Length
Sample Data Shaman_Elemental_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Shaman_Elemental_T19M Damage Per Second
Count 7499
Mean 418838.09
Minimum 371760.85
Maximum 480687.24
Spread ( max - min ) 108926.40
Range [ ( max - min ) / 2 * 100% ] 13.00%
Standard Deviation 14902.3904
5th Percentile 395004.78
95th Percentile 444040.53
( 95th Percentile - 5th Percentile ) 49035.76
Mean Distribution
Standard Deviation 172.0895
95.00% Confidence Intervall ( 418500.80 - 419175.37 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4863
0.1 Scale Factor Error with Delta=300 1895813
0.05 Scale Factor Error with Delta=300 7583252
0.01 Scale Factor Error with Delta=300 189581320
Priority Target DPS
Sample Data Shaman_Elemental_T19M Priority Target Damage Per Second
Count 7499
Mean 418838.09
Minimum 371760.85
Maximum 480687.24
Spread ( max - min ) 108926.40
Range [ ( max - min ) / 2 * 100% ] 13.00%
Standard Deviation 14902.3904
5th Percentile 395004.78
95th Percentile 444040.53
( 95th Percentile - 5th Percentile ) 49035.76
Mean Distribution
Standard Deviation 172.0895
95.00% Confidence Intervall ( 418500.80 - 419175.37 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4863
0.1 Scale Factor Error with Delta=300 1895813
0.05 Scale Factor Error with Delta=300 7583252
0.01 Scale Factor Error with Delta=300 189581320
DPS(e)
Sample Data Shaman_Elemental_T19M Damage Per Second (Effective)
Count 7499
Mean 418838.09
Minimum 371760.85
Maximum 480687.24
Spread ( max - min ) 108926.40
Range [ ( max - min ) / 2 * 100% ] 13.00%
Damage
Sample Data Shaman_Elemental_T19M Damage
Count 7499
Mean 105980217.46
Minimum 76523736.73
Maximum 140652485.39
Spread ( max - min ) 64128748.67
Range [ ( max - min ) / 2 * 100% ] 30.26%
DTPS
Sample Data Shaman_Elemental_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaman_Elemental_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shaman_Elemental_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaman_Elemental_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaman_Elemental_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaman_Elemental_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Shaman_Elemental_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Shaman_Elemental_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,name=fishbrul_special
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 stormkeeper
6 0.00 totem_mastery
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
7 1.00 potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
8 0.00 totem_mastery,if=buff.resonance_totem.remains<2
9 1.98 fire_elemental
0.00 storm_elemental
A 3.00 elemental_mastery
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
B 2.06 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
C 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
D 0.00 run_action_list,name=single
actions.single
# count action,conditions
0.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
E 5.04 flame_shock,if=!ticking
0.00 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
F 16.88 earth_shock,if=maelstrom>=92
0.00 icefury,if=raid_event.movement.in<5
G 41.24 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
0.00 elemental_blast
H 12.22 earthquake,if=buff.echoes_of_the_great_sundering.up
I 15.42 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
0.00 frost_shock,moving=1,if=buff.icefury.up
J 9.31 earth_shock,if=maelstrom>=86
0.00 icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 4.35 stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
L 2.24 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
M 4.51 lightning_bolt,if=buff.power_of_the_maelstrom.up,target_if=!debuff.lightning_rod.up
N 13.15 lightning_bolt,if=buff.power_of_the_maelstrom.up
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
O 24.89 lightning_bolt,target_if=!debuff.lightning_rod.up
P 90.57 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1

Sample Sequence

024569ABEGOGOOOOJHGOGMINNJPPPGPPPFPPPPGINGFHNGNNNPFPGIPPPOOFGPIPKPPOGPFHPPIGPPPPFPGGIOPGFHPPPGIOGOGFGHLPPPIGJAPKPPPPGPJPPPPPEGGFNMMOGJHGEOGOGOPFHPGIPPPOOGFHOBOEGKOPPJHPGPGIPOFOGOOOOIOGFOPPPGLIGPP9FPGPPPPIAGPJPKGNNNPJPPGPEPPFHPGPPIPGFPGPP7OOPGFPEPPPGPPPFHP

Sample Sequence Table

time name target resources buffs
Pre flask Shaman_Elemental_T19M 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre augmentation Shaman_Elemental_T19M 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom potion_of_deadly_grace
Pre stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), potion_of_deadly_grace
Pre totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.000 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.882 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.882 berserking Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:00.882 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, berserking, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:01.637 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, berserking, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:02.489 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom bloodlust, berserking, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:03.243 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom bloodlust, berserking, lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:03.998 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom bloodlust, berserking, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:04.751 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom bloodlust, berserking, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:05.505 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom bloodlust, berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:06.359 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom bloodlust, berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:07.213 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom bloodlust, berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:07.969 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/100: 6% maelstrom bloodlust, berserking, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering, potion_of_deadly_grace
0:08.722 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom bloodlust, berserking, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:09.476 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom bloodlust, berserking, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:10.331 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom bloodlust, berserking, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:11.116 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:12.096 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:12.852 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/100: 57% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:13.832 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:14.814 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/100: 87% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:15.568 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:16.549 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/100: 22% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:17.529 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:18.510 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:19.492 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:20.473 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:21.454 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/100: 77% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:22.630 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:23.512 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:24.686 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:25.861 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:27.036 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/100: 47% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:28.213 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:29.388 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:30.273 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:31.448 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:32.329 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:33.211 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
0:34.092 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:35.267 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:36.149 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:37.325 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:38.499 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:39.674 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:40.851 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/100: 96% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:41.998 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:43.524 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:45.051 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:46.198 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:47.724 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:49.253 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:50.780 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:52.309 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:53.835 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:54.981 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:56.508 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:58.036 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.183 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.710 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.859 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.005 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.152 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/100: 61% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.298 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.824 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.351 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.498 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:10.645 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.171 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/100: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.699 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.846 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.373 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.900 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.429 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.956 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.485 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.632 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.160 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.689 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.837 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.985 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.511 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.040 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.187 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.333 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:35.479 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.006 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.534 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:40.063 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:41.590 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:42.738 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/100: 57% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:44.266 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/100: 67% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:45.412 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.938 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.084 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.230 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:50.375 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:51.521 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.286 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:53.815 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.343 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:56.870 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.017 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.544 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.690 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.882 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:02.156 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:03.112 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:04.068 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:05.024 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/100: 35% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:05.980 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:07.254 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:08.211 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:09.484 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/100: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:10.439 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:11.714 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:12.987 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:14.260 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:15.533 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:16.806 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:17.763 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/100: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:19.036 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:19.994 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/100: 96% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:20.964 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.491 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.018 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.546 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.071 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.599 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.746 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
2:30.892 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.038 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.184 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.713 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.860 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.389 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.533 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.061 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/100: 77% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.589 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.734 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
2:43.881 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.409 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.936 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.082 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.609 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.137 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.664 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/100: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.192 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.720 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.868 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/100: 99% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.013 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
2:59.160 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.687 berserking Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.882 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.210 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom berserking, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.207 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/100: 28% maelstrom berserking, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.203 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom berserking, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.198 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom berserking, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.197 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom berserking, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.194 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom berserking, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.190 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/100: 90% maelstrom berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.188 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom berserking, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
3:10.185 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom berserking, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.514 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.659 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.185 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.331 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.476 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.004 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.531 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.678 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.206 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.734 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.260 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.786 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.314 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.841 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.989 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.518 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.044 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/100: 98% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.191 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.717 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.246 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.773 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.302 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.449 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.215 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.362 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.507 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/100: 67% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.035 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.563 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.709 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.856 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.384 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.911 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.438 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.966 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.494 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.023 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.169 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.169 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:02.125 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/100: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:03.398 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/100: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:04.353 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:05.627 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:06.583 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/100: 18% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:07.542 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:08.499 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:09.454 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/100: 67% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:10.410 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:11.683 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/100: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:12.639 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:13.911 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:15.185 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:16.459 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:17.732 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:18.689 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:19.962 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:21.238 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.382 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
4:23.526 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/100: 3% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.054 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.581 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.108 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.634 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.780 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/100: 67% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.307 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.453 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.599 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.125 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.273 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.800 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.328 potion Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.328 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:41.856 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:43.383 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:44.911 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:46.439 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:47.586 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:49.112 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:50.258 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/100: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:51.785 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/100: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:53.311 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:54.839 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:56.366 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:57.894 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:59.422 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
5:00.951 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
5:02.098 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering, potion_of_deadly_grace
5:03.242 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 9357 9032 0
Stamina 42217 42217 26216
Intellect 39146 37440 28334 (14046)
Spirit 1 1 0
Health 2533020 2533020 0
Mana 220000 220000 0
Maelstrom 100 100 0
Spell Power 39146 37440 0
Crit 32.67% 32.67% 9685
Haste 28.70% 28.70% 5524
Damage / Heal Versatility 2.20% 2.20% 880
Attack Power 9357 9032 0
Mastery 40.95% 40.95% 3570
Armor 2774 2774 2774
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 884.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Echoes of the Great Sundering
ilevel: 895, stats: { 357 Armor, +2219 Sta, +1479 AgiInt, +496 Haste, +662 Mastery }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist Laughing Sister's Pouch-Chain
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 AgiInt, +783 Crit, +312 Haste }
Local Legs Disjointed Linkage Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +886 Haste, +574 Crit }
Local Feet Scored Ironclaw Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +689 Crit, +406 Haste }
Local Wrists Manacles of the Nightmare Colossus
ilevel: 880, stats: { 199 Armor, +1447 Sta, +965 AgiInt, +481 Haste, +340 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Crit }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Crit }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 906, weapon: { 2776 - 5157, 2.6 }, stats: { +937 Int, +1405 Sta, +350 Crit, +337 Mastery, +11921 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 906, stats: { +1230 Int, +1844 Sta, +460 Crit, +442 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Elemental Blast (Elemental Shaman) Ancestral Swiftness Echo of the Elements
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Icefury (Elemental Shaman)
90 Elemental Mastery (Elemental Shaman) Storm Elemental (Elemental Shaman) Aftershock (Elemental Shaman)
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Liquid Magma Totem (Elemental Shaman)

Profile

shaman="Shaman_Elemental_T19M"
level=110
race=troll
role=spell
position=ranged_back
talents=3112212
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:3:299:3:300:3:301:3:302:3:303:3:304:3:305:3:306:3:1350:1
spec=elemental

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,name=fishbrul_special
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/stormkeeper
actions.precombat+=/totem_mastery

# Executed every time the actor is available.
actions=bloodlust,if=target.health.pct<25|time>0.500
actions+=/potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning=3&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=buff.lava_surge.up&spell_targets.chain_lightning=3
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=!debuff.lightning_rod.up
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single+=/flame_shock,if=!ticking
actions.single+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
actions.single+=/earth_shock,if=maelstrom>=92
actions.single+=/icefury,if=raid_event.movement.in<5
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single+=/elemental_blast
actions.single+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single+=/frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
actions.single+=/frost_shock,moving=1,if=buff.icefury.up
actions.single+=/earth_shock,if=maelstrom>=86
actions.single+=/icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
actions.single+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single+=/stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
actions.single+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single+=/lightning_bolt,if=buff.power_of_the_maelstrom.up,target_if=!debuff.lightning_rod.up
actions.single+=/lightning_bolt,if=buff.power_of_the_maelstrom.up
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single+=/lightning_bolt,target_if=!debuff.lightning_rod.up
actions.single+=/lightning_bolt
actions.single+=/flame_shock,moving=1,target_if=refreshable
actions.single+=/earth_shock,moving=1

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=echoes_of_the_great_sundering,id=137074
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=binding_of_intellect
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=manacles_of_the_nightmare_colossus,id=139222,bonus_id=1806
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1806
waist=laughing_sisters_pouchchain,id=139211,bonus_id=1806
legs=disjointed_linkage_leggings,id=139216,bonus_id=1806
feet=scored_ironclaw_sabatons,id=139220,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant_id=5427
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant_id=5427
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=139264/139259/139264,relic_id=1806/1806/1806
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=884.19
# gear_stamina=26216
# gear_intellect=28334
# gear_crit_rating=9685
# gear_haste_rating=5524
# gear_mastery_rating=3570
# gear_versatility_rating=880
# gear_armor=2774

Warrior_Arms_T19M : 509507 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
509507.1 509507.1 583.6 / 0.115% 101565.7 / 19.9% 40905.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.4 12.4 Rage 2.21% 91.4 100.0% 100%
Talents
  • 15: Dauntless (Arms Warrior)
  • 30: Double Time
  • 45: Avatar
  • 60: Bounding Stride
  • 75: Focused Rage (Arms Warrior)
  • 90: Deadly Calm (Arms Warrior)
  • 100: Anger Management
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Warrior_Arms_T19M 509507
auto_attack_mh 28624 5.6% 99.3 3.05sec 86568 28786 Direct 99.3 64411 129243 86568 34.2%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.35 99.35 0.00 0.00 3.0072 0.0000 8600407.00 12643412.94 31.98 28786.43 28786.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.40 65.82% 64411.44 33019 77788 64419.49 57060 68792 4212255 6192414 31.98
crit 33.95 34.18% 129242.56 66039 155577 129288.79 108432 141615 4388152 6450999 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bladestorm 0 (2907) 0.0% (0.6%) 2.0 123.02sec 433619 222262

Stats details: bladestorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.02 0.00 6.10 0.00 1.9512 0.5624 0.00 0.00 0.00 222261.71 222261.71
 
 

Action details: bladestorm

Static Values
  • id:227847
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:227847
  • name:Bladestorm
  • school:physical
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Bladestorm (_mh) 2907 0.6% 0.0 0.00sec 0 0 Direct 6.1 120914 241797 143417 18.6%  

Stats details: bladestorm_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.10 0.00 0.00 0.0000 0.0000 875044.37 1286398.11 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.97 81.38% 120914.46 73415 172953 119330.28 0 172953 600365 882593 31.38
crit 1.14 18.62% 241796.81 146829 345907 164199.88 0 345907 274679 403805 21.70
 
 

Action details: bladestorm_mh

Static Values
  • id:50622
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50622
  • name:Bladestorm
  • school:physical
  • tooltip:
  • description:You become a whirling storm of destructive force, striking all nearby targets with your main hand weapon for $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.35
 
Colossus Smash 63531 12.5% 54.2 5.62sec 351716 277496 Direct 54.2 275244 542117 351717 28.7%  

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.23 54.23 0.00 0.00 1.2675 0.0000 19073655.27 28040079.95 31.98 277495.53 277495.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.69 71.35% 275244.32 142728 336245 274716.89 239123 299001 10649326 15655518 31.98
crit 15.54 28.65% 542116.69 285457 672490 541237.71 400818 627657 8424329 12384562 31.98
 
 

Action details: colossus_smash

Static Values
  • id:167105
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:167105
  • name:Colossus Smash
  • school:physical
  • tooltip:
  • description:Smashes the enemy's armor, dealing $sw1 Physical damage, and increasing damage you deal to them by {$208086s3=15}% for {$208086d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.52
 
Corrupted Blood of Zakajz 42137 8.3% 0.0 0.00sec 0 0 Periodic 60.7 208191 0 208191 0.0% 40.4%

Stats details: corrupted_blood_of_zakajz

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 60.75 60.75 0.0000 2.0000 12647131.19 12647131.19 0.00 104095.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.7 100.00% 208191.24 16205 404023 208557.22 131792 263440 12647131 12647131 0.00
 
 

Action details: corrupted_blood_of_zakajz

Static Values
  • id:209569
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209569
  • name:Corrupted Blood of Zakajz
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t sec.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:50.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Execute 62176 12.2% 26.7 2.12sec 698760 528369 Direct 26.7 428209 912792 698768 55.8%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.74 26.74 0.00 0.00 1.3225 0.0000 18687880.97 27472955.19 31.98 528368.94 528368.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.81 44.17% 428208.62 50502 618666 428437.83 207547 523487 5058124 7435921 31.98
crit 14.93 55.83% 912792.35 102266 1237333 912098.34 579820 1089804 13629757 20037034 31.98
 
 

Action details: execute

Static Values
  • id:163201
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stone_heart.react
Spelldata
  • id:163201
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempts to finish off a foe, causing $sw2 Physical damage, and consuming up to $m4 additional Rage to deal up to ${$sw2*$m4/10} additional damage. Only usable on enemies that have less than 20% health.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.62
 
Horrific Slam 23676 4.7% 119.5 2.18sec 59548 0 Direct 119.5 44449 89101 59548 33.8%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.48 119.48 0.00 0.00 0.0000 0.0000 7114697.79 7114697.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.08 66.19% 44448.94 22636 53327 44465.05 31981 52282 3515057 3515057 0.00
crit 40.40 33.81% 89101.22 45273 106655 89062.81 61465 106655 3599641 3599641 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Mortal Strike 174757 34.3% 64.3 4.61sec 816020 645589 Direct 64.3 492490 1061683 816010 56.8%  

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.33 64.33 0.00 0.00 1.2640 0.0000 52495447.60 77173280.48 31.98 645589.29 645589.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.76 43.16% 492489.58 117230 682151 492839.93 363653 592180 13673739 20101691 31.98
crit 36.57 56.84% 1061683.11 234460 1364302 1061887.87 889350 1181806 38821709 57071589 31.98
 
 

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals ${$sw3*$<mult>} Physical damage and reduces the effectiveness of healing on the target for {$115804d=10 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
Potion of the Old War 29529 5.7% 23.4 12.96sec 373707 0 Direct 23.4 270134 558138 373699 36.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.39 23.39 0.00 0.00 0.0000 0.0000 8739331.46 12847645.06 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.98 64.04% 270133.71 130700 307909 269943.06 185493 307909 4045416 5947145 31.98
crit 8.41 35.96% 558137.63 261400 615817 558535.91 379539 615817 4693915 6900500 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Wave 19867 3.9% 13.2 19.72sec 451540 0 Direct 13.2 332077 672173 451557 35.1%  

Stats details: shadow_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.21 13.21 0.00 0.00 0.0000 0.0000 5965282.33 5965282.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.57 64.87% 332077.35 170539 401763 331525.77 0 401763 2845942 2845942 0.00
crit 4.64 35.13% 672173.12 341078 803525 659867.56 0 803525 3119340 3119340 0.00
 
 

Action details: shadow_wave

Static Values
  • id:215047
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215047
  • name:Shadow Wave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc215089=Your melee attacks have a chance to unleash 4 Shadow Waves that deal {$s1=78543} Shadow damage to enemies in their path. The waves travel 15 yards away from you, and then return.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:150798.04
  • base_dd_max:150798.04
 
Slam 56468 11.1% 78.6 3.07sec 216026 171266 Direct 78.6 158914 313294 216028 37.0%  

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.55 78.55 0.00 0.00 1.2614 0.0000 16969022.51 24946070.44 31.98 171265.87 171265.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.49 63.00% 158914.01 81023 190878 159049.54 131697 171790 7864765 11561949 31.98
crit 29.06 37.00% 313293.63 162046 381755 313817.05 251018 351814 9104258 13384121 31.98
 
 

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Warbreaker 5835 1.1% 4.4 70.36sec 401894 320498 Direct 4.4 303443 623217 401901 30.8%  

Stats details: warbreaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.36 0.00 0.00 1.2541 0.0000 1751203.59 1751203.59 0.00 320498.46 320498.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.02 69.22% 303443.09 160400 377878 301846.16 0 377878 915231 915231 0.00
crit 1.34 30.78% 623216.62 320801 755756 505984.10 0 755756 835973 835973 0.00
 
 

Action details: warbreaker

Static Values
  • id:209577
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:209577
  • name:Warbreaker
  • school:shadow
  • tooltip:
  • description:Stomp the ground, causing a ring of corrupted spikes to erupt upwards, dealing $sw1 Shadow damage and applying the Colossus Smash effect to all nearby enemies.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Simple Action Stats Execute Interval
Warrior_Arms_T19M
Arcane Torrent 3.7 91.24sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:69179
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.down&rage.deficit>40
Spelldata
  • id:69179
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and increase your Rage by {$/10;s2=15}. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T19M
  • harmful:false
  • if_expr:
 
Avatar 3.8 90.02sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 11.3 27.66sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:17.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T19M
  • harmful:false
  • if_expr:
 
Focused Rage 196.0 1.49sec

Stats details: focused_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: focused_rage

Static Values
  • id:207982
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
Spelldata
  • id:207982
  • name:Focused Rage
  • school:physical
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T19M
  • harmful:false
  • if_expr:
 
Heroic Leap 10.2 30.97sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.18 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 3.8 0.0 90.0sec 90.0sec 24.44% 24.44% 0.0(0.0) 3.6

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:24.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 11.3 0.0 27.7sec 27.7sec 18.68% 18.68% 0.0(0.0) 11.1

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:18.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bladestorm 2.0 0.0 123.3sec 123.3sec 1.14% 1.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_bladestorm
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladestorm_1:1.14%

Trigger Attempt Success

  • trigger_pct:98.29%

Spelldata details

  • id:227847
  • name:Bladestorm
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
  • max_stacks:0
  • duration:6.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupted Blood of Zakajz 11.3 0.0 27.7sec 27.7sec 18.68% 19.84% 0.0(0.0) 11.1

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_corrupted_blood_of_zakajz
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • corrupted_blood_of_zakajz_1:18.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209567
  • name:Corrupted Blood of Zakajz
  • tooltip:An additional {$s1=20}% of all damage dealt will be done to your enemies over {$209569d=6 seconds}.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Rage 63.3 132.6 4.6sec 1.5sec 73.49% 97.41% 29.8(29.8) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_focused_rage
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • focused_rage_1:32.76%
  • focused_rage_2:21.80%
  • focused_rage_3:18.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207982
  • name:Focused Rage
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
  • max_stacks:3
  • duration:30.00
  • cooldown:1.50
  • default_chance:100.00%
Horrific Appendages 6.2 2.2 47.2sec 33.6sec 30.45% 30.45% 121.7(121.7) 5.9

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 256.2sec 0.0sec 16.22% 16.22% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Precise Strikes 58.6 0.0 5.2sec 5.2sec 30.19% 30.19% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_precise_strikes
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.60

Stack Uptimes

  • precise_strikes_1:30.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209493
  • name:Precise Strikes
  • tooltip:
  • description:{$@spelldesc209492=Colossus Smash reduces the Rage cost of your next Mortal Strike or Execute by {$s1=15}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shattered Defenses 58.6 0.0 5.2sec 5.2sec 30.19% 64.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_shattered_defenses
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • shattered_defenses_1:30.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209706
  • name:Shattered Defenses
  • tooltip:Damage and critical strike chance of your next Mortal Strike or Execute increased by {$s1=30}%.
  • description:{$@spelldesc209574=After using Colossus Smash, your next Mortal Strike or Execute gains {$209706s1=30}% increased critical strike chance and deals {$209706s2=30}% additional damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Battle Cry1.4740.0019.2638.4870.00026.288
Avatar0.7770.0012.1560.0340.0002.156
Heroic Leap1.0900.00123.5938.7791.61644.646
Focused Rage4.0930.00138.37344.51617.74584.063
Colossus Smash1.0760.0016.76656.89525.10798.238
Warbreaker11.1020.001155.33534.8140.000155.335
Mortal Strike1.4600.00114.62792.09843.344152.146
Bladestorm34.6520.001221.58534.4520.000221.585

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Arms_T19M
execute Rage 26.7 513.4 19.2 19.2 36400.3
focused_rage Rage 196.0 1843.6 9.4 9.4 0.0
mortal_strike Rage 64.3 408.6 6.4 6.4 128462.3
slam Rage 78.6 972.7 12.4 12.4 17445.8
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 20.00 (0.53%) 20.00 0.00 0.00%
arcane_torrent Rage 3.73 55.93 (1.47%) 15.00 0.00 0.00%
archavons_heavy_hand Rage 64.33 942.46 (24.75%) 14.65 22.49 2.33%
melee_crit Rage 33.95 1179.69 (30.97%) 34.75 73.24 5.85%
melee_main_hand Rage 65.40 1610.57 (42.29%) 24.63 37.42 2.27%
Resource RPS-Gain RPS-Loss
Rage 12.66 12.43
Combat End Resource Mean Min Max
Rage 70.47 0.00 130.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 3.1%

Procs

Count Interval
tactician 61.7 4.9sec

Statistics & Data Analysis

Fight Length
Sample Data Warrior_Arms_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Warrior_Arms_T19M Damage Per Second
Count 7499
Mean 509507.08
Minimum 397763.18
Maximum 599125.26
Spread ( max - min ) 201362.09
Range [ ( max - min ) / 2 * 100% ] 19.76%
Standard Deviation 25786.3163
5th Percentile 467197.07
95th Percentile 551828.60
( 95th Percentile - 5th Percentile ) 84631.53
Mean Distribution
Standard Deviation 297.7746
95.00% Confidence Intervall ( 508923.45 - 510090.70 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 98
0.1% Error 9839
0.1 Scale Factor Error with Delta=300 5676260
0.05 Scale Factor Error with Delta=300 22705040
0.01 Scale Factor Error with Delta=300 567626000
Priority Target DPS
Sample Data Warrior_Arms_T19M Priority Target Damage Per Second
Count 7499
Mean 509507.08
Minimum 397763.18
Maximum 599125.26
Spread ( max - min ) 201362.09
Range [ ( max - min ) / 2 * 100% ] 19.76%
Standard Deviation 25786.3163
5th Percentile 467197.07
95th Percentile 551828.60
( 95th Percentile - 5th Percentile ) 84631.53
Mean Distribution
Standard Deviation 297.7746
95.00% Confidence Intervall ( 508923.45 - 510090.70 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 98
0.1% Error 9839
0.1 Scale Factor Error with Delta=300 5676260
0.05 Scale Factor Error with Delta=300 22705040
0.01 Scale Factor Error with Delta=300 567626000
DPS(e)
Sample Data Warrior_Arms_T19M Damage Per Second (Effective)
Count 7499
Mean 509507.08
Minimum 397763.18
Maximum 599125.26
Spread ( max - min ) 201362.09
Range [ ( max - min ) / 2 * 100% ] 19.76%
Damage
Sample Data Warrior_Arms_T19M Damage
Count 7499
Mean 152919104.08
Minimum 102606665.38
Maximum 203483985.99
Spread ( max - min ) 100877320.61
Range [ ( max - min ) / 2 * 100% ] 32.98%
DTPS
Sample Data Warrior_Arms_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Warrior_Arms_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Warrior_Arms_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Warrior_Arms_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Warrior_Arms_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Warrior_Arms_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Warrior_Arms_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Warrior_Arms_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
0.00 blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
0.00 berserking,if=buff.battle_cry.up|target.time_to_die<=11
8 3.73 arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
9 11.30 battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
A 3.80 avatar,if=(buff.bloodlust.up|time>=1)
B 10.18 heroic_leap,if=debuff.colossus_smash.up
0.00 rend,if=remains<gcd
C 39.09 focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
D 7.87 colossus_smash,if=debuff.colossus_smash.down
E 0.78 warbreaker,if=debuff.colossus_smash.down
0.00 ravager
0.00 overpower,if=buff.overpower.react
F 0.00 run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
G 0.00 run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
H 0.00 run_action_list,name=execute,if=target.health.pct<=20
I 0.00 run_action_list,name=single,if=target.health.pct>20
actions.execute
# count action,conditions
J 1.88 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
K 4.82 execute,if=buff.battle_cry_deadly_calm.up
L 8.60 colossus_smash,if=buff.shattered_defenses.down
M 0.27 warbreaker,if=buff.shattered_defenses.down&rage<=30
N 9.28 execute,if=buff.shattered_defenses.up&rage>22
O 3.28 mortal_strike,if=equipped.archavons_heavy_hand&rage<60
P 12.65 execute,if=buff.shattered_defenses.down
Q 0.15 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single
# count action,conditions
R 4.52 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
S 37.76 colossus_smash,if=buff.shattered_defenses.down
T 3.30 warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
U 66.68 focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
V 54.65 mortal_strike
0.00 execute,if=buff.stone_heart.react
W 78.55 slam
0.00 execute,if=equipped.archavons_heavy_hand
X 90.19 focused_rage,if=equipped.archavons_heavy_hand
Y 1.87 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

Sample Sequence

0124568ADUX9BVCSCVCWCWXSXVUWXSUVUWUWUTXVUWUWXWXVXYWXXDXVXX9WCWCWCVCRXDUBWUWXVUWUWXSXVUWUWXSXVXWXWVXXW9CWCWCVCWXDUVXSUVUBWXSUVXSUVXSUVUSUVXSUVUWXSUVUWXSU9VCSCVCWXSUVAXSUBVUWUWU8TXVUWUWUSXVUWXWXSXVXWXSX9VCSCWCWXVUWUSUVUBWUWXSXVUWXSXVXWXWXYXVXDX9VCWCWCWCVXSUVXSUWUVXBSUWUVXSUVUWUWUTXVUWXSU9VCWCWCRCSUWUWXVXSUWUAWXVUBWXWX8WXVXWXWX9VCXDCVCWUWUWXVUWXDXVXWXWXWXVXXWXVXXD9BCVCWCWCTXVUWUWUWXVXWXWXDXYVXXSXVXSXVXWXSX9VCWCB7KCKLNPPLNLNPLNPALNPOP8LNP9CKCBKCJCKDNPPPLNPOLNOPPP

Sample Sequence Table

time name target resources buffs
Pre flask Warrior_Arms_T19M 0.0/130: 0% rage
Pre food Warrior_Arms_T19M 0.0/130: 0% rage
Pre augmentation Warrior_Arms_T19M 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 charge Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 20.0/130: 15% rage bloodlust, potion_of_the_old_war
0:00.000 arcane_torrent Fluffy_Pillow 45.2/130: 35% rage bloodlust, potion_of_the_old_war
0:00.000 avatar Fluffy_Pillow 60.2/130: 46% rage bloodlust, potion_of_the_old_war
0:00.000 colossus_smash Fluffy_Pillow 60.2/130: 46% rage bloodlust, avatar, potion_of_the_old_war
0:00.000 focused_rage Fluffy_Pillow 48.2/130: 37% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.014 focused_rage Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.017 battle_cry Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.017 heroic_leap Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:01.017 mortal_strike Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:02.028 focused_rage Fluffy_Pillow 51.2/130: 39% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:02.034 colossus_smash Fluffy_Pillow 51.2/130: 39% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:03.042 focused_rage Fluffy_Pillow 88.4/130: 68% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:03.051 mortal_strike Fluffy_Pillow 88.4/130: 68% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:04.056 focused_rage Fluffy_Pillow 103.4/130: 80% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:04.069 slam Fluffy_Pillow 103.4/130: 80% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:05.070 focused_rage Fluffy_Pillow 130.0/130: 100% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
0:05.087 slam Fluffy_Pillow 130.0/130: 100% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
0:06.084 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:06.106 colossus_smash Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:07.098 focused_rage Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:07.124 mortal_strike Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:08.112 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:08.142 slam Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:09.126 focused_rage Fluffy_Pillow 90.0/130: 69% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:09.159 colossus_smash Fluffy_Pillow 90.0/130: 69% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:10.140 focused_rage Fluffy_Pillow 103.2/130: 79% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:10.178 mortal_strike Fluffy_Pillow 103.2/130: 79% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:11.154 focused_rage Fluffy_Pillow 99.8/130: 77% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:11.196 slam Fluffy_Pillow 99.8/130: 77% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:12.168 focused_rage Fluffy_Pillow 71.8/130: 55% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:12.215 slam Fluffy_Pillow 97.0/130: 75% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:13.182 focused_rage Fluffy_Pillow 69.0/130: 53% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:13.233 warbreaker Fluffy_Pillow 69.0/130: 53% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:14.196 focused_rage Fluffy_Pillow 57.0/130: 44% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:14.252 mortal_strike Fluffy_Pillow 57.0/130: 44% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:15.210 focused_rage Fluffy_Pillow 78.8/130: 61% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:15.272 slam Fluffy_Pillow 78.8/130: 61% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:16.224 focused_rage Fluffy_Pillow 50.8/130: 39% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:16.290 slam Fluffy_Pillow 50.8/130: 39% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:17.238 focused_rage Fluffy_Pillow 48.0/130: 37% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:17.308 slam Fluffy_Pillow 48.0/130: 37% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:18.252 focused_rage Fluffy_Pillow 20.0/130: 15% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:18.325 mortal_strike Fluffy_Pillow 20.0/130: 15% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:19.266 focused_rage Fluffy_Pillow 7.0/130: 5% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:19.344 bladestorm Fluffy_Pillow 7.0/130: 5% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:21.006 slam Fluffy_Pillow 32.2/130: 25% rage bloodlust, focused_rage, potion_of_the_old_war
0:21.006 focused_rage Fluffy_Pillow 4.2/130: 3% rage bloodlust, focused_rage(2), potion_of_the_old_war
0:22.020 focused_rage Fluffy_Pillow 17.4/130: 13% rage bloodlust, focused_rage(3), potion_of_the_old_war
0:22.023 colossus_smash Fluffy_Pillow 17.4/130: 13% rage bloodlust, focused_rage(3), potion_of_the_old_war
0:23.034 focused_rage Fluffy_Pillow 5.4/130: 4% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:23.041 Waiting 1.300 sec 5.4/130: 4% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:24.341 mortal_strike Fluffy_Pillow 42.6/130: 33% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:24.341 focused_rage Fluffy_Pillow 39.2/130: 30% rage bloodlust, focused_rage
0:25.355 focused_rage Fluffy_Pillow 27.2/130: 21% rage bloodlust, focused_rage(2)
0:25.359 battle_cry Fluffy_Pillow 27.2/130: 21% rage bloodlust, focused_rage(2)
0:25.359 slam Fluffy_Pillow 27.2/130: 21% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:26.369 focused_rage Fluffy_Pillow 27.2/130: 21% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:26.377 slam Fluffy_Pillow 27.2/130: 21% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:27.383 focused_rage Fluffy_Pillow 64.9/130: 50% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:27.396 slam Fluffy_Pillow 64.9/130: 50% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:28.397 focused_rage Fluffy_Pillow 64.9/130: 50% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:28.413 mortal_strike Fluffy_Pillow 64.9/130: 50% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:29.411 focused_rage Fluffy_Pillow 117.3/130: 90% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:29.431 mortal_strike Fluffy_Pillow 117.3/130: 90% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:30.425 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, focused_rage
0:30.449 colossus_smash Fluffy_Pillow 118.0/130: 91% rage bloodlust, focused_rage
0:31.439 focused_rage Fluffy_Pillow 106.0/130: 82% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:31.468 heroic_leap Fluffy_Pillow 106.0/130: 82% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:31.468 slam Fluffy_Pillow 106.0/130: 82% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:32.453 focused_rage Fluffy_Pillow 103.2/130: 79% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:32.488 slam Fluffy_Pillow 103.2/130: 79% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:33.467 focused_rage Fluffy_Pillow 75.2/130: 58% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:33.506 mortal_strike Fluffy_Pillow 75.2/130: 58% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:34.481 focused_rage Fluffy_Pillow 97.0/130: 75% rage bloodlust, focused_rage
0:34.525 slam Fluffy_Pillow 97.0/130: 75% rage bloodlust, focused_rage
0:35.495 focused_rage Fluffy_Pillow 69.0/130: 53% rage bloodlust, focused_rage(2)
0:35.545 slam Fluffy_Pillow 69.0/130: 53% rage bloodlust, focused_rage(2)
0:36.509 focused_rage Fluffy_Pillow 41.0/130: 32% rage bloodlust, focused_rage(3)
0:36.563 colossus_smash Fluffy_Pillow 66.2/130: 51% rage bloodlust, focused_rage(3)
0:37.523 focused_rage Fluffy_Pillow 54.2/130: 42% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:37.582 mortal_strike Fluffy_Pillow 54.2/130: 42% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:38.537 focused_rage Fluffy_Pillow 50.8/130: 39% rage bloodlust, focused_rage
0:38.599 slam Fluffy_Pillow 50.8/130: 39% rage bloodlust, focused_rage
0:39.551 focused_rage Fluffy_Pillow 48.0/130: 37% rage bloodlust, focused_rage(2)
0:39.617 slam Fluffy_Pillow 48.0/130: 37% rage bloodlust, focused_rage(2)
0:40.734 focused_rage Fluffy_Pillow 20.0/130: 15% rage focused_rage(3)
0:40.825 colossus_smash Fluffy_Pillow 20.0/130: 15% rage focused_rage(3)
0:42.052 focused_rage Fluffy_Pillow 33.2/130: 26% rage focused_rage(3), precise_strikes, shattered_defenses
0:42.148 mortal_strike Fluffy_Pillow 33.2/130: 26% rage focused_rage(3), precise_strikes, shattered_defenses
0:43.370 focused_rage Fluffy_Pillow 29.8/130: 23% rage focused_rage
0:43.471 slam Fluffy_Pillow 29.8/130: 23% rage focused_rage
0:44.688 focused_rage Fluffy_Pillow 1.8/130: 1% rage focused_rage(2)
0:44.793 Waiting 0.200 sec 1.8/130: 1% rage focused_rage(2)
0:44.993 slam Fluffy_Pillow 27.0/130: 21% rage focused_rage(2)
0:46.315 Waiting 1.900 sec 11.0/130: 8% rage focused_rage(2)
0:48.215 mortal_strike Fluffy_Pillow 47.9/130: 37% rage focused_rage(2)
0:48.215 focused_rage Fluffy_Pillow 34.9/130: 27% rage focused_rage
0:49.533 focused_rage Fluffy_Pillow 22.9/130: 18% rage focused_rage(2)
0:49.539 slam Fluffy_Pillow 22.9/130: 18% rage focused_rage(2)
0:50.862 battle_cry Fluffy_Pillow 6.9/130: 5% rage focused_rage(2)
0:50.862 focused_rage Fluffy_Pillow 6.9/130: 5% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:50.862 slam Fluffy_Pillow 6.9/130: 5% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:52.180 focused_rage Fluffy_Pillow 44.3/130: 34% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:52.183 slam Fluffy_Pillow 44.3/130: 34% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:53.498 focused_rage Fluffy_Pillow 44.3/130: 34% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:53.506 mortal_strike Fluffy_Pillow 44.3/130: 34% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:54.816 focused_rage Fluffy_Pillow 96.1/130: 74% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
0:54.829 slam Fluffy_Pillow 96.1/130: 74% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
0:56.134 focused_rage Fluffy_Pillow 84.1/130: 65% rage focused_rage(2)
0:56.152 colossus_smash Fluffy_Pillow 84.1/130: 65% rage focused_rage(2)
0:57.452 focused_rage Fluffy_Pillow 72.1/130: 55% rage focused_rage(3), precise_strikes, shattered_defenses
0:57.475 mortal_strike Fluffy_Pillow 72.1/130: 55% rage focused_rage(3), precise_strikes, shattered_defenses
0:58.770 focused_rage Fluffy_Pillow 104.8/130: 81% rage focused_rage
0:58.798 colossus_smash Fluffy_Pillow 104.8/130: 81% rage focused_rage
1:00.088 focused_rage Fluffy_Pillow 92.8/130: 71% rage focused_rage(2), precise_strikes, shattered_defenses
1:00.121 mortal_strike Fluffy_Pillow 92.8/130: 71% rage focused_rage(2), precise_strikes, shattered_defenses
1:01.406 focused_rage Fluffy_Pillow 114.6/130: 88% rage focused_rage
1:01.444 heroic_leap Fluffy_Pillow 114.6/130: 88% rage focused_rage
1:01.468 slam Fluffy_Pillow 114.6/130: 88% rage focused_rage
1:02.724 focused_rage Fluffy_Pillow 86.6/130: 67% rage focused_rage(2)
1:02.791 colossus_smash Fluffy_Pillow 86.6/130: 67% rage focused_rage(2)
1:04.042 focused_rage Fluffy_Pillow 99.8/130: 77% rage focused_rage(3), precise_strikes, shattered_defenses
1:04.111 mortal_strike Fluffy_Pillow 99.8/130: 77% rage focused_rage(3), precise_strikes, shattered_defenses
1:05.360 focused_rage Fluffy_Pillow 96.4/130: 74% rage focused_rage
1:05.435 colossus_smash Fluffy_Pillow 96.4/130: 74% rage focused_rage
1:06.678 focused_rage Fluffy_Pillow 84.4/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
1:06.758 mortal_strike Fluffy_Pillow 84.4/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
1:07.996 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage
1:08.080 colossus_smash Fluffy_Pillow 118.0/130: 91% rage focused_rage
1:09.314 focused_rage Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
1:09.403 mortal_strike Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
1:10.632 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage
1:10.725 colossus_smash Fluffy_Pillow 118.0/130: 91% rage focused_rage
1:11.950 focused_rage Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
1:12.046 mortal_strike Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
1:13.268 focused_rage Fluffy_Pillow 102.6/130: 79% rage focused_rage
1:13.369 colossus_smash Fluffy_Pillow 102.6/130: 79% rage focused_rage
1:14.586 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
1:14.691 mortal_strike Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
1:15.904 focused_rage Fluffy_Pillow 114.6/130: 88% rage focused_rage
1:16.012 slam Fluffy_Pillow 114.6/130: 88% rage focused_rage
1:17.222 focused_rage Fluffy_Pillow 111.8/130: 86% rage focused_rage(2)
1:17.335 colossus_smash Fluffy_Pillow 111.8/130: 86% rage focused_rage(2)
1:18.540 focused_rage Fluffy_Pillow 99.8/130: 77% rage focused_rage(3), precise_strikes, shattered_defenses
1:18.657 mortal_strike Fluffy_Pillow 99.8/130: 77% rage focused_rage(3), precise_strikes, shattered_defenses
1:19.858 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage
1:19.979 slam Fluffy_Pillow 118.0/130: 91% rage focused_rage
1:21.176 focused_rage Fluffy_Pillow 90.0/130: 69% rage focused_rage(2)
1:21.301 colossus_smash Fluffy_Pillow 90.0/130: 69% rage focused_rage(2)
1:22.494 focused_rage Fluffy_Pillow 78.0/130: 60% rage focused_rage(3), precise_strikes, shattered_defenses
1:22.626 battle_cry Fluffy_Pillow 78.0/130: 60% rage focused_rage(3), precise_strikes, shattered_defenses
1:22.626 mortal_strike Fluffy_Pillow 78.0/130: 60% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
1:23.812 focused_rage Fluffy_Pillow 129.0/130: 99% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:23.948 colossus_smash Fluffy_Pillow 129.0/130: 99% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:25.130 focused_rage Fluffy_Pillow 129.0/130: 99% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:25.271 mortal_strike Fluffy_Pillow 129.0/130: 99% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:26.448 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
1:26.594 slam Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
1:27.766 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), horrific_appendages
1:27.918 colossus_smash Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), horrific_appendages
1:29.084 focused_rage Fluffy_Pillow 106.0/130: 82% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:29.241 mortal_strike Fluffy_Pillow 106.0/130: 82% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:30.000 avatar Fluffy_Pillow 130.0/130: 100% rage avatar, horrific_appendages
1:30.402 focused_rage Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage, horrific_appendages
1:30.563 colossus_smash Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage, horrific_appendages
1:31.720 focused_rage Fluffy_Pillow 106.0/130: 82% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
1:31.885 heroic_leap Fluffy_Pillow 106.0/130: 82% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
1:31.885 mortal_strike Fluffy_Pillow 106.0/130: 82% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
1:33.038 focused_rage Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage, horrific_appendages
1:33.207 slam Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage, horrific_appendages
1:34.356 focused_rage Fluffy_Pillow 90.0/130: 69% rage avatar, focused_rage(2), horrific_appendages
1:34.531 slam Fluffy_Pillow 90.0/130: 69% rage avatar, focused_rage(2), horrific_appendages
1:35.674 focused_rage Fluffy_Pillow 87.2/130: 67% rage avatar, focused_rage(3), horrific_appendages
1:35.853 arcane_torrent Fluffy_Pillow 87.2/130: 67% rage avatar, focused_rage(3), horrific_appendages
1:35.853 warbreaker Fluffy_Pillow 102.2/130: 79% rage avatar, focused_rage(3), horrific_appendages
1:36.992 focused_rage Fluffy_Pillow 90.2/130: 69% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:37.176 mortal_strike Fluffy_Pillow 90.2/130: 69% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:38.310 focused_rage Fluffy_Pillow 86.8/130: 67% rage avatar, focused_rage, horrific_appendages
1:38.499 slam Fluffy_Pillow 86.8/130: 67% rage avatar, focused_rage, horrific_appendages
1:39.628 focused_rage Fluffy_Pillow 84.0/130: 65% rage avatar, focused_rage(2), horrific_appendages
1:39.823 slam Fluffy_Pillow 84.0/130: 65% rage avatar, focused_rage(2), horrific_appendages
1:40.946 focused_rage Fluffy_Pillow 56.0/130: 43% rage avatar, focused_rage(3), horrific_appendages
1:41.147 colossus_smash Fluffy_Pillow 56.0/130: 43% rage avatar, focused_rage(3), horrific_appendages
1:42.264 focused_rage Fluffy_Pillow 69.2/130: 53% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:42.470 mortal_strike Fluffy_Pillow 69.2/130: 53% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:43.582 focused_rage Fluffy_Pillow 65.8/130: 51% rage avatar, focused_rage
1:43.794 slam Fluffy_Pillow 65.8/130: 51% rage avatar, focused_rage
1:44.900 focused_rage Fluffy_Pillow 37.8/130: 29% rage avatar, focused_rage(2)
1:45.114 slam Fluffy_Pillow 63.0/130: 48% rage avatar, focused_rage(2)
1:46.218 focused_rage Fluffy_Pillow 35.0/130: 27% rage avatar, focused_rage(3)
1:46.437 colossus_smash Fluffy_Pillow 35.0/130: 27% rage avatar, focused_rage(3)
1:47.536 focused_rage Fluffy_Pillow 23.0/130: 18% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:47.758 mortal_strike Fluffy_Pillow 23.0/130: 18% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:48.854 focused_rage Fluffy_Pillow 44.8/130: 34% rage avatar, focused_rage
1:49.081 slam Fluffy_Pillow 44.8/130: 34% rage avatar, focused_rage
1:50.172 focused_rage Fluffy_Pillow 16.8/130: 13% rage focused_rage(2)
1:50.405 colossus_smash Fluffy_Pillow 16.8/130: 13% rage focused_rage(2)
1:51.490 focused_rage Fluffy_Pillow 30.0/130: 23% rage focused_rage(3), precise_strikes, shattered_defenses
1:51.726 battle_cry Fluffy_Pillow 30.0/130: 23% rage focused_rage(3), precise_strikes, shattered_defenses
1:51.726 mortal_strike Fluffy_Pillow 30.0/130: 23% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
1:52.808 focused_rage Fluffy_Pillow 45.0/130: 35% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:53.048 colossus_smash Fluffy_Pillow 45.0/130: 35% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:54.126 focused_rage Fluffy_Pillow 45.0/130: 35% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:54.371 slam Fluffy_Pillow 45.0/130: 35% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:55.444 focused_rage Fluffy_Pillow 82.6/130: 64% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
1:55.694 slam Fluffy_Pillow 82.6/130: 64% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
1:56.762 focused_rage Fluffy_Pillow 70.6/130: 54% rage focused_rage(3), precise_strikes, shattered_defenses
1:57.017 mortal_strike Fluffy_Pillow 70.6/130: 54% rage focused_rage(3), precise_strikes, shattered_defenses
1:58.080 focused_rage Fluffy_Pillow 103.7/130: 80% rage focused_rage
1:58.339 slam Fluffy_Pillow 103.7/130: 80% rage focused_rage
1:59.398 focused_rage Fluffy_Pillow 75.7/130: 58% rage focused_rage(2)
1:59.662 colossus_smash Fluffy_Pillow 75.7/130: 58% rage focused_rage(2)
2:00.716 focused_rage Fluffy_Pillow 63.7/130: 49% rage focused_rage(3), precise_strikes, shattered_defenses
2:00.985 mortal_strike Fluffy_Pillow 88.9/130: 68% rage focused_rage(3), precise_strikes, shattered_defenses
2:02.034 focused_rage Fluffy_Pillow 85.5/130: 66% rage focused_rage
2:02.307 heroic_leap Fluffy_Pillow 85.5/130: 66% rage focused_rage
2:02.307 slam Fluffy_Pillow 85.5/130: 66% rage focused_rage
2:03.352 focused_rage Fluffy_Pillow 57.5/130: 44% rage focused_rage(2)
2:03.629 slam Fluffy_Pillow 57.5/130: 44% rage focused_rage(2)
2:04.670 focused_rage Fluffy_Pillow 54.7/130: 42% rage focused_rage(3)
2:04.951 colossus_smash Fluffy_Pillow 54.7/130: 42% rage focused_rage(3)
2:05.988 focused_rage Fluffy_Pillow 42.7/130: 33% rage focused_rage(3), precise_strikes, shattered_defenses
2:06.273 mortal_strike Fluffy_Pillow 42.7/130: 33% rage focused_rage(3), precise_strikes, shattered_defenses
2:07.306 focused_rage Fluffy_Pillow 64.5/130: 50% rage focused_rage
2:07.595 slam Fluffy_Pillow 64.5/130: 50% rage focused_rage
2:08.624 focused_rage Fluffy_Pillow 36.5/130: 28% rage focused_rage(2)
2:08.918 colossus_smash Fluffy_Pillow 36.5/130: 28% rage focused_rage(2)
2:09.942 focused_rage Fluffy_Pillow 24.5/130: 19% rage focused_rage(3), precise_strikes, shattered_defenses
2:10.239 mortal_strike Fluffy_Pillow 24.5/130: 19% rage focused_rage(3), precise_strikes, shattered_defenses
2:11.260 focused_rage Fluffy_Pillow 46.3/130: 36% rage focused_rage
2:11.560 slam Fluffy_Pillow 46.3/130: 36% rage focused_rage
2:12.578 focused_rage Fluffy_Pillow 18.3/130: 14% rage focused_rage(2)
2:12.882 slam Fluffy_Pillow 18.3/130: 14% rage focused_rage(2)
2:13.896 focused_rage Fluffy_Pillow 15.5/130: 12% rage focused_rage(3)
2:14.207 bladestorm Fluffy_Pillow 15.5/130: 12% rage focused_rage(3)
2:16.156 focused_rage Fluffy_Pillow 15.5/130: 12% rage focused_rage(3), horrific_appendages
2:16.156 Waiting 0.600 sec 3.5/130: 3% rage focused_rage(3), horrific_appendages
2:16.756 mortal_strike Fluffy_Pillow 28.7/130: 22% rage focused_rage(3), horrific_appendages
2:17.474 focused_rage Fluffy_Pillow 15.7/130: 12% rage focused_rage, horrific_appendages
2:18.078 colossus_smash Fluffy_Pillow 15.7/130: 12% rage focused_rage, horrific_appendages
2:18.792 focused_rage Fluffy_Pillow 3.7/130: 3% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
2:19.400 battle_cry Fluffy_Pillow 3.7/130: 3% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
2:19.400 mortal_strike Fluffy_Pillow 3.7/130: 3% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
2:20.110 focused_rage Fluffy_Pillow 55.2/130: 42% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
2:20.724 slam Fluffy_Pillow 55.2/130: 42% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
2:21.428 focused_rage Fluffy_Pillow 55.2/130: 42% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
2:22.047 slam Fluffy_Pillow 55.2/130: 42% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
2:22.746 focused_rage Fluffy_Pillow 55.2/130: 42% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
2:23.371 slam Fluffy_Pillow 92.9/130: 71% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
2:24.064 focused_rage Fluffy_Pillow 92.9/130: 71% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
2:24.694 mortal_strike Fluffy_Pillow 92.9/130: 71% rage focused_rage(3), horrific_appendages
2:25.382 focused_rage Fluffy_Pillow 79.9/130: 61% rage focused_rage, horrific_appendages
2:26.019 colossus_smash Fluffy_Pillow 79.9/130: 61% rage focused_rage, horrific_appendages
2:26.700 focused_rage Fluffy_Pillow 93.1/130: 72% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
2:27.342 mortal_strike Fluffy_Pillow 93.1/130: 72% rage focused_rage(2), precise_strikes, shattered_defenses
2:28.018 focused_rage Fluffy_Pillow 89.7/130: 69% rage focused_rage
2:28.664 colossus_smash Fluffy_Pillow 89.7/130: 69% rage focused_rage
2:29.336 focused_rage Fluffy_Pillow 77.7/130: 60% rage focused_rage(2), precise_strikes, shattered_defenses
2:29.988 slam Fluffy_Pillow 115.2/130: 89% rage focused_rage(2), precise_strikes, shattered_defenses
2:30.654 focused_rage Fluffy_Pillow 87.2/130: 67% rage focused_rage(3), precise_strikes, shattered_defenses
2:31.312 mortal_strike Fluffy_Pillow 87.2/130: 67% rage focused_rage(3), precise_strikes, shattered_defenses
2:31.972 focused_rage Fluffy_Pillow 83.8/130: 64% rage focused_rage
2:32.635 heroic_leap Fluffy_Pillow 109.0/130: 84% rage focused_rage
2:32.635 colossus_smash Fluffy_Pillow 109.0/130: 84% rage focused_rage
2:33.290 focused_rage Fluffy_Pillow 97.0/130: 75% rage focused_rage(2), precise_strikes, shattered_defenses
2:33.956 slam Fluffy_Pillow 97.0/130: 75% rage focused_rage(2), precise_strikes, shattered_defenses
2:34.608 focused_rage Fluffy_Pillow 69.0/130: 53% rage focused_rage(3), precise_strikes, shattered_defenses
2:35.279 mortal_strike Fluffy_Pillow 69.0/130: 53% rage focused_rage(3), precise_strikes, shattered_defenses
2:35.926 focused_rage Fluffy_Pillow 90.8/130: 70% rage focused_rage
2:36.601 colossus_smash Fluffy_Pillow 90.8/130: 70% rage focused_rage
2:37.244 focused_rage Fluffy_Pillow 78.8/130: 61% rage focused_rage(2), precise_strikes, shattered_defenses
2:37.923 mortal_strike Fluffy_Pillow 78.8/130: 61% rage focused_rage(2), precise_strikes, shattered_defenses
2:38.562 focused_rage Fluffy_Pillow 75.4/130: 58% rage focused_rage
2:39.245 slam Fluffy_Pillow 113.0/130: 87% rage focused_rage
2:39.880 focused_rage Fluffy_Pillow 85.0/130: 65% rage focused_rage(2)
2:40.567 slam Fluffy_Pillow 85.0/130: 65% rage focused_rage(2)
2:41.198 focused_rage Fluffy_Pillow 57.0/130: 44% rage focused_rage(3)
2:41.889 warbreaker Fluffy_Pillow 57.0/130: 44% rage focused_rage(3)
2:42.516 focused_rage Fluffy_Pillow 70.2/130: 54% rage focused_rage(3), precise_strikes, shattered_defenses
2:43.212 mortal_strike Fluffy_Pillow 70.2/130: 54% rage focused_rage(3), precise_strikes, shattered_defenses
2:43.834 focused_rage Fluffy_Pillow 66.8/130: 51% rage focused_rage
2:44.535 slam Fluffy_Pillow 66.8/130: 51% rage focused_rage
2:45.152 focused_rage Fluffy_Pillow 38.8/130: 30% rage focused_rage(2)
2:45.858 colossus_smash Fluffy_Pillow 64.0/130: 49% rage focused_rage(2)
2:46.470 focused_rage Fluffy_Pillow 52.0/130: 40% rage focused_rage(3), precise_strikes, shattered_defenses
2:47.180 battle_cry Fluffy_Pillow 52.0/130: 40% rage focused_rage(3), precise_strikes, shattered_defenses
2:47.180 mortal_strike Fluffy_Pillow 52.0/130: 40% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:47.788 focused_rage Fluffy_Pillow 67.0/130: 52% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:48.501 slam Fluffy_Pillow 103.6/130: 80% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:49.106 focused_rage Fluffy_Pillow 103.6/130: 80% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:49.823 slam Fluffy_Pillow 103.6/130: 80% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:50.424 focused_rage Fluffy_Pillow 103.6/130: 80% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
2:51.146 mortal_strike Fluffy_Pillow 103.6/130: 80% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
2:51.742 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:52.468 colossus_smash Fluffy_Pillow 130.0/130: 100% rage focused_rage
2:53.060 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
2:53.791 slam Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
2:54.378 focused_rage Fluffy_Pillow 90.0/130: 69% rage focused_rage(3), precise_strikes, shattered_defenses
2:55.113 slam Fluffy_Pillow 115.2/130: 89% rage focused_rage(3), precise_strikes, shattered_defenses
2:55.696 focused_rage Fluffy_Pillow 87.2/130: 67% rage focused_rage(3), precise_strikes, shattered_defenses
2:56.437 mortal_strike Fluffy_Pillow 87.2/130: 67% rage focused_rage(3), precise_strikes, shattered_defenses
2:57.014 focused_rage Fluffy_Pillow 83.8/130: 64% rage focused_rage
2:57.759 colossus_smash Fluffy_Pillow 83.8/130: 64% rage focused_rage
2:58.332 focused_rage Fluffy_Pillow 97.0/130: 75% rage focused_rage(2), precise_strikes, shattered_defenses
2:59.081 slam Fluffy_Pillow 97.0/130: 75% rage focused_rage(2), precise_strikes, shattered_defenses
2:59.650 focused_rage Fluffy_Pillow 69.0/130: 53% rage focused_rage(3), precise_strikes, shattered_defenses
3:00.000 avatar Fluffy_Pillow 69.0/130: 53% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:00.403 slam Fluffy_Pillow 69.0/130: 53% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:00.968 focused_rage Fluffy_Pillow 41.0/130: 32% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:01.724 mortal_strike Fluffy_Pillow 66.2/130: 51% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:02.286 focused_rage Fluffy_Pillow 62.8/130: 48% rage avatar, focused_rage
3:03.046 heroic_leap Fluffy_Pillow 62.8/130: 48% rage avatar, focused_rage
3:03.046 slam Fluffy_Pillow 62.8/130: 48% rage avatar, focused_rage
3:03.604 focused_rage Fluffy_Pillow 34.8/130: 27% rage avatar, focused_rage(2)
3:04.365 slam Fluffy_Pillow 60.0/130: 46% rage avatar, focused_rage(2)
3:04.922 focused_rage Fluffy_Pillow 32.0/130: 25% rage avatar, focused_rage(3)
3:05.688 arcane_torrent Fluffy_Pillow 32.0/130: 25% rage avatar, focused_rage(3)
3:05.853 slam Fluffy_Pillow 47.0/130: 36% rage avatar, focused_rage(3)
3:06.240 focused_rage Fluffy_Pillow 19.0/130: 15% rage avatar, focused_rage(3)
3:07.175 mortal_strike Fluffy_Pillow 19.0/130: 15% rage avatar, focused_rage(3)
3:07.558 focused_rage Fluffy_Pillow 31.2/130: 24% rage avatar, focused_rage
3:08.497 slam Fluffy_Pillow 31.2/130: 24% rage avatar, focused_rage
3:08.876 focused_rage Fluffy_Pillow 3.2/130: 2% rage avatar, focused_rage(2)
3:09.819 Waiting 0.700 sec 3.2/130: 2% rage avatar, focused_rage(2)
3:10.519 slam Fluffy_Pillow 28.4/130: 22% rage avatar, focused_rage(2)
3:10.519 focused_rage Fluffy_Pillow 0.4/130: 0% rage avatar, focused_rage(3)
3:11.842 Waiting 1.100 sec 0.4/130: 0% rage avatar, focused_rage(3)
3:12.942 battle_cry Fluffy_Pillow 0.4/130: 0% rage avatar, focused_rage(3)
3:13.100 mortal_strike Fluffy_Pillow 0.4/130: 0% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:13.100 focused_rage Fluffy_Pillow 15.4/130: 12% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
3:14.418 focused_rage Fluffy_Pillow 52.1/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:14.423 colossus_smash Fluffy_Pillow 52.1/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:15.736 focused_rage Fluffy_Pillow 52.1/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:15.745 mortal_strike Fluffy_Pillow 52.1/130: 40% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:17.054 focused_rage Fluffy_Pillow 104.9/130: 81% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
3:17.066 slam Fluffy_Pillow 104.9/130: 81% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
3:18.372 focused_rage Fluffy_Pillow 92.9/130: 71% rage avatar, focused_rage(2)
3:18.391 slam Fluffy_Pillow 92.9/130: 71% rage avatar, focused_rage(2)
3:19.690 focused_rage Fluffy_Pillow 64.9/130: 50% rage avatar, focused_rage(3)
3:19.714 slam Fluffy_Pillow 64.9/130: 50% rage avatar, focused_rage(3)
3:21.008 focused_rage Fluffy_Pillow 62.1/130: 48% rage focused_rage(3)
3:21.036 mortal_strike Fluffy_Pillow 62.1/130: 48% rage focused_rage(3)
3:22.326 focused_rage Fluffy_Pillow 49.1/130: 38% rage focused_rage
3:22.358 slam Fluffy_Pillow 49.1/130: 38% rage focused_rage
3:23.644 focused_rage Fluffy_Pillow 46.3/130: 36% rage focused_rage(2)
3:23.680 colossus_smash Fluffy_Pillow 46.3/130: 36% rage focused_rage(2)
3:24.962 focused_rage Fluffy_Pillow 34.3/130: 26% rage focused_rage(3), precise_strikes, shattered_defenses
3:25.004 mortal_strike Fluffy_Pillow 34.3/130: 26% rage focused_rage(3), precise_strikes, shattered_defenses
3:26.280 focused_rage Fluffy_Pillow 30.9/130: 24% rage focused_rage
3:26.326 slam Fluffy_Pillow 56.1/130: 43% rage focused_rage
3:27.598 focused_rage Fluffy_Pillow 28.1/130: 22% rage focused_rage(2)
3:27.647 slam Fluffy_Pillow 28.1/130: 22% rage focused_rage(2)
3:28.916 focused_rage Fluffy_Pillow 0.1/130: 0% rage focused_rage(3)
3:28.970 Waiting 0.600 sec 0.1/130: 0% rage focused_rage(3)
3:29.570 slam Fluffy_Pillow 36.7/130: 28% rage focused_rage(3)
3:30.234 focused_rage Fluffy_Pillow 8.7/130: 7% rage focused_rage(3)
3:30.891 Waiting 1.800 sec 8.7/130: 7% rage focused_rage(3)
3:32.691 mortal_strike Fluffy_Pillow 33.9/130: 26% rage focused_rage(3)
3:32.691 focused_rage Fluffy_Pillow 20.9/130: 16% rage focused_rage
3:34.009 focused_rage Fluffy_Pillow 8.9/130: 7% rage focused_rage(2)
3:34.014 Waiting 1.800 sec 8.9/130: 7% rage focused_rage(2)
3:35.814 slam Fluffy_Pillow 34.1/130: 26% rage focused_rage(2)
3:35.814 focused_rage Fluffy_Pillow 6.1/130: 5% rage focused_rage(3)
3:37.137 Waiting 1.900 sec 6.1/130: 5% rage focused_rage(3)
3:39.037 mortal_strike Fluffy_Pillow 31.3/130: 24% rage focused_rage(3)
3:39.037 focused_rage Fluffy_Pillow 18.3/130: 14% rage focused_rage
3:40.355 focused_rage Fluffy_Pillow 6.3/130: 5% rage focused_rage(2)
3:40.358 colossus_smash Fluffy_Pillow 6.3/130: 5% rage focused_rage(2)
3:41.682 battle_cry Fluffy_Pillow 6.3/130: 5% rage focused_rage(2), precise_strikes, shattered_defenses
3:41.682 heroic_leap Fluffy_Pillow 6.3/130: 5% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
3:41.682 focused_rage Fluffy_Pillow 6.3/130: 5% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
3:41.682 mortal_strike Fluffy_Pillow 6.3/130: 5% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:43.000 focused_rage Fluffy_Pillow 57.9/130: 45% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:43.005 slam Fluffy_Pillow 57.9/130: 45% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:44.318 focused_rage Fluffy_Pillow 57.9/130: 45% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:44.328 slam Fluffy_Pillow 57.9/130: 45% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:45.636 focused_rage Fluffy_Pillow 95.2/130: 73% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:45.649 warbreaker Fluffy_Pillow 95.2/130: 73% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:46.954 focused_rage Fluffy_Pillow 83.2/130: 64% rage focused_rage(3), precise_strikes, shattered_defenses
3:46.972 mortal_strike Fluffy_Pillow 83.2/130: 64% rage focused_rage(3), precise_strikes, shattered_defenses
3:48.272 focused_rage Fluffy_Pillow 79.8/130: 61% rage focused_rage
3:48.294 slam Fluffy_Pillow 79.8/130: 61% rage focused_rage
3:49.590 focused_rage Fluffy_Pillow 88.4/130: 68% rage focused_rage(2)
3:49.617 slam Fluffy_Pillow 88.4/130: 68% rage focused_rage(2)
3:50.908 focused_rage Fluffy_Pillow 60.4/130: 46% rage focused_rage(3)
3:50.938 slam Fluffy_Pillow 60.4/130: 46% rage focused_rage(3)
3:52.226 focused_rage Fluffy_Pillow 57.6/130: 44% rage focused_rage(3)
3:52.259 mortal_strike Fluffy_Pillow 57.6/130: 44% rage focused_rage(3)
3:53.544 focused_rage Fluffy_Pillow 44.6/130: 34% rage focused_rage
3:53.582 slam Fluffy_Pillow 44.6/130: 34% rage focused_rage
3:54.862 focused_rage Fluffy_Pillow 41.8/130: 32% rage focused_rage(2)
3:54.904 slam Fluffy_Pillow 41.8/130: 32% rage focused_rage(2)
3:56.180 focused_rage Fluffy_Pillow 13.8/130: 11% rage focused_rage(3)
3:56.227 colossus_smash Fluffy_Pillow 13.8/130: 11% rage focused_rage(3)
3:57.498 focused_rage Fluffy_Pillow 1.8/130: 1% rage focused_rage(3), precise_strikes, shattered_defenses
3:57.550 bladestorm Fluffy_Pillow 1.8/130: 1% rage focused_rage(3), precise_strikes, shattered_defenses
3:59.557 mortal_strike Fluffy_Pillow 27.0/130: 21% rage focused_rage(3), precise_strikes, shattered_defenses
3:59.557 focused_rage Fluffy_Pillow 23.6/130: 18% rage focused_rage
4:00.875 focused_rage Fluffy_Pillow 11.6/130: 9% rage focused_rage(2)
4:00.880 colossus_smash Fluffy_Pillow 11.6/130: 9% rage focused_rage(2)
4:02.193 focused_rage Fluffy_Pillow 24.8/130: 19% rage focused_rage(3), precise_strikes, shattered_defenses
4:02.202 mortal_strike Fluffy_Pillow 24.8/130: 19% rage focused_rage(3), precise_strikes, shattered_defenses
4:03.511 focused_rage Fluffy_Pillow 21.4/130: 16% rage focused_rage
4:03.525 colossus_smash Fluffy_Pillow 21.4/130: 16% rage focused_rage
4:04.829 focused_rage Fluffy_Pillow 34.6/130: 27% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
4:04.847 mortal_strike Fluffy_Pillow 34.6/130: 27% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
4:06.147 focused_rage Fluffy_Pillow 31.2/130: 24% rage focused_rage, horrific_appendages
4:06.169 slam Fluffy_Pillow 31.2/130: 24% rage focused_rage, horrific_appendages
4:07.465 focused_rage Fluffy_Pillow 28.4/130: 22% rage focused_rage(2), horrific_appendages
4:07.491 colossus_smash Fluffy_Pillow 28.4/130: 22% rage focused_rage(2), horrific_appendages
4:08.783 focused_rage Fluffy_Pillow 16.4/130: 13% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
4:08.814 battle_cry Fluffy_Pillow 16.4/130: 13% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
4:08.814 mortal_strike Fluffy_Pillow 16.4/130: 13% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
4:10.101 focused_rage Fluffy_Pillow 31.4/130: 24% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
4:10.136 slam Fluffy_Pillow 31.4/130: 24% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
4:11.419 focused_rage Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
4:11.458 heroic_leap Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
4:11.682 potion Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
4:11.682 execute Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages, potion_of_the_old_war
4:12.737 focused_rage Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages, potion_of_the_old_war
4:13.005 execute Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages, potion_of_the_old_war
4:14.328 colossus_smash Fluffy_Pillow 104.1/130: 80% rage focused_rage(3), horrific_appendages, potion_of_the_old_war
4:15.651 execute Fluffy_Pillow 104.1/130: 80% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
4:16.972 execute Fluffy_Pillow 128.3/130: 99% rage focused_rage(3), potion_of_the_old_war
4:18.296 execute Fluffy_Pillow 96.3/130: 74% rage focused_rage(3), potion_of_the_old_war
4:19.616 colossus_smash Fluffy_Pillow 64.3/130: 49% rage focused_rage(3), potion_of_the_old_war
4:20.938 execute Fluffy_Pillow 89.5/130: 69% rage focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
4:22.259 colossus_smash Fluffy_Pillow 76.7/130: 59% rage focused_rage(3), potion_of_the_old_war
4:23.582 execute Fluffy_Pillow 101.9/130: 78% rage focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
4:24.905 execute Fluffy_Pillow 89.1/130: 69% rage focused_rage(3), potion_of_the_old_war
4:26.228 colossus_smash Fluffy_Pillow 57.1/130: 44% rage focused_rage(3), potion_of_the_old_war
4:27.550 execute Fluffy_Pillow 94.7/130: 73% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
4:28.873 execute Fluffy_Pillow 81.9/130: 63% rage focused_rage(3), horrific_appendages, potion_of_the_old_war
4:30.000 avatar Fluffy_Pillow 75.1/130: 58% rage avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
4:30.197 colossus_smash Fluffy_Pillow 75.1/130: 58% rage avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
4:31.519 execute Fluffy_Pillow 75.1/130: 58% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
4:32.838 execute Fluffy_Pillow 87.5/130: 67% rage avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
4:34.160 mortal_strike Fluffy_Pillow 55.5/130: 43% rage avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
4:35.481 execute Fluffy_Pillow 54.5/130: 42% rage avatar, horrific_appendages, potion_of_the_old_war
4:36.802 arcane_torrent Fluffy_Pillow 59.4/130: 46% rage avatar, horrific_appendages
4:36.802 colossus_smash Fluffy_Pillow 74.4/130: 57% rage avatar, horrific_appendages
4:38.124 execute Fluffy_Pillow 74.4/130: 57% rage avatar, precise_strikes, shattered_defenses, horrific_appendages
4:39.447 execute Fluffy_Pillow 86.8/130: 67% rage avatar
4:40.768 battle_cry Fluffy_Pillow 54.8/130: 42% rage avatar
4:40.768 focused_rage Fluffy_Pillow 54.8/130: 42% rage avatar, corrupted_blood_of_zakajz, battle_cry
4:40.768 execute Fluffy_Pillow 54.8/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:42.086 focused_rage Fluffy_Pillow 54.8/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:42.091 heroic_leap Fluffy_Pillow 54.8/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:42.091 execute Fluffy_Pillow 54.8/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:43.404 focused_rage Fluffy_Pillow 92.1/130: 71% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:43.413 mortal_strike Fluffy_Pillow 92.1/130: 71% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:44.722 focused_rage Fluffy_Pillow 107.1/130: 82% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:44.736 execute Fluffy_Pillow 107.1/130: 82% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:46.058 colossus_smash Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage
4:47.380 execute Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage, precise_strikes, shattered_defenses
4:48.702 execute Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage
4:50.024 execute Fluffy_Pillow 98.0/130: 75% rage focused_rage
4:51.347 execute Fluffy_Pillow 66.0/130: 51% rage focused_rage
4:52.668 colossus_smash Fluffy_Pillow 59.2/130: 46% rage focused_rage
4:53.991 execute Fluffy_Pillow 59.2/130: 46% rage focused_rage, precise_strikes, shattered_defenses
4:55.313 execute Fluffy_Pillow 71.6/130: 55% rage focused_rage
4:56.634 mortal_strike Fluffy_Pillow 39.6/130: 30% rage focused_rage
4:57.955 colossus_smash Fluffy_Pillow 38.6/130: 30% rage
4:59.276 execute Fluffy_Pillow 63.8/130: 49% rage precise_strikes, shattered_defenses
5:00.598 mortal_strike Fluffy_Pillow 51.0/130: 39% rage
5:01.919 execute Fluffy_Pillow 75.2/130: 58% rage
5:03.241 execute Fluffy_Pillow 43.2/130: 33% rage
5:04.561 execute Fluffy_Pillow 36.4/130: 28% rage

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 27987 26281 14801 (6219)
Agility 6579 6254 0
Stamina 42257 42257 26247
Intellect 5328 5003 0
Spirit 2 2 0
Health 2535420 2535420 0
Rage 130 130 0
Crit 18.49% 18.49% 4370
Haste 13.75% 13.75% 4470
Damage / Heal Versatility 2.81% 2.81% 1124
Attack Power 27987 26281 0
Mastery 81.32% 79.18% 11055
Armor 4353 4353 4353
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Warhelm of the Obsidian Aspect
ilevel: 880, stats: { 593 Armor, +1715 Str, +2573 Sta, +793 Crit, +668 Haste }
Local Neck Zealous Timestone Pendant
ilevel: 880, stats: { +1448 Sta, +1233 Mastery, +822 Haste }, enchant: { +300 Mastery }
Local Shoulders Shoulderplates of the Obsidian Aspect
ilevel: 880, stats: { 547 Armor, +1287 Str, +1930 Sta, +759 Haste, +336 Crit }
Local Chest Breastplate of the Remembered King
ilevel: 880, stats: { 729 Armor, +2573 Sta, +1715 StrInt, +1012 Mastery, +448 Vers }
Local Waist Gilded Nightborne Waistplate
ilevel: 880, stats: { 410 Armor, +1930 Sta, +1287 StrInt, +759 Mastery, +336 Vers }
Local Legs Legplates of the Obsidian Aspect
ilevel: 880, stats: { 638 Armor, +1715 Str, +2573 Sta, +918 Crit, +542 Haste }
Local Feet Leystone-Toe Kickers
ilevel: 880, stats: { 501 Armor, +1930 Sta, +1287 StrInt, +665 Mastery, +430 Haste }
Local Wrists Jagged Carapace Wristclamps
ilevel: 880, stats: { 319 Armor, +1448 Sta, +965 StrInt, +481 Mastery, +340 Vers }
Local Hands Archavon's Heavy Hand
ilevel: 895, stats: { 471 Armor, +2219 Sta, +1479 Str, +496 Crit, +662 Haste }
Local Finger1 Ring of Exclusive Servitude
ilevel: 880, stats: { +1448 Sta, +1350 Mastery, +704 Crit }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 880, stats: { +1448 Sta, +1467 Mastery, +587 Haste }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Trinket2 Terrorbound Nexus
ilevel: 880, stats: { +1043 Mastery }
Local Back Greatcloak of the Obsidian Aspect
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +516 Mastery, +305 Crit }, enchant: { +200 Str }
Local Main Hand Strom'kar, the Warbreaker
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Dauntless (Arms Warrior) Overpower (Arms Warrior) Sweeping Strikes (Arms Warrior)
30 Shockwave (Arms Warrior) Storm Bolt (Arms Warrior) Double Time
45 Fervor of Battle (Arms Warrior) Rend (Arms Warrior) Avatar
60 Second Wind Bounding Stride Defensive Stance (Arms Warrior)
75 In For The Kill (Arms Warrior) Mortal Combo (Arms Warrior) Focused Rage (Arms Warrior)
90 Deadly Calm (Arms Warrior) Trauma (Arms Warrior) Titanic Might (Arms Warrior)
100 Anger Management Opportunity Strikes (Arms Warrior) Ravager (Arms Warrior)

Profile

warrior="Warrior_Arms_T19M"
level=110
race=blood_elf
role=attack
position=back
talents=1332311
artifact=36:140815:141523:140822:0:1136:1:1137:1:1138:1:1139:1:1140:1:1141:1:1142:1:1143:3:1144:3:1145:3:1146:3:1147:3:1148:3:1149:4:1150:5:1151:3:1356:1
spec=arms

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=charge
actions+=/auto_attack
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
actions+=/blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
actions+=/berserking,if=buff.battle_cry.up|target.time_to_die<=11
actions+=/arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
actions+=/battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
actions+=/avatar,if=(buff.bloodlust.up|time>=1)
actions+=/heroic_leap,if=debuff.colossus_smash.up
actions+=/rend,if=remains<gcd
actions+=/focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
actions+=/colossus_smash,if=debuff.colossus_smash.down
actions+=/warbreaker,if=debuff.colossus_smash.down
actions+=/ravager
actions+=/overpower,if=buff.overpower.react
actions+=/run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
actions+=/run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
actions+=/run_action_list,name=execute,if=target.health.pct<=20
actions+=/run_action_list,name=single,if=target.health.pct>20

actions.aoe=mortal_strike
actions.aoe+=/execute,if=buff.stone_heart.react
actions.aoe+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.aoe+=/warbreaker,if=buff.shattered_defenses.down
actions.aoe+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.aoe+=/rend,if=remains<=duration*0.3
actions.aoe+=/bladestorm
actions.aoe+=/cleave
actions.aoe+=/whirlwind,if=rage>=60
actions.aoe+=/shockwave
actions.aoe+=/storm_bolt

actions.cleave=mortal_strike
actions.cleave+=/execute,if=buff.stone_heart.react
actions.cleave+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.cleave+=/warbreaker,if=buff.shattered_defenses.down
actions.cleave+=/focused_rage,if=rage>100|buff.battle_cry_deadly_calm.up
actions.cleave+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.cleave+=/rend,if=remains<=duration*0.3
actions.cleave+=/bladestorm
actions.cleave+=/cleave
actions.cleave+=/whirlwind,if=rage>40|buff.cleave.up
actions.cleave+=/shockwave
actions.cleave+=/storm_bolt

actions.execute=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
actions.execute+=/execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/colossus_smash,if=buff.shattered_defenses.down
actions.execute+=/warbreaker,if=buff.shattered_defenses.down&rage<=30
actions.execute+=/execute,if=buff.shattered_defenses.up&rage>22
actions.execute+=/mortal_strike,if=equipped.archavons_heavy_hand&rage<60
actions.execute+=/execute,if=buff.shattered_defenses.down
actions.execute+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

actions.single=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
actions.single+=/colossus_smash,if=buff.shattered_defenses.down
actions.single+=/warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
actions.single+=/focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
actions.single+=/mortal_strike
actions.single+=/execute,if=buff.stone_heart.react
actions.single+=/slam
actions.single+=/execute,if=equipped.archavons_heavy_hand
actions.single+=/focused_rage,if=equipped.archavons_heavy_hand
actions.single+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

head=warhelm_of_the_obsidian_aspect,id=138357,bonus_id=1806
neck=zealous_timestone_pendant,id=140894,bonus_id=1806,enchant=mark_of_the_trained_soldier
shoulders=shoulderplates_of_the_obsidian_aspect,id=138363,bonus_id=1806
back=greatcloak_of_the_obsidian_aspect,id=138374,bonus_id=1806,enchant=binding_of_strength
chest=breastplate_of_the_remembered_king,id=140913,bonus_id=1806
wrists=jagged_carapace_wristclamps,id=140902,bonus_id=1806
hands=archavons_heavy_hand,id=137060,bonus_id=1811
waist=gilded_nightborne_waistplate,id=140880,bonus_id=1806
legs=legplates_of_the_obsidian_aspect,id=138360,bonus_id=1806
feet=leystonetoe_kickers,id=140884,bonus_id=1806
finger1=ring_of_exclusive_servitude,id=140906,bonus_id=1806,enchant=binding_of_mastery
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=1806,enchant=binding_of_mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1806
trinket2=terrorbound_nexus,id=137406,bonus_id=1806
main_hand=stromkar_the_warbreaker,id=128910,bonus_id=750,gem_id=140815/137377/139257,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=882.73
# gear_strength=14801
# gear_stamina=26247
# gear_crit_rating=4370
# gear_haste_rating=4470
# gear_mastery_rating=11055
# gear_versatility_rating=1124
# gear_armor=4353
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

Warrior_Fury_T19M : 467463 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
467463.4 467463.4 362.6 / 0.078% 63074.3 / 13.5% 50708.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.2 9.2 Rage 0.00% 57.0 100.0% 100%
Talents
  • 15: Endless Rage (Fury Warrior)
  • 30: Storm Bolt (Fury Warrior)
  • 45: Avatar
  • 60: Bounding Stride
  • 75: Massacre (Fury Warrior)
  • 90: Inner Rage (Fury Warrior)
  • 100: Dragon Roar (Fury Warrior)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Warrior_Fury_T19M 467463
auto_attack_mh 50679 10.8% 226.2 1.33sec 67283 50723 Direct 226.2 46342 99766 67283 40.1% 1.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 226.22 226.22 0.00 0.00 1.3265 0.0000 15220896.88 22376160.18 31.98 50722.80 50722.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.06 58.82% 46342.25 31711 61309 46349.33 44662 48128 6166115 9064774 31.98
crit 90.76 40.12% 99766.36 63422 141011 99826.80 94992 106692 9054782 13311387 31.98
miss 2.41 1.06% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 25337 5.4% 226.2 1.33sec 33637 25358 Direct 226.2 23171 49886 33638 40.1% 1.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 226.22 226.22 0.00 0.00 1.3265 0.0000 7609522.35 11186718.65 31.98 25358.31 25358.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.09 58.83% 23170.86 15855 30654 23174.10 22368 23981 3083749 4533404 31.98
crit 90.72 40.10% 49885.99 31711 70505 49916.62 47335 53406 4525773 6653315 31.98
miss 2.41 1.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bloodthirst 33073 7.1% 50.6 5.23sec 196528 176870 Direct 50.6 129224 265291 196528 49.5% 0.0%  

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.56 50.56 0.00 0.00 1.1111 0.0000 9937241.90 14608686.88 31.98 176869.61 176869.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.55 50.54% 129223.67 90031 174063 129350.15 118939 143124 3302050 4854326 31.98
crit 25.01 49.46% 265290.64 180061 400346 265388.05 230700 300480 6635192 9754361 31.98
 
 

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.down|rage<50
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Assault the target in a bloodthirsty craze, dealing ${$sw2*$<mult>} Physical damage and restoring {$117313s1=4}% of your health. |cFFFFFFFFGenerates ${$m3/10} Rage.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.01
 
Dragon Roar 6747 1.4% 13.7 22.68sec 147818 132493 Direct 13.7 0 147817 147817 100.0% 0.0%  

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.71 13.71 0.00 0.00 1.1157 0.0000 2026340.84 2026340.84 0.00 132492.54 132492.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 13.71 100.00% 147817.41 101697 188426 147857.74 132457 161433 2026341 2026341 0.00
 
 

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:Damage done increased by {$s2=20}%.
  • description:Roar explosively, dealing $m1 damage to all enemies within $A1 yards and increasing all damage you deal by {$s2=20}% for {$d=6 seconds}. Dragon Roar ignores all armor and always critically strikes.
 
Execute 69290 (103943) 14.9% (22.3%) 44.1 6.82sec 709579 622347 Direct 44.1 302215 631205 473008 51.9% 0.0%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.12 44.12 0.00 0.00 1.1402 0.0000 20867208.48 30676773.07 31.98 622347.28 622347.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.22 48.09% 302215.31 149257 793572 301049.52 228135 406656 6411723 9425840 31.98
crit 22.90 51.91% 631205.31 298515 1825215 628557.73 460999 888448 14455485 21250933 31.98
 
 

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.13
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2))|buff.stone_heart.react
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
    Execute Off-Hand 34653 7.4% 0.0 0.00sec 0 0 Direct 44.1 151268 315292 236598 52.0% 0.0%  

Stats details: execute_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 44.12 0.00 0.00 0.0000 0.0000 10438104.40 15345002.19 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.17 47.98% 151268.20 74630 396795 150734.49 112632 197464 3201676 4706767 31.98
crit 22.95 52.02% 315292.34 149261 912629 313876.56 234240 439652 7236428 10638235 31.98
 
 

Action details: execute_offhand

Static Values
  • id:163558
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.13
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:163558
  • name:Execute Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc5308=Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Fel-Crazed Rage 1451 0.3% 2.9 129.11sec 152217 0 Direct 2.9 77958 156586 152341 94.6% 0.0%  

Stats details: felcrazed_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 2.86 0.00 0.00 0.0000 0.0000 436373.26 436373.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.15 5.40% 77958.08 54356 105091 12048.42 0 105091 12059 12059 0.00
crit 2.71 94.60% 156586.17 108712 241708 155420.04 119583 189383 424314 424314 0.00
 
 

Action details: felcrazed_rage

Static Values
  • id:225777
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225777
  • name:Fel-Crazed Rage
  • school:shadow
  • tooltip:
  • description:{$@spelldesc225141=Enter a fel-crazed rage, dealing {$225777s1=29114 to 32178} Shadow damage to a random nearby enemy every ${$t1}.2 sec for {$d=3 seconds}. You cannot move or use abilities during your rage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:50927.68
  • base_dd_max:56288.48
 
Furious Slash 10531 2.3% 27.5 8.72sec 115053 103719 Direct 27.5 84135 178132 115054 32.9% 0.0%  

Stats details: furious_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.50 27.50 0.00 0.00 1.1093 0.0000 3163647.10 4650860.90 31.98 103719.33 103719.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.45 67.11% 84135.39 58710 113508 84157.58 75049 92488 1552544 2282387 31.98
crit 9.04 32.89% 178132.46 117419 261068 178550.10 0 261068 1611103 2368474 31.97
 
 

Action details: furious_slash

Static Values
  • id:100130
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
Spelldata
  • id:100130
  • name:Furious Slash
  • school:physical
  • tooltip:
  • description:Aggressively strike with your off-hand weapon for ${$sw3*$<mult>} Physical damage.$?a231824[ Increases your Bloodthirst critical strike chance by {$206333s1=15}% until it next deals a critical strike, stacking up to {$206333u=6} times.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.93
 
Mark of the Hidden Satyr 6742 1.4% 19.4 15.56sec 104511 0 Direct 19.4 71543 156230 104511 38.9% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.38 19.38 0.00 0.00 0.0000 0.0000 2024977.67 2024977.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.83 61.07% 71542.66 50191 97037 71514.91 59842 85245 846554 846554 0.00
crit 7.54 38.93% 156230.43 100381 223186 156181.10 0 223186 1178424 1178424 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Odyn's Fury 0 (25521) 0.0% (5.5%) 7.2 44.30sec 1057757 969396

Stats details: odyns_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.25 0.00 0.00 0.00 1.0912 0.0000 0.00 0.00 0.00 969396.43 969396.43
 
 

Action details: odyns_fury

Static Values
  • id:205545
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up&buff.enrage.up
Spelldata
  • id:205545
  • name:Odyn's Fury
  • school:physical
  • tooltip:
  • description:Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.
 
    Odyn's Fury (_mh) 20278 4.3% 0.0 0.00sec 0 0 Direct 7.2 0 434634 434634 100.0% 0.0%  
Periodic 28.7 52877 112670 102374 82.8% 0.0% 9.6%

Stats details: odyns_fury_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.25 28.74 28.74 0.0000 1.0000 6092537.11 6092537.11 0.00 212024.96 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 7.25 100.00% 434634.14 366254 527406 434619.14 410205 498106 3150777 3150777 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.9 17.22% 52876.77 31389 60687 53085.28 0 60687 261663 261663 0.00
crit 23.8 82.78% 112669.77 62778 139579 112765.65 101217 128208 2680097 2680097 0.00
 
 

Action details: odyns_fury_mh

Static Values
  • id:205546
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205546
  • name:Odyn's Fury
  • school:fire
  • tooltip:Suffering $o3 Fire damage over {$d=4 seconds}.
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
    Odyn's Fury (_oh) 5243 1.1% 0.0 0.00sec 0 0 Direct 7.2 0 217317 217317 100.0% 0.0%  

Stats details: odyns_fury_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.25 0.00 0.00 0.0000 0.0000 1575388.67 1575388.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 7.25 100.00% 217317.07 183127 263703 217309.57 205102 249053 1575389 1575389 0.00
 
 

Action details: odyns_fury_oh

Static Values
  • id:205547
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205547
  • name:Odyn's Fury
  • school:fire
  • tooltip:
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
Potion of the Old War 26543 5.6% 27.6 11.01sec 284031 0 Direct 27.6 180332 403262 284040 46.5% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.63 27.63 0.00 0.00 0.0000 0.0000 7847545.22 11536634.82 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.78 53.48% 180332.15 117183 226559 180287.78 149501 210826 2664746 3917430 31.98
crit 12.85 46.52% 403262.12 234366 521087 404409.12 331396 500588 5182799 7619205 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Raging Blow 0 (93935) 0.0% (20.1%) 61.7 4.73sec 457599 410627

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.68 0.00 0.00 0.00 1.1144 0.0000 0.00 0.00 0.00 410626.59 410626.59
 
 

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.juggernaut.down&buff.enrage.up
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r
 
    Raging Blow (_oh) 31311 6.7% 0.0 0.00sec 0 0 Direct 61.7 108054 230990 152519 36.2% 0.0%  

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 61.68 0.00 0.00 0.0000 0.0000 9407211.80 13829492.42 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.37 63.83% 108053.64 73955 142983 108091.32 101457 114604 4254215 6254098 31.98
crit 22.31 36.17% 230989.98 147909 328860 231407.49 211766 264333 5152997 7575394 31.98
 
 

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.95
 
    Raging Blow (_mh) 62624 13.4% 0.0 0.00sec 0 0 Direct 61.7 216181 461685 305080 36.2% 0.0%  

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 61.68 0.00 0.00 0.0000 0.0000 18817206.54 27663076.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.34 63.79% 216181.39 147909 285965 216255.82 203991 230361 8505646 12504106 31.98
crit 22.33 36.21% 461684.52 295819 657720 462523.62 414241 524865 10311560 15158970 31.98
 
 

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.95
 
Rampage 0 (71691) 0.0% (15.3%) 49.5 6.11sec 435070 301559

Stats details: rampage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.51 0.00 0.00 0.00 1.4427 0.0000 0.00 0.00 0.00 301559.14 301559.14
 
 

Action details: rampage

Static Values
  • id:184367
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:2.0000
  • min_gcd:0.7500
  • base_cost:85.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.meat_cleaver.up
Spelldata
  • id:184367
  • name:Rampage
  • school:physical
  • tooltip:
  • description:Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.
 
    Rampage (1) 6189 1.3% 0.0 0.00sec 0 0 Direct 49.5 25962 55357 37562 39.5% 0.0%  

Stats details: rampage1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.51 0.00 0.00 0.0000 0.0000 1859578.74 2733756.90 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.97 60.54% 25961.53 18565 35893 25961.49 22565 28616 778078 1143848 31.98
crit 19.54 39.46% 55357.33 37130 82554 55400.78 47465 65618 1081501 1589909 31.98
 
 

Action details: rampage1

Static Values
  • id:218617
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218617
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.62
 
    Rampage (2) 9826 2.1% 0.0 0.00sec 0 0 Direct 49.5 41302 87878 59682 39.5% 0.0%  

Stats details: rampage2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.46 0.00 0.00 0.0000 0.0000 2951775.21 4339389.15 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.94 60.54% 41302.38 37607 54154 41310.43 38443 45060 1236609 1817932 31.98
crit 19.52 39.46% 87877.81 75214 124555 87968.98 79993 98591 1715167 2521457 31.98
 
 

Action details: rampage2

Static Values
  • id:184707
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184707
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.87
 
    Rampage (3) 13010 2.8% 0.0 0.00sec 0 0 Direct 49.4 54656 116327 79122 39.7% 0.0%  

Stats details: rampage3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.41 0.00 0.00 0.0000 0.0000 3909025.79 5746638.19 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.81 60.33% 54655.84 49851 71786 54668.50 51513 58575 1629100 2394931 31.98
crit 19.60 39.67% 116327.35 99703 165108 116435.47 104545 130882 2279926 3351707 31.98
 
 

Action details: rampage3

Static Values
  • id:184709
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184709
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.24
 
    Rampage (4) 19706 4.2% 0.0 0.00sec 0 0 Direct 49.3 82609 176866 120094 39.8% 0.0%  

Stats details: rampage4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.30 0.00 0.00 0.0000 0.0000 5920399.50 8703548.06 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.69 60.23% 82609.33 75433 108623 82632.10 77815 88364 2452868 3605948 31.98
crit 19.61 39.77% 176865.70 150866 249834 177095.90 156668 211765 3467531 5097600 31.98
 
 

Action details: rampage4

Static Values
  • id:201364
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201364
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
    Rampage (5) 22960 4.9% 0.0 0.00sec 0 0 Direct 49.3 96256 206106 139952 39.8% 0.0%  

Stats details: rampage5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.29 0.00 0.00 0.0000 0.0000 6898383.54 10141277.24 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.68 60.22% 96255.63 87896 126570 96281.93 91048 102884 2857227 4200395 31.98
crit 19.61 39.78% 206105.94 175792 291111 206378.43 185029 235014 4041156 5940883 31.98
 
 

Action details: rampage5

Static Values
  • id:201363
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201363
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.19
 
Rend Flesh 11269 2.4% 45.4 6.65sec 74632 0 Periodic 132.7 17406 37983 25530 39.5% 0.0% 85.9%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.40 0.00 132.73 132.73 0.0000 1.9471 3388667.95 3388667.95 0.00 13111.55 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.3 60.52% 17406.15 6 23852 17410.46 16274 18605 1398228 1398228 0.00
crit 52.4 39.48% 37982.91 12 54859 38012.90 34076 42315 1990440 1990440 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:12167.02
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Warrior_Fury_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_T19M
  • harmful:false
  • if_expr:
 
Avatar 4.1 86.13sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 7.4 43.66sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.45 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:50.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Berserking 2.0 181.22sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.battle_cry.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_T19M
  • harmful:false
  • if_expr:
 
Heroic Leap 12.0 26.35sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 4.1 0.0 85.9sec 86.1sec 26.11% 26.11% 0.0(0.0) 3.7

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:26.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 7.4 0.0 43.3sec 43.7sec 12.29% 12.29% 0.0(0.0) 7.3

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:12.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Berserking 2.0 0.0 199.9sec 181.5sec 6.77% 8.46% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking (_) 6.3 66.9 46.6sec 3.5sec 28.18% 28.18% 0.0(0.0) 5.8

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_berserking_
  • max_stacks:12
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03

Stack Uptimes

  • berserking__1:2.09%
  • berserking__2:2.07%
  • berserking__3:2.06%
  • berserking__4:2.05%
  • berserking__5:2.04%
  • berserking__6:2.03%
  • berserking__7:2.02%
  • berserking__8:2.01%
  • berserking__9:2.00%
  • berserking__10:1.99%
  • berserking__11:1.97%
  • berserking__12:5.85%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:200953
  • name:Berserking
  • tooltip:Attack speed and critical strike chance increased by {$s1=3}%.
  • description:{$@spelldesc200845=Rampage and Execute have a chance to activate Berserking, increasing your attack speed and critical strike chance by {$200953s1=3}% every $200951t sec for {$200951d=12 seconds}.}
  • max_stacks:12
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 17.92% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dragon Roar 13.7 0.0 22.7sec 22.7sec 27.10% 27.10% 0.0(0.0) 13.4

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_dragon_roar
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • dragon_roar_1:27.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118000
  • name:Dragon Roar
  • tooltip:Damage done increased by {$s2=20}%.
  • description:Roar explosively, dealing $m1 damage to all enemies within $A1 yards and increasing all damage you deal by {$s2=20}% for {$d=6 seconds}. Dragon Roar ignores all armor and always critically strikes.
  • max_stacks:0
  • duration:6.00
  • cooldown:25.00
  • default_chance:0.00%
Enrage 15.1 59.4 18.8sec 4.0sec 92.61% 94.45% 59.4(59.4) 14.1

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:5.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • enrage_1:92.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184362
  • name:Enrage
  • tooltip:Attack speed increased by {$s1=100}% and damage taken increased by {$s2=20}%.
  • description:{$@spelldesc184361=Bloodthirst critical strikes $?a206320[or activating Berserker Rage ][]will Enrage you, increasing your attack speed by {$184362s1=100}% and damage you take by {$184362s2=20}% for {$184362d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Juggernaut 13.7 30.4 19.1sec 6.8sec 50.46% 68.93% 0.0(0.0) 12.7

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_juggernaut
  • max_stacks:99
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05

Stack Uptimes

  • juggernaut_1:23.19%
  • juggernaut_2:7.11%
  • juggernaut_3:2.58%
  • juggernaut_4:1.28%
  • juggernaut_5:0.88%
  • juggernaut_6:0.78%
  • juggernaut_7:0.74%
  • juggernaut_8:0.74%
  • juggernaut_9:0.75%
  • juggernaut_10:0.75%
  • juggernaut_11:0.75%
  • juggernaut_12:0.76%
  • juggernaut_13:0.75%
  • juggernaut_14:0.76%
  • juggernaut_15:0.76%
  • juggernaut_16:0.75%
  • juggernaut_17:0.76%
  • juggernaut_18:0.76%
  • juggernaut_19:0.75%
  • juggernaut_20:0.74%
  • juggernaut_21:0.71%
  • juggernaut_22:0.67%
  • juggernaut_23:0.60%
  • juggernaut_24:0.50%
  • juggernaut_25:0.42%
  • juggernaut_26:0.33%
  • juggernaut_27:0.26%
  • juggernaut_28:0.20%
  • juggernaut_29:0.15%
  • juggernaut_30:0.11%
  • juggernaut_31:0.08%
  • juggernaut_32:0.05%
  • juggernaut_33:0.03%
  • juggernaut_34:0.03%
  • juggernaut_35:0.01%
  • juggernaut_36:0.01%
  • juggernaut_37:0.01%
  • juggernaut_38:0.00%
  • juggernaut_39:0.00%
  • juggernaut_40:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201009
  • name:Juggernaut
  • tooltip:Execute damage increased by {$s1=5}%.
  • description:{$@spelldesc200875=Execute increases damage dealt by Execute by {$201009s1=5}% for {$201009d=6 seconds}, stacking up to {$201009u=99} times.}
  • max_stacks:99
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Massacre 23.2 22.7 13.3sec 6.6sec 19.73% 19.73% 22.7(22.7) 0.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_massacre
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • massacre_1:19.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206316
  • name:Massacre
  • tooltip:Rampage costs no Rage.
  • description:{$@spelldesc206315=Execute critical strikes reduce the Rage cost of your next Rampage by {$206316s1=100}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Odyn's Champion 8.8 1.0 32.1sec 28.5sec 18.76% 15.91% 1.0(1.0) 8.6

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_odyns_champion
  • max_stacks:1
  • duration:6.00
  • cooldown:0.10
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • odyns_champion_1:18.76%

Trigger Attempt Success

  • trigger_pct:19.97%

Spelldata details

  • id:200986
  • name:Odyn's Champion
  • tooltip:All special ability uses will reduce the cooldown of all abilities by {$200872s1=1} sec.
  • description:{$@spelldesc200872=When you use Rampage, Odyn has a chance to declare you the Champion of the Valarjar for {$200986d=6 seconds}, causing all your offensive abilities to reduce the cooldown of all your abilities by {$s1=1} sec.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 260.2sec 0.0sec 16.22% 16.22% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Sense Death 6.6 0.0 38.2sec 37.2sec 10.16% 10.16% 0.0(0.0) 1.2

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_sense_death
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • sense_death_1:10.16%

Trigger Attempt Success

  • trigger_pct:14.86%

Spelldata details

  • id:200979
  • name:Sense Death
  • tooltip:Your next Execute will cost 0 rage.
  • description:{$@spelldesc200863=Execute has a {$h=15}% chance to make your next Execute cost no Rage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Stone Heart 22.2 1.2 13.6sec 12.9sec 5.91% 5.91% 1.2(1.2) 0.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_stone_heart
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stone_heart_1:5.91%

Trigger Attempt Success

  • trigger_pct:2.04%

Spelldata details

  • id:225947
  • name:Stone Heart
  • tooltip:Execute costs no Rage and can be used on any target.
  • description:{$@spelldesc207767=Your attacks have a chance to make your next Execute cost no $?s12712[initial ][]Rage$?s12712[, consume no extra Rage,][] and be usable on any target, regardless of health level.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Taste for Blood 22.1 5.4 10.9sec 8.7sec 42.57% 42.57% 0.0(0.0) 5.2

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_taste_for_blood
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • taste_for_blood_1:35.26%
  • taste_for_blood_2:6.53%
  • taste_for_blood_3:0.76%
  • taste_for_blood_4:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206333
  • name:Taste for Blood
  • tooltip:Critical strike chance of Bloodthirst increased by {$s1=15}%.
  • description:Furious Slash increases the critical strike chance of Bloodthirst by {$s1=15}%.
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Heroic Leap0.7510.0011.5502.5470.0009.548
Battle Cry1.6910.0013.6150.5910.0009.101
Avatar5.2930.00116.2756.3500.00036.353
Bloodthirst1.9100.00574.35294.64136.011179.823
Odyn's Fury5.6040.001100.51516.9170.000152.826
Dragon Roar1.6390.00116.7628.2120.00029.113

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Fury_T19M
execute Rage 44.1 481.4 10.9 10.9 65027.6
rampage Rage 49.5 2287.2 46.2 46.2 9417.1
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 35.00 (1.25%) 35.00 0.00 0.00%
bloodthirst Rage 50.56 483.26 (17.26%) 9.56 22.37 4.42%
raging_blow Rage 61.68 295.97 (10.57%) 4.80 12.43 4.03%
melee_main_hand Rage 223.82 1349.27 (48.18%) 6.03 127.92 8.66%
melee_off_hand Rage 223.81 636.72 (22.74%) 2.84 101.86 13.79%
Resource RPS-Gain RPS-Loss
Health 9253.43 0.00
Rage 9.31 9.21
Combat End Resource Mean Min Max
Rage 31.96 0.10 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 9.4%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Warrior_Fury_T19M Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Warrior_Fury_T19M Damage Per Second
Count 7499
Mean 467463.36
Minimum 415194.86
Maximum 529215.74
Spread ( max - min ) 114020.87
Range [ ( max - min ) / 2 * 100% ] 12.20%
Standard Deviation 16020.9345
5th Percentile 441909.33
95th Percentile 494602.30
( 95th Percentile - 5th Percentile ) 52692.96
Mean Distribution
Standard Deviation 185.0062
95.00% Confidence Intervall ( 467100.76 - 467825.97 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4512
0.1 Scale Factor Error with Delta=300 2191085
0.05 Scale Factor Error with Delta=300 8764342
0.01 Scale Factor Error with Delta=300 219108567
Priority Target DPS
Sample Data Warrior_Fury_T19M Priority Target Damage Per Second
Count 7499
Mean 467463.36
Minimum 415194.86
Maximum 529215.74
Spread ( max - min ) 114020.87
Range [ ( max - min ) / 2 * 100% ] 12.20%
Standard Deviation 16020.9345
5th Percentile 441909.33
95th Percentile 494602.30
( 95th Percentile - 5th Percentile ) 52692.96
Mean Distribution
Standard Deviation 185.0062
95.00% Confidence Intervall ( 467100.76 - 467825.97 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4512
0.1 Scale Factor Error with Delta=300 2191085
0.05 Scale Factor Error with Delta=300 8764342
0.01 Scale Factor Error with Delta=300 219108567
DPS(e)
Sample Data Warrior_Fury_T19M Damage Per Second (Effective)
Count 7499
Mean 467463.36
Minimum 415194.86
Maximum 529215.74
Spread ( max - min ) 114020.87
Range [ ( max - min ) / 2 * 100% ] 12.20%
Damage
Sample Data Warrior_Fury_T19M Damage
Count 7499
Mean 140392032.97
Minimum 102540331.92
Maximum 184044143.23
Spread ( max - min ) 81503811.31
Range [ ( max - min ) / 2 * 100% ] 29.03%
DTPS
Sample Data Warrior_Fury_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Warrior_Fury_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Warrior_Fury_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Warrior_Fury_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Warrior_Fury_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Warrior_Fury_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Warrior_Fury_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Warrior_Fury_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 1.00 charge
7 0.00 run_action_list,name=movement,if=movement.distance>5
8 11.95 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
9 2.87 use_item,name=draught_of_souls,if=(spell_targets.whirlwind>1|!raid_event.adds.exists)&((talent.bladestorm.enabled&cooldown.bladestorm.remains=0)|buff.battle_cry.up|target.time_to_die<25)
A 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
B 7.45 battle_cry,if=(cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))
C 4.10 avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
0.00 bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
0.00 blood_fury,if=buff.battle_cry.up
D 2.01 berserking,if=buff.battle_cry.up
0.00 arcane_torrent,if=rage<rage.max-40
E 0.00 call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
F 0.00 call_action_list,name=aoe,if=spell_targets.whirlwind>3
G 0.00 call_action_list,name=single_target
actions.single_target
# count action,conditions
0.00 bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
I 21.06 execute,if=(artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2))|buff.stone_heart.react
J 45.62 rampage,if=rage=100&(target.health.pct>20|target.health.pct<20&!talent.massacre.enabled)|buff.massacre.react&buff.enrage.remains<1
0.00 berserker_rage,if=talent.outburst.enabled&cooldown.odyns_fury.remains=0&buff.enrage.down
K 13.71 dragon_roar,if=cooldown.odyns_fury.remains>=10|cooldown.odyns_fury.remains<=3
L 7.25 odyns_fury,if=buff.battle_cry.up&buff.enrage.up
M 3.89 rampage,if=buff.enrage.down&buff.juggernaut.down
0.00 furious_slash,if=talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
N 35.37 raging_blow,if=buff.juggernaut.down&buff.enrage.up
0.00 whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
O 23.06 execute,if=talent.inner_rage.enabled|!talent.inner_rage.enabled&rage>50
P 7.78 bloodthirst,if=buff.enrage.down
Q 2.91 raging_blow,if=buff.enrage.down
0.00 execute,if=artifact.juggernaut.enabled
R 23.40 raging_blow
S 42.79 bloodthirst
T 27.50 furious_slash
U 0.00 call_action_list,name=bladestorm
0.00 bloodbath,if=buff.frothing_berserker.up|(rage>80&!talent.frothing_berserker.enabled)

Sample Sequence

0124568B9CDIJKILRSJRJSNTSNIJK8JRSTNSIJRSTIJBLRJSKNSTNJ8SNTIRJJIRSTQPTNJKNSTQPTJN8STNSTJNBCLSKIRJJRSTNPIJ8JRSTNSJKNSTQPJNSTNSJNSTNB9P8LJNIKJRSTJNSTNSTJNI8KRPTRJSNTSNJSBCLNSKN8JSNTSNTJNISRTSJNISKRSJJN8STNPIJRBDLSNTSJNSKNPJNSTNPTN8JSNTSQMSNTIRPTRJSIKJORIB9ACJ8LOOJOOOROJROOJKOROJR8OSJOOOJOOOJBIKLJ

Sample Sequence Table

time name target resources buffs
Pre flask Warrior_Fury_T19M 0.0/100: 0% rage
Pre food Warrior_Fury_T19M 0.0/100: 0% rage
Pre augmentation Warrior_Fury_T19M 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% rage potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% rage potion_of_the_old_war
0:00.000 charge Fluffy_Pillow 9.9/100: 10% rage bloodlust, stone_heart, potion_of_the_old_war
0:00.000 heroic_leap Fluffy_Pillow 44.9/100: 45% rage bloodlust, stone_heart, potion_of_the_old_war
0:00.000 battle_cry Fluffy_Pillow 44.9/100: 45% rage bloodlust, stone_heart, potion_of_the_old_war
0:00.000 use_item_draught_of_souls Fluffy_Pillow 44.9/100: 45% rage bloodlust, battle_cry, stone_heart, potion_of_the_old_war
0:00.000 avatar Fluffy_Pillow 44.9/100: 45% rage bloodlust, battle_cry, stone_heart, potion_of_the_old_war
0:00.000 berserking Fluffy_Pillow 44.9/100: 45% rage bloodlust, avatar, battle_cry, stone_heart, potion_of_the_old_war
0:00.000 execute Fluffy_Pillow 44.9/100: 45% rage bloodlust, berserking, avatar, battle_cry, stone_heart, potion_of_the_old_war
0:00.786 rampage Fluffy_Pillow 44.9/100: 45% rage bloodlust, berserking, massacre, avatar, sense_death, juggernaut, battle_cry, potion_of_the_old_war
0:01.834 dragon_roar Fluffy_Pillow 44.9/100: 45% rage bloodlust, berserking, avatar, enrage, sense_death, juggernaut, battle_cry, stone_heart, potion_of_the_old_war
0:02.623 execute Fluffy_Pillow 54.8/100: 55% rage bloodlust, berserking, avatar, dragon_roar, enrage, sense_death, juggernaut, odyns_champion, battle_cry, stone_heart, potion_of_the_old_war
0:03.411 odyns_fury Fluffy_Pillow 64.7/100: 65% rage bloodlust, berserking, massacre, avatar, dragon_roar, enrage, juggernaut(2), odyns_champion, battle_cry, potion_of_the_old_war
0:04.200 raging_blow Fluffy_Pillow 74.6/100: 75% rage bloodlust, berserking, massacre, avatar, dragon_roar, enrage, juggernaut(2), odyns_champion, battle_cry, potion_of_the_old_war
0:04.986 bloodthirst Fluffy_Pillow 89.5/100: 89% rage bloodlust, berserking, massacre, avatar, dragon_roar, enrage, juggernaut(2), odyns_champion, battle_cry, potion_of_the_old_war
0:05.774 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, berserking, massacre, avatar, dragon_roar, enrage, juggernaut(2), odyns_champion, potion_of_the_old_war
0:06.825 raging_blow Fluffy_Pillow 100.0/100: 100% rage bloodlust, berserking, avatar, dragon_roar, enrage, juggernaut(2), odyns_champion, berserking_, potion_of_the_old_war
0:07.613 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, berserking, avatar, dragon_roar, enrage, juggernaut(2), odyns_champion, berserking_, potion_of_the_old_war
0:08.664 bloodthirst Fluffy_Pillow 24.9/100: 25% rage bloodlust, berserking, avatar, enrage, odyns_champion, berserking_(2), potion_of_the_old_war
0:09.451 raging_blow Fluffy_Pillow 44.8/100: 45% rage bloodlust, berserking, avatar, enrage, odyns_champion, berserking_(3), potion_of_the_old_war
0:10.274 furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, avatar, enrage, odyns_champion, berserking_(4), potion_of_the_old_war
0:11.180 bloodthirst Fluffy_Pillow 69.6/100: 70% rage bloodlust, avatar, enrage, taste_for_blood, odyns_champion, berserking_(5), potion_of_the_old_war
0:12.086 raging_blow Fluffy_Pillow 89.5/100: 89% rage bloodlust, avatar, enrage, odyns_champion, berserking_(6), potion_of_the_old_war
0:12.991 execute Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, enrage, odyns_champion, berserking_(7), stone_heart, potion_of_the_old_war
0:13.896 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, massacre, avatar, enrage, sense_death, juggernaut, odyns_champion, berserking_(8), potion_of_the_old_war
0:15.103 dragon_roar Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, enrage, sense_death, juggernaut, berserking_(9), potion_of_the_old_war
0:16.009 heroic_leap Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, dragon_roar, enrage, sense_death, juggernaut, odyns_champion, berserking_(10), potion_of_the_old_war
0:16.009 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, dragon_roar, enrage, sense_death, juggernaut, odyns_champion, berserking_(10), potion_of_the_old_war
0:17.216 raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, avatar, dragon_roar, enrage, sense_death, juggernaut, odyns_champion, berserking_(11), potion_of_the_old_war
0:18.121 bloodthirst Fluffy_Pillow 49.7/100: 50% rage bloodlust, avatar, dragon_roar, enrage, sense_death, juggernaut, odyns_champion, berserking_(12), potion_of_the_old_war
0:19.026 furious_slash Fluffy_Pillow 69.6/100: 70% rage bloodlust, avatar, dragon_roar, enrage, sense_death, odyns_champion, berserking_(12), potion_of_the_old_war
0:19.931 raging_blow Fluffy_Pillow 79.5/100: 79% rage bloodlust, avatar, dragon_roar, enrage, taste_for_blood, sense_death, odyns_champion, berserking_(12), potion_of_the_old_war
0:20.834 bloodthirst Fluffy_Pillow 94.4/100: 94% rage bloodlust, dragon_roar, enrage, taste_for_blood, sense_death, odyns_champion, potion_of_the_old_war
0:21.739 execute Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, sense_death, odyns_champion, stone_heart, potion_of_the_old_war
0:22.646 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, juggernaut, odyns_champion, potion_of_the_old_war
0:23.852 raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, enrage, juggernaut
0:24.757 bloodthirst Fluffy_Pillow 39.8/100: 40% rage bloodlust, enrage, juggernaut
0:25.663 furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, enrage, juggernaut
0:26.567 execute Fluffy_Pillow 59.7/100: 60% rage bloodlust, enrage, taste_for_blood, juggernaut, stone_heart
0:27.473 rampage Fluffy_Pillow 69.6/100: 70% rage bloodlust, massacre, enrage, taste_for_blood, juggernaut(2)
0:28.000 battle_cry Fluffy_Pillow 79.5/100: 79% rage bloodlust, enrage, taste_for_blood, juggernaut(2), battle_cry
0:28.680 odyns_fury Fluffy_Pillow 79.5/100: 79% rage bloodlust, enrage, taste_for_blood, juggernaut(2), battle_cry
0:29.586 raging_blow Fluffy_Pillow 89.4/100: 89% rage bloodlust, enrage, taste_for_blood, juggernaut(2), battle_cry
0:30.492 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, taste_for_blood, juggernaut(2), battle_cry
0:31.698 bloodthirst Fluffy_Pillow 24.9/100: 25% rage bloodlust, enrage, taste_for_blood, juggernaut(2), battle_cry
0:32.604 dragon_roar Fluffy_Pillow 44.8/100: 45% rage bloodlust, enrage, battle_cry
0:33.509 raging_blow Fluffy_Pillow 54.7/100: 55% rage bloodlust, dragon_roar, enrage
0:34.414 bloodthirst Fluffy_Pillow 69.6/100: 70% rage bloodlust, dragon_roar, enrage
0:35.320 furious_slash Fluffy_Pillow 89.5/100: 89% rage bloodlust, dragon_roar, enrage
0:36.225 raging_blow Fluffy_Pillow 89.5/100: 89% rage bloodlust, dragon_roar, enrage, taste_for_blood
0:37.132 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, dragon_roar, enrage, taste_for_blood
0:38.338 heroic_leap Fluffy_Pillow 24.9/100: 25% rage bloodlust, dragon_roar, enrage, taste_for_blood
0:38.338 bloodthirst Fluffy_Pillow 24.9/100: 25% rage bloodlust, dragon_roar, enrage, taste_for_blood
0:39.243 raging_blow Fluffy_Pillow 44.8/100: 45% rage bloodlust, enrage
0:40.196 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage
0:41.373 execute Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, stone_heart
0:42.550 raging_blow Fluffy_Pillow 79.5/100: 79% rage massacre, enrage, taste_for_blood, juggernaut
0:43.725 rampage Fluffy_Pillow 84.5/100: 84% rage massacre, enrage, taste_for_blood, juggernaut
0:45.230 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, juggernaut
0:46.735 execute Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, juggernaut, stone_heart
0:47.912 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, juggernaut(2)
0:49.088 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, juggernaut(2)
0:50.265 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, juggernaut(2)
0:51.442 raging_blow Fluffy_Pillow 69.6/100: 70% rage taste_for_blood, juggernaut(2)
0:52.619 bloodthirst Fluffy_Pillow 74.6/100: 75% rage taste_for_blood, juggernaut(2)
0:53.794 furious_slash Fluffy_Pillow 94.5/100: 94% rage enrage
0:54.970 raging_blow Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood
0:56.147 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
0:57.654 dragon_roar Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood
0:58.831 raging_blow Fluffy_Pillow 34.8/100: 35% rage dragon_roar, enrage, taste_for_blood
1:00.009 bloodthirst Fluffy_Pillow 49.7/100: 50% rage dragon_roar, enrage, taste_for_blood
1:01.183 furious_slash Fluffy_Pillow 69.6/100: 70% rage dragon_roar, enrage, taste_for_blood
1:02.361 raging_blow Fluffy_Pillow 76.2/100: 76% rage dragon_roar, taste_for_blood(2)
1:03.539 bloodthirst Fluffy_Pillow 81.2/100: 81% rage dragon_roar, taste_for_blood(2)
1:04.716 furious_slash Fluffy_Pillow 91.2/100: 91% rage enrage
1:05.893 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
1:07.397 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood
1:08.575 heroic_leap Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood
1:08.575 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood
1:09.752 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage
1:10.927 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood
1:12.104 bloodthirst Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood
1:13.280 furious_slash Fluffy_Pillow 94.5/100: 94% rage enrage
1:14.456 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
1:15.962 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, odyns_champion
1:17.000 battle_cry Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, odyns_champion, battle_cry
1:17.100 avatar Fluffy_Pillow 39.8/100: 40% rage avatar, enrage, taste_for_blood, odyns_champion, battle_cry
1:17.140 odyns_fury Fluffy_Pillow 39.8/100: 40% rage avatar, enrage, taste_for_blood, odyns_champion, battle_cry
1:18.317 bloodthirst Fluffy_Pillow 49.7/100: 50% rage avatar, enrage, taste_for_blood, odyns_champion, battle_cry
1:19.494 dragon_roar Fluffy_Pillow 69.6/100: 70% rage avatar, enrage, odyns_champion, battle_cry
1:20.831 execute Fluffy_Pillow 79.5/100: 79% rage avatar, dragon_roar, enrage, odyns_champion, battle_cry, stone_heart
1:22.006 raging_blow Fluffy_Pillow 89.4/100: 89% rage massacre, avatar, dragon_roar, enrage, juggernaut
1:23.183 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, avatar, dragon_roar, enrage, juggernaut
1:24.686 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, dragon_roar, enrage, juggernaut, berserking_
1:26.192 raging_blow Fluffy_Pillow 24.9/100: 25% rage avatar, enrage, juggernaut, berserking_(3)
1:27.369 bloodthirst Fluffy_Pillow 39.8/100: 40% rage avatar, enrage, berserking_(4)
1:28.547 furious_slash Fluffy_Pillow 59.7/100: 60% rage avatar, enrage, berserking_(5)
1:29.723 raging_blow Fluffy_Pillow 59.7/100: 60% rage avatar, enrage, taste_for_blood, berserking_(6)
1:30.900 bloodthirst Fluffy_Pillow 74.6/100: 75% rage avatar, taste_for_blood, berserking_(7)
1:32.076 execute Fluffy_Pillow 94.5/100: 94% rage avatar, enrage, berserking_(8), stone_heart
1:33.253 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, avatar, enrage, sense_death, juggernaut, berserking_(10)
1:34.758 heroic_leap Fluffy_Pillow 100.0/100: 100% rage avatar, enrage, sense_death, juggernaut, berserking_(11)
1:34.758 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, enrage, sense_death, juggernaut, berserking_(11)
1:36.263 raging_blow Fluffy_Pillow 24.9/100: 25% rage avatar, enrage, sense_death, juggernaut, berserking_(12)
1:37.440 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, sense_death, juggernaut, berserking_(12)
1:38.617 furious_slash Fluffy_Pillow 69.6/100: 70% rage enrage, sense_death
1:39.793 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, sense_death
1:40.969 bloodthirst Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood, sense_death
1:42.146 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, sense_death
1:43.652 dragon_roar Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, sense_death, berserking_
1:44.830 raging_blow Fluffy_Pillow 34.8/100: 35% rage dragon_roar, enrage, taste_for_blood, berserking_(2)
1:46.008 bloodthirst Fluffy_Pillow 49.7/100: 50% rage dragon_roar, enrage, taste_for_blood, berserking_(3)
1:47.184 furious_slash Fluffy_Pillow 69.6/100: 70% rage dragon_roar, enrage, berserking_(5)
1:48.360 raging_blow Fluffy_Pillow 79.5/100: 79% rage dragon_roar, taste_for_blood, berserking_(6)
1:49.538 bloodthirst Fluffy_Pillow 84.5/100: 84% rage dragon_roar, taste_for_blood, berserking_(7)
1:50.714 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, berserking_(8)
1:52.217 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, berserking_(10)
1:53.394 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, berserking_(11)
1:54.571 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, berserking_(12)
1:55.747 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, berserking_(12)
1:56.922 bloodthirst Fluffy_Pillow 94.4/100: 94% rage enrage, taste_for_blood, berserking_(12)
1:58.097 rampage Fluffy_Pillow 100.0/100: 100% rage enrage
1:59.602 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage
2:00.779 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage
2:01.956 furious_slash Fluffy_Pillow 49.8/100: 50% rage enrage
2:03.132 raging_blow Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood
2:04.308 battle_cry Fluffy_Pillow 74.6/100: 75% rage taste_for_blood
2:04.308 use_item_draught_of_souls Fluffy_Pillow 74.6/100: 75% rage taste_for_blood, battle_cry
2:04.308 bloodthirst Fluffy_Pillow 74.6/100: 75% rage taste_for_blood, battle_cry
2:05.482 heroic_leap Fluffy_Pillow 94.5/100: 94% rage enrage, battle_cry
2:05.482 odyns_fury Fluffy_Pillow 94.5/100: 94% rage enrage, battle_cry
2:06.660 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, battle_cry
2:08.163 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, battle_cry
2:09.340 execute Fluffy_Pillow 39.8/100: 40% rage enrage, stone_heart
2:10.515 dragon_roar Fluffy_Pillow 39.8/100: 40% rage massacre, enrage, juggernaut
2:11.691 rampage Fluffy_Pillow 49.7/100: 50% rage massacre, dragon_roar, enrage, juggernaut
2:13.196 raging_blow Fluffy_Pillow 59.6/100: 60% rage dragon_roar, enrage, juggernaut
2:14.373 bloodthirst Fluffy_Pillow 74.5/100: 74% rage dragon_roar, enrage, juggernaut
2:15.550 furious_slash Fluffy_Pillow 94.4/100: 94% rage dragon_roar, enrage
2:16.725 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
2:18.228 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, odyns_champion
2:19.402 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, odyns_champion
2:20.579 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, odyns_champion
2:21.755 raging_blow Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood, odyns_champion
2:22.931 bloodthirst Fluffy_Pillow 74.6/100: 75% rage enrage, taste_for_blood, odyns_champion
2:24.108 furious_slash Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood
2:25.287 rampage Fluffy_Pillow 100.0/100: 100% rage taste_for_blood(2)
2:26.791 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood(2), odyns_champion
2:27.967 execute Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood(2), odyns_champion, stone_heart
2:29.144 heroic_leap Fluffy_Pillow 49.7/100: 50% rage enrage, taste_for_blood(2), juggernaut, odyns_champion
2:29.144 dragon_roar Fluffy_Pillow 49.7/100: 50% rage enrage, taste_for_blood(2), juggernaut, odyns_champion
2:30.322 raging_blow Fluffy_Pillow 59.6/100: 60% rage dragon_roar, enrage, taste_for_blood(2), juggernaut, odyns_champion
2:31.500 bloodthirst Fluffy_Pillow 64.6/100: 65% rage dragon_roar, taste_for_blood(2), juggernaut, odyns_champion
2:32.678 furious_slash Fluffy_Pillow 84.5/100: 84% rage dragon_roar, enrage, juggernaut
2:33.856 raging_blow Fluffy_Pillow 94.4/100: 94% rage dragon_roar, enrage, taste_for_blood, juggernaut
2:35.032 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage, taste_for_blood
2:36.537 bloodthirst Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, berserking_
2:37.713 raging_blow Fluffy_Pillow 44.8/100: 45% rage enrage, berserking_(2)
2:38.890 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, berserking_(3)
2:40.067 bloodthirst Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, berserking_(5)
2:41.243 raging_blow Fluffy_Pillow 89.5/100: 89% rage enrage, berserking_(6)
2:42.420 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, berserking_(7)
2:43.923 bloodthirst Fluffy_Pillow 24.9/100: 25% rage enrage, odyns_champion, berserking_(8)
2:43.923 battle_cry Fluffy_Pillow 34.9/100: 35% rage enrage, odyns_champion, battle_cry, berserking_(8)
2:43.923 avatar Fluffy_Pillow 34.9/100: 35% rage avatar, enrage, odyns_champion, battle_cry, berserking_(8)
2:45.099 odyns_fury Fluffy_Pillow 44.8/100: 45% rage avatar, enrage, odyns_champion, battle_cry, berserking_(10)
2:46.276 raging_blow Fluffy_Pillow 54.7/100: 55% rage avatar, enrage, odyns_champion, battle_cry, berserking_(11)
2:47.453 bloodthirst Fluffy_Pillow 69.6/100: 70% rage avatar, enrage, odyns_champion, battle_cry, berserking_(12)
2:48.629 dragon_roar Fluffy_Pillow 89.5/100: 89% rage avatar, enrage, odyns_champion, battle_cry, berserking_(12)
2:49.805 raging_blow Fluffy_Pillow 99.4/100: 99% rage avatar, dragon_roar, enrage, berserking_(12)
2:50.982 heroic_leap Fluffy_Pillow 100.0/100: 100% rage avatar, dragon_roar, enrage
2:51.144 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, dragon_roar, enrage
2:52.650 bloodthirst Fluffy_Pillow 24.9/100: 25% rage avatar, dragon_roar, enrage
2:53.827 raging_blow Fluffy_Pillow 44.8/100: 45% rage avatar, dragon_roar, enrage
2:55.002 furious_slash Fluffy_Pillow 49.8/100: 50% rage avatar, enrage
2:56.181 bloodthirst Fluffy_Pillow 59.7/100: 60% rage avatar, enrage, taste_for_blood
2:57.356 raging_blow Fluffy_Pillow 79.6/100: 80% rage avatar, enrage
2:58.532 furious_slash Fluffy_Pillow 94.5/100: 94% rage avatar, enrage
2:59.709 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, enrage, taste_for_blood
3:01.213 raging_blow Fluffy_Pillow 24.9/100: 25% rage avatar, enrage, taste_for_blood
3:02.390 execute Fluffy_Pillow 39.8/100: 40% rage avatar, enrage, taste_for_blood, stone_heart
3:03.567 bloodthirst Fluffy_Pillow 39.8/100: 40% rage avatar, enrage, taste_for_blood, juggernaut
3:04.742 raging_blow Fluffy_Pillow 59.7/100: 60% rage enrage, juggernaut
3:05.919 furious_slash Fluffy_Pillow 74.6/100: 75% rage enrage, juggernaut
3:07.096 bloodthirst Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood, juggernaut
3:08.273 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, juggernaut
3:09.780 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood
3:10.958 execute Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, stone_heart
3:12.135 bloodthirst Fluffy_Pillow 49.7/100: 50% rage massacre, enrage, taste_for_blood, juggernaut
3:13.312 dragon_roar Fluffy_Pillow 59.7/100: 60% rage massacre, enrage, juggernaut
3:14.490 raging_blow Fluffy_Pillow 69.6/100: 70% rage massacre, dragon_roar, enrage, juggernaut
3:15.665 bloodthirst Fluffy_Pillow 84.5/100: 84% rage massacre, dragon_roar, enrage, juggernaut
3:16.842 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, dragon_roar, enrage, juggernaut
3:18.345 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage
3:19.850 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage
3:21.025 heroic_leap Fluffy_Pillow 39.8/100: 40% rage enrage
3:21.144 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage
3:22.321 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage
3:23.498 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood
3:24.675 bloodthirst Fluffy_Pillow 74.6/100: 75% rage taste_for_blood
3:25.852 execute Fluffy_Pillow 94.5/100: 94% rage enrage, stone_heart
3:27.027 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, juggernaut
3:28.532 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, juggernaut
3:29.710 battle_cry Fluffy_Pillow 39.8/100: 40% rage enrage, juggernaut
3:29.923 berserking Fluffy_Pillow 39.8/100: 40% rage enrage, juggernaut, battle_cry
3:29.923 odyns_fury Fluffy_Pillow 39.8/100: 40% rage berserking, enrage, juggernaut, battle_cry
3:30.945 bloodthirst Fluffy_Pillow 49.7/100: 50% rage berserking, enrage, juggernaut, battle_cry
3:31.969 raging_blow Fluffy_Pillow 69.6/100: 70% rage berserking, enrage, battle_cry
3:32.991 furious_slash Fluffy_Pillow 84.5/100: 84% rage berserking, enrage, battle_cry
3:34.015 bloodthirst Fluffy_Pillow 94.4/100: 94% rage berserking, enrage, taste_for_blood, battle_cry
3:35.040 rampage Fluffy_Pillow 100.0/100: 100% rage berserking, enrage
3:36.403 raging_blow Fluffy_Pillow 24.9/100: 25% rage berserking, enrage
3:37.427 bloodthirst Fluffy_Pillow 39.8/100: 40% rage berserking, enrage
3:38.452 dragon_roar Fluffy_Pillow 59.7/100: 60% rage berserking, enrage
3:39.475 raging_blow Fluffy_Pillow 69.6/100: 70% rage berserking, dragon_roar, enrage
3:40.585 bloodthirst Fluffy_Pillow 84.5/100: 84% rage dragon_roar
3:41.761 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar
3:43.265 raging_blow Fluffy_Pillow 15.0/100: 15% rage dragon_roar, enrage
3:44.442 bloodthirst Fluffy_Pillow 29.9/100: 30% rage dragon_roar, enrage
3:45.619 furious_slash Fluffy_Pillow 39.9/100: 40% rage enrage
3:46.796 raging_blow Fluffy_Pillow 49.8/100: 50% rage enrage, taste_for_blood
3:47.972 bloodthirst Fluffy_Pillow 64.7/100: 65% rage taste_for_blood
3:49.150 furious_slash Fluffy_Pillow 84.6/100: 85% rage enrage
3:50.325 raging_blow Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood
3:51.502 heroic_leap Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
3:51.502 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
3:53.006 bloodthirst Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood
3:54.182 raging_blow Fluffy_Pillow 34.9/100: 35% rage enrage, taste_for_blood
3:55.359 furious_slash Fluffy_Pillow 49.8/100: 50% rage enrage, taste_for_blood
3:56.536 bloodthirst Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood(2)
3:57.715 raging_blow Fluffy_Pillow 79.6/100: 80% rage taste_for_blood(2)
3:58.892 rampage Fluffy_Pillow 94.5/100: 94% rage taste_for_blood(2)
4:00.397 bloodthirst Fluffy_Pillow 9.5/100: 9% rage enrage, taste_for_blood(2)
4:01.573 raging_blow Fluffy_Pillow 29.4/100: 29% rage enrage
4:02.750 furious_slash Fluffy_Pillow 44.3/100: 44% rage enrage
4:03.927 execute Fluffy_Pillow 44.3/100: 44% rage enrage, taste_for_blood, stone_heart
4:05.104 raging_blow Fluffy_Pillow 54.2/100: 54% rage enrage, taste_for_blood, juggernaut
4:06.280 bloodthirst Fluffy_Pillow 69.1/100: 69% rage taste_for_blood, juggernaut
4:07.455 furious_slash Fluffy_Pillow 89.0/100: 89% rage enrage, juggernaut
4:08.631 raging_blow Fluffy_Pillow 98.9/100: 99% rage enrage, taste_for_blood, juggernaut
4:09.808 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, juggernaut
4:11.312 bloodthirst Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood
4:12.487 execute Fluffy_Pillow 44.8/100: 45% rage enrage, taste_for_blood
4:13.664 dragon_roar Fluffy_Pillow 19.8/100: 20% rage massacre, enrage, taste_for_blood, juggernaut
4:14.840 rampage Fluffy_Pillow 29.7/100: 30% rage massacre, dragon_roar, enrage, taste_for_blood, juggernaut
4:16.345 execute Fluffy_Pillow 39.6/100: 40% rage dragon_roar, enrage, juggernaut
4:17.520 raging_blow Fluffy_Pillow 24.5/100: 25% rage massacre, dragon_roar, enrage, juggernaut(2)
4:18.698 execute Fluffy_Pillow 39.4/100: 39% rage massacre, dragon_roar, enrage, juggernaut(2), stone_heart
4:19.875 battle_cry Fluffy_Pillow 49.3/100: 49% rage massacre, enrage, juggernaut(3)
4:19.923 use_item_draught_of_souls Fluffy_Pillow 49.3/100: 49% rage massacre, enrage, juggernaut(3), battle_cry
4:19.923 potion Fluffy_Pillow 49.3/100: 49% rage massacre, enrage, juggernaut(3), battle_cry
4:19.923 avatar Fluffy_Pillow 49.3/100: 49% rage massacre, enrage, juggernaut(3), battle_cry, potion_of_the_old_war
4:19.923 rampage Fluffy_Pillow 49.3/100: 49% rage massacre, avatar, enrage, juggernaut(3), battle_cry, potion_of_the_old_war
4:21.427 heroic_leap Fluffy_Pillow 59.2/100: 59% rage avatar, enrage, juggernaut(3), battle_cry, potion_of_the_old_war
4:21.502 odyns_fury Fluffy_Pillow 59.2/100: 59% rage avatar, enrage, juggernaut(3), battle_cry, potion_of_the_old_war
4:22.680 execute Fluffy_Pillow 69.1/100: 69% rage avatar, enrage, juggernaut(3), battle_cry, potion_of_the_old_war
4:23.856 execute Fluffy_Pillow 54.0/100: 54% rage massacre, avatar, enrage, juggernaut(4), battle_cry, potion_of_the_old_war
4:25.032 rampage Fluffy_Pillow 29.0/100: 29% rage massacre, avatar, enrage, sense_death, juggernaut(5), potion_of_the_old_war
4:26.536 execute Fluffy_Pillow 48.8/100: 49% rage avatar, enrage, sense_death, juggernaut(5), potion_of_the_old_war
4:27.713 execute Fluffy_Pillow 48.8/100: 49% rage avatar, enrage, juggernaut(6), potion_of_the_old_war
4:28.890 execute Fluffy_Pillow 33.7/100: 34% rage avatar, enrage, juggernaut(7), potion_of_the_old_war
4:30.067 raging_blow Fluffy_Pillow 18.6/100: 19% rage avatar, enrage, juggernaut(8), potion_of_the_old_war
4:31.243 execute Fluffy_Pillow 26.9/100: 27% rage avatar, juggernaut(8), potion_of_the_old_war
4:32.419 rampage Fluffy_Pillow 1.9/100: 2% rage massacre, avatar, juggernaut(9), potion_of_the_old_war
4:33.923 raging_blow Fluffy_Pillow 11.8/100: 12% rage avatar, enrage, juggernaut(9), odyns_champion, potion_of_the_old_war
4:35.100 execute Fluffy_Pillow 26.7/100: 27% rage avatar, enrage, juggernaut(9), odyns_champion, stone_heart, potion_of_the_old_war
4:36.277 execute Fluffy_Pillow 26.7/100: 27% rage avatar, enrage, juggernaut(10), odyns_champion, potion_of_the_old_war
4:37.454 rampage Fluffy_Pillow 11.6/100: 12% rage massacre, avatar, enrage, juggernaut(11), odyns_champion, potion_of_the_old_war
4:38.958 dragon_roar Fluffy_Pillow 21.5/100: 22% rage avatar, enrage, juggernaut(11), odyns_champion, berserking_, potion_of_the_old_war
4:40.135 execute Fluffy_Pillow 31.4/100: 31% rage dragon_roar, enrage, juggernaut(11), berserking_(2), potion_of_the_old_war
4:41.310 raging_blow Fluffy_Pillow 16.3/100: 16% rage dragon_roar, enrage, juggernaut(12), berserking_(3), potion_of_the_old_war
4:42.487 execute Fluffy_Pillow 31.2/100: 31% rage dragon_roar, enrage, juggernaut(12), berserking_(5), potion_of_the_old_war
4:43.663 rampage Fluffy_Pillow 16.1/100: 16% rage massacre, dragon_roar, juggernaut(13), berserking_(6), potion_of_the_old_war
4:45.166 raging_blow Fluffy_Pillow 16.1/100: 16% rage enrage, juggernaut(13), odyns_champion, berserking_(7)
4:46.342 heroic_leap Fluffy_Pillow 31.0/100: 31% rage enrage, juggernaut(13), odyns_champion, berserking_(8)
4:46.342 execute Fluffy_Pillow 31.0/100: 31% rage enrage, juggernaut(13), odyns_champion, berserking_(8)
4:47.520 bloodthirst Fluffy_Pillow 15.9/100: 16% rage massacre, enrage, juggernaut(14), odyns_champion, berserking_(10)
4:48.696 rampage Fluffy_Pillow 35.8/100: 36% rage massacre, enrage, juggernaut(14), odyns_champion, berserking_(11)
4:50.202 execute Fluffy_Pillow 55.6/100: 56% rage enrage, juggernaut(14), odyns_champion, berserking_(12)
4:51.379 execute Fluffy_Pillow 40.5/100: 41% rage massacre, enrage, sense_death, juggernaut(15), berserking_(12)
4:52.554 execute Fluffy_Pillow 50.4/100: 50% rage massacre, enrage, juggernaut(16)
4:53.731 rampage Fluffy_Pillow 35.3/100: 35% rage massacre, enrage, juggernaut(17)
4:55.236 execute Fluffy_Pillow 45.2/100: 45% rage enrage, juggernaut(17)
4:56.412 execute Fluffy_Pillow 30.1/100: 30% rage massacre, enrage, juggernaut(18), berserking_
4:57.587 execute Fluffy_Pillow 15.0/100: 15% rage massacre, enrage, sense_death, juggernaut(19), berserking_(2)
4:58.763 rampage Fluffy_Pillow 24.9/100: 25% rage massacre, enrage, juggernaut(20), berserking_(3), stone_heart
4:59.923 battle_cry Fluffy_Pillow 34.8/100: 35% rage enrage, juggernaut(20), battle_cry, berserking_(4), stone_heart
5:00.268 execute Fluffy_Pillow 34.8/100: 35% rage enrage, juggernaut(20), battle_cry, berserking_(5), stone_heart
5:01.445 dragon_roar Fluffy_Pillow 44.7/100: 45% rage massacre, enrage, juggernaut(21), battle_cry, berserking_(6)
5:02.621 odyns_fury Fluffy_Pillow 54.6/100: 55% rage massacre, dragon_roar, enrage, juggernaut(21), battle_cry, berserking_(7)
5:03.797 rampage Fluffy_Pillow 64.5/100: 65% rage massacre, dragon_roar, enrage, juggernaut(21), battle_cry, berserking_(8)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 30956 29250 17625 (4389)
Agility 6579 6254 0
Stamina 51209 51209 27995
Intellect 5321 4996 0
Spirit 1 1 0
Health 3072540 3072540 0
Rage 100 100 0
Crit 24.43% 24.43% 6802
Haste 27.98% 27.98% 9093
Damage / Heal Versatility 1.39% 1.39% 558
Attack Power 30956 29250 0
Mastery 30.35% 28.85% 4414
Armor 4262 4262 4262
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Warhelm of the Obsidian Aspect
ilevel: 870, stats: { 580 Armor, +1563 Str, +2345 Sta, +763 Crit, +643 Haste }
Local Neck Radiant String of Scorpid Eyes
ilevel: 870, stats: { +1319 Sta, +1074 Haste, +905 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Shoulderplates of the Obsidian Aspect
ilevel: 870, stats: { 535 Armor, +1172 Str, +1758 Sta, +731 Haste, +324 Crit }
Local Chest Chestplate of the Obsidian Aspect
ilevel: 870, stats: { 713 Armor, +1563 Str, +2345 Sta, +945 Haste, +462 Crit }
Local Waist Waistplate of Nameless Horror
ilevel: 880, stats: { 410 Armor, +1930 Sta, +1287 StrInt, +665 Haste, +430 Crit }
Local Legs Legplates of the Obsidian Aspect
ilevel: 870, stats: { 624 Armor, +1563 Str, +2345 Sta, +885 Crit, +523 Haste }
Local Feet Immaculately Polished Boots
ilevel: 870, stats: { 490 Armor, +1758 Sta, +1172 StrInt, +731 Haste, +324 Mastery }
Local Wrists Dragonbone Wristclamps
ilevel: 880, stats: { 319 Armor, +1447 Sta, +965 StrInt, +551 Mastery, +270 Haste }
Local Hands Gauntlets of the Obsidian Aspect
ilevel: 870, stats: { 446 Armor, +1172 Str, +1758 Sta, +731 Haste, +324 Vers }
Local Finger1 Ring of Braided Stems
ilevel: 870, stats: { +1319 Sta, +1188 Haste, +791 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ayala's Stone Heart
ilevel: 895, stats: { +1665 Sta, +1397 Crit, +776 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Ursoc's Rending Paw
ilevel: 880, stats: { +1631 Str }
Local Trinket2 Draught of Souls
ilevel: 870, stats: { +1005 Haste }
Local Back Astromancer's Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +587 Haste, +234 Vers }, enchant: { +200 Str }
Local Main Hand Warswords of the Valarjar
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Warswords of the Valarjar
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }

Talents

Level
15 War Machine (Fury Warrior) Endless Rage (Fury Warrior) Fresh Meat (Fury Warrior)
30 Shockwave (Fury Warrior) Storm Bolt (Fury Warrior) Double Time
45 Wrecking Ball (Fury Warrior) Outburst Avatar
60 Furious Charge (Fury Warrior) Bounding Stride Warpaint (Fury Warrior)
75 Massacre (Fury Warrior) Frothing Berserker (Fury Warrior) Carnage (Fury Warrior)
90 Bloodbath (Fury Warrior) Frenzy (Fury Warrior) Inner Rage (Fury Warrior)
100 Bladestorm (Fury Warrior) Reckless Abandon (Fury Warrior) Dragon Roar (Fury Warrior)

Profile

warrior="Warrior_Fury_T19M"
level=110
race=troll
role=attack
position=back
talents=2232133
artifact=35:139256:139262:139255:0:980:1:981:1:982:1:984:1:985:1:986:1:987:1:988:4:989:4:990:4:991:3:992:3:993:3:994:3:995:3:996:3:1357:1
spec=fury

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/charge
actions+=/run_action_list,name=movement,if=movement.distance>5
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
actions+=/use_item,name=draught_of_souls,if=(spell_targets.whirlwind>1|!raid_event.adds.exists)&((talent.bladestorm.enabled&cooldown.bladestorm.remains=0)|buff.battle_cry.up|target.time_to_die<25)
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
actions+=/battle_cry,if=(cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))
actions+=/avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
actions+=/bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
actions+=/blood_fury,if=buff.battle_cry.up
actions+=/berserking,if=buff.battle_cry.up
actions+=/arcane_torrent,if=rage<rage.max-40
actions+=/call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
actions+=/call_action_list,name=aoe,if=spell_targets.whirlwind>3
actions+=/call_action_list,name=single_target

actions.aoe=bloodthirst,if=buff.enrage.down|rage<50
actions.aoe+=/call_action_list,name=bladestorm
actions.aoe+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.aoe+=/whirlwind,if=buff.enrage.up
actions.aoe+=/dragon_roar
actions.aoe+=/rampage,if=buff.meat_cleaver.up
actions.aoe+=/bloodthirst
actions.aoe+=/whirlwind

actions.bladestorm=bladestorm,if=buff.enrage.remains>2&(raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets)

actions.movement=heroic_leap

actions.single_target=bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
actions.single_target+=/execute,if=(artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2))|buff.stone_heart.react
actions.single_target+=/rampage,if=rage=100&(target.health.pct>20|target.health.pct<20&!talent.massacre.enabled)|buff.massacre.react&buff.enrage.remains<1
actions.single_target+=/berserker_rage,if=talent.outburst.enabled&cooldown.odyns_fury.remains=0&buff.enrage.down
actions.single_target+=/dragon_roar,if=cooldown.odyns_fury.remains>=10|cooldown.odyns_fury.remains<=3
actions.single_target+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.single_target+=/rampage,if=buff.enrage.down&buff.juggernaut.down
actions.single_target+=/furious_slash,if=talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
actions.single_target+=/raging_blow,if=buff.juggernaut.down&buff.enrage.up
actions.single_target+=/whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
actions.single_target+=/execute,if=talent.inner_rage.enabled|!talent.inner_rage.enabled&rage>50
actions.single_target+=/bloodthirst,if=buff.enrage.down
actions.single_target+=/raging_blow,if=buff.enrage.down
actions.single_target+=/execute,if=artifact.juggernaut.enabled
actions.single_target+=/raging_blow
actions.single_target+=/bloodthirst
actions.single_target+=/furious_slash
actions.single_target+=/call_action_list,name=bladestorm
actions.single_target+=/bloodbath,if=buff.frothing_berserker.up|(rage>80&!talent.frothing_berserker.enabled)

actions.two_targets=whirlwind,if=buff.meat_cleaver.down
actions.two_targets+=/call_action_list,name=bladestorm
actions.two_targets+=/rampage,if=buff.enrage.down|(rage=100&buff.juggernaut.down)|buff.massacre.up
actions.two_targets+=/bloodthirst,if=buff.enrage.down
actions.two_targets+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.two_targets+=/raging_blow,if=talent.inner_rage.enabled&spell_targets.whirlwind=2
actions.two_targets+=/whirlwind,if=spell_targets.whirlwind>2
actions.two_targets+=/dragon_roar
actions.two_targets+=/bloodthirst
actions.two_targets+=/whirlwind

head=warhelm_of_the_obsidian_aspect,id=138357,bonus_id=3443
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3443,enchant=mark_of_the_hidden_satyr
shoulders=shoulderplates_of_the_obsidian_aspect,id=138363,bonus_id=3443
back=astromancers_greatcloak,id=140909,bonus_id=1806,enchant=binding_of_strength
chest=chestplate_of_the_obsidian_aspect,id=138351,bonus_id=3443
wrists=dragonbone_wristclamps,id=138218,bonus_id=1806
hands=gauntlets_of_the_obsidian_aspect,id=138354,bonus_id=3443
waist=waistplate_of_nameless_horror,id=139227,bonus_id=1806
legs=legplates_of_the_obsidian_aspect,id=138360,bonus_id=3443
feet=immaculately_polished_boots,id=140904,bonus_id=3443
finger1=ring_of_braided_stems,id=140896,bonus_id=3443,enchant=binding_of_mastery
finger2=ayalas_stone_heart,id=137052,bonus_id=1811,enchant=binding_of_mastery
trinket1=ursocs_rending_paw,id=139328,bonus_id=1806
trinket2=draught_of_souls,id=140808,bonus_id=3443
main_hand=warswords_of_the_valarjar,id=128908,bonus_id=751,gem_id=139256/139262/139255,relic_id=1806/1806/1806
off_hand=warswords_of_the_valarjar,id=134553

# Gear Summary
# gear_ilvl=878.56
# gear_strength=17625
# gear_stamina=27995
# gear_crit_rating=6802
# gear_haste_rating=9093
# gear_mastery_rating=4414
# gear_versatility_rating=558
# gear_armor=4262
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length: 227 - 378 ( 300.8 )

Performance:
Total Events Processed: 514191319
Max Event Queue: 525
Sim Seconds: 2256034
CPU Seconds: 1064.3300
Physical Seconds: 534.9634
Speed Up: 2120

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Hunter_BM_T19M Hunter_BM_T19M a_murder_of_crows 131894 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.33sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M crow_peck 131900 8169205 27161 17.07 74206 151202 0.0 85.6 27.6% 0.0% 0.0% 0.0% 0.00sec 12009505 300.76sec
Hunter_BM_T19M Hunter_BM_T19M aspect_of_the_wild 193530 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 127.29sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M auto_shot 0 5065921 16843 24.51 29920 62420 122.9 122.9 34.8% 0.0% 0.0% 0.0% 2.46sec 7447384 300.76sec
Hunter_BM_T19M Hunter_BM_T19M bestial_wrath 19574 0 0 0.00 0 0 8.9 0.0 0.0% 0.0% 0.0% 0.0% 35.37sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M cobra_shot 193455 11511271 38273 13.97 117206 241843 70.2 70.0 37.8% 0.0% 0.0% 0.0% 4.25sec 16922659 300.76sec
Hunter_BM_T19M Hunter_BM_T19M deadly_grace 188091 3653471 12147 5.68 99520 203107 28.5 28.5 27.8% 0.0% 0.0% 0.0% 3.24sec 3653471 300.76sec
Hunter_BM_T19M Hunter_BM_T19M dire_beast 120679 0 0 0.00 0 0 34.3 0.0 0.0% 0.0% 0.0% 0.0% 8.86sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast dire_beast_melee 0 7438774 32253 47.72 32044 64083 183.5 183.5 26.5% 0.0% 0.0% 0.0% 1.64sec 10935703 230.64sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast stomp 201754 7279417 31562 8.91 168204 336291 34.3 34.3 26.4% 0.0% 0.0% 0.0% 8.86sec 10701433 230.64sec
Hunter_BM_T19M Hunter_BM_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M kill_command 34026 0 0 0.00 0 0 73.3 0.0 0.0% 0.0% 0.0% 0.0% 4.10sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_cat kill_command 83381 26888127 89399 14.63 260646 530013 73.3 73.3 39.3% 0.0% 0.0% 0.0% 4.10sec 39528094 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_cat jaws_of_thunder 197162 5387081 17911 5.87 183224 0 29.4 29.4 0.0% 0.0% 0.0% 0.0% 10.13sec 5387081 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_hati kill_command 83381 8168380 27159 14.63 87182 176368 73.3 73.3 27.1% 0.0% 0.0% 0.0% 4.10sec 12008292 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_hati jaws_of_thunder 197162 1630746 5422 5.85 55642 0 29.3 29.3 0.0% 0.0% 0.0% 0.0% 10.10sec 1630746 300.76sec
Hunter_BM_T19M Hunter_BM_T19M pepper_breath ticks -225622 1181008 3937 14.01 16974 0 14.1 70.1 0.0% 0.0% 0.0% 0.0% 21.07sec 1181008 300.76sec
Hunter_BM_T19M Hunter_BM_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M titans_thunder 207068 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.04sec 0 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_cat titans_thunder ticks -207068 1676764 5589 8.50 30743 62441 5.4 42.5 27.5% 0.0% 0.0% 0.0% 61.04sec 1676764 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 2137402 7125 8.12 41222 82410 5.2 40.6 27.8% 0.0% 0.0% 0.0% 63.74sec 2137402 230.64sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 191235 637 0.73 41270 82462 0.5 3.7 26.3% 0.0% 0.0% 0.0% 102.16sec 191235 47.59sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 18368 61 0.07 41400 83034 0.0 0.3 29.5% 0.0% 0.0% 0.0% 120.66sec 18368 10.54sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 3232 11 0.01 42114 85171 0.0 0.1 38.5% 0.0% 0.0% 0.0% 0.00sec 3232 8.16sec
Hunter_BM_T19M Hunter_BM_T19M_hati titans_thunder ticks -207068 2143637 7145 8.50 39283 79763 5.4 42.5 27.6% 0.0% 0.0% 0.0% 61.04sec 2143637 300.76sec
Hunter_BM_T19M Hunter_BM_T19M tormenting_cyclone 221857 1690346 5620 14.32 18509 37487 10.4 71.8 26.5% 0.0% 0.0% 0.0% 27.80sec 1690346 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_cat claw 16827 6393728 21258 20.10 45571 93490 100.8 100.8 37.3% 0.0% 0.0% 0.0% 3.00sec 9399386 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_cat melee 0 6400529 21281 40.15 22848 46593 201.2 201.2 37.7% 0.0% 0.0% 0.0% 1.49sec 9409383 300.76sec
Hunter_BM_T19M Hunter_BM_T19M_hati hati_melee 0 6821623 22681 36.69 29216 59144 182.9 183.9 26.3% 0.0% 0.0% 0.0% 1.64sec 10028432 300.76sec
Hunter_MM_T19M Hunter_MM_T19M aimed_shot 19434 44505501 147975 18.25 325712 774409 91.6 91.5 35.8% 0.0% 0.0% 0.0% 3.26sec 65427303 300.76sec
Hunter_MM_T19M Hunter_MM_T19M legacy_of_the_windrunners 19434 7633388 25380 16.34 62310 148801 0.0 81.9 35.7% 0.0% 0.0% 0.0% 0.00sec 11221803 300.76sec
Hunter_MM_T19M Hunter_MM_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_MM_T19M Hunter_MM_T19M auto_shot 0 4833076 16069 23.81 29694 65657 119.4 119.4 30.0% 0.0% 0.0% 0.0% 2.52sec 7105079 300.76sec
Hunter_MM_T19M Hunter_MM_T19M barrage ticks -120360 12837390 42791 43.63 44090 93309 13.7 218.2 30.0% 0.0% 0.0% 0.0% 22.87sec 18872180 300.76sec
Hunter_MM_T19M Hunter_MM_T19M deadly_grace 188091 4316444 14352 6.75 79173 204753 33.9 33.9 38.5% 0.0% 0.0% 0.0% 8.92sec 4316444 300.76sec
Hunter_MM_T19M Hunter_MM_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_MM_T19M Hunter_MM_T19M marked_shot 185901 16371289 54432 5.77 375507 843582 28.9 28.9 40.6% 0.0% 0.0% 0.0% 10.42sec 24067346 300.76sec
Hunter_MM_T19M Hunter_MM_T19M call_of_the_hunter 191070 1205230 4007 2.42 70835 163507 12.1 12.1 30.7% 0.0% 0.0% 0.0% 46.49sec 1771802 300.76sec
Hunter_MM_T19M Hunter_MM_T19M pepper_breath ticks -225622 1228781 4096 14.58 16972 0 14.6 72.9 0.0% 0.0% 0.0% 0.0% 20.22sec 1228781 300.76sec
Hunter_MM_T19M Hunter_MM_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_MM_T19M Hunter_MM_T19M sidewinders 214579 5195059 17273 6.60 114546 255613 33.1 33.1 30.1% 0.0% 0.0% 0.0% 9.15sec 5195059 300.76sec
Hunter_MM_T19M Hunter_MM_T19M tormenting_cyclone 221857 1565444 5205 14.94 15351 33713 10.9 74.9 30.3% 0.0% 0.0% 0.0% 26.59sec 1565444 300.76sec
Hunter_MM_T19M Hunter_MM_T19M trueshot 193526 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 157.95sec 0 300.76sec
Hunter_MM_T19M Hunter_MM_T19M windburst 204147 8324257 27677 2.83 440645 931829 13.2 14.2 29.7% 0.0% 0.0% 0.0% 21.89sec 12237446 300.76sec
Hunter_SV_T19M Hunter_SV_T19M aspect_of_the_eagle 186289 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.05sec 0 300.76sec
Hunter_SV_T19M Hunter_SV_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_SV_T19M Hunter_SV_T19M auto_attack_mh 0 5679326 18883 20.81 37488 74972 104.3 104.3 45.3% 0.0% 0.0% 0.0% 2.88sec 8349147 300.76sec
Hunter_SV_T19M Hunter_SV_T19M talon_strike 203525 1530618 5089 4.16 50444 101016 20.9 20.9 45.3% 0.0% 0.0% 0.0% 26.34sec 2250154 300.76sec
Hunter_SV_T19M Hunter_SV_T19M cleansed_drakes_breath 222520 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 63.07sec 0 300.76sec
Hunter_SV_T19M Hunter_SV_T19M dragonsfire_grenade 194855 1028391 3419 2.04 100410 0 10.3 10.2 0.0% 0.0% 0.0% 0.0% 30.57sec 5988944 300.76sec
Hunter_SV_T19M Hunter_SV_T19M dragonsfire_grenade ticks -194855 4960553 16535 16.15 42260 84554 10.3 80.7 45.3% 0.0% 0.0% 0.0% 30.57sec 5988944 300.76sec
Hunter_SV_T19M Hunter_SV_T19M explosive_trap 13812 8039480 26730 4.95 223219 446392 24.8 24.8 45.3% 0.0% 0.0% 0.0% 12.37sec 16253907 300.76sec
Hunter_SV_T19M Hunter_SV_T19M explosive_trap ticks -13812 8214427 27381 48.67 23221 46450 24.8 243.4 45.3% 0.0% 0.0% 0.0% 12.37sec 16253907 300.76sec
Hunter_SV_T19M Hunter_SV_T19M flanking_strike 202800 7876026 26187 5.91 167936 335944 29.6 29.6 58.4% 0.0% 0.0% 0.0% 9.78sec 11578504 300.76sec
Hunter_SV_T19M Hunter_SV_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_SV_T19M Hunter_SV_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_SV_T19M Hunter_SV_T19M fury_of_the_eagle ticks -203415 8934834 29783 11.78 104465 208687 6.6 58.9 45.3% 0.0% 0.0% 0.0% 47.90sec 13135052 300.76sec
Hunter_SV_T19M Hunter_SV_T19M harpoon 190925 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_SV_T19M Hunter_SV_T19M lacerate 185855 1629610 5418 5.03 44334 88800 25.2 25.2 45.6% 0.0% 0.0% 0.0% 11.85sec 14114172 300.76sec
Hunter_SV_T19M Hunter_SV_T19M lacerate ticks -185855 11718491 39062 57.62 27992 55988 25.2 288.1 45.3% 0.0% 0.0% 0.0% 11.85sec 14114172 300.76sec
Hunter_SV_T19M Hunter_SV_T19M mongoose_bite 190928 13799203 45880 8.96 211475 422935 44.9 44.9 45.3% 0.0% 0.0% 0.0% 6.61sec 20286136 300.76sec
Hunter_SV_T19M Hunter_SV_T19M on_the_trail ticks -204081 2453855 8180 60.05 8172 0 0.0 300.3 0.0% 0.0% 0.0% 0.0% 0.00sec 2453855 300.76sec
Hunter_SV_T19M Hunter_SV_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_SV_T19M Hunter_SV_T19M potion_of_the_old_war 188028 4780526 15895 4.65 140879 282007 23.3 23.3 45.4% 0.0% 0.0% 0.0% 3.78sec 7027826 300.76sec
Hunter_SV_T19M Hunter_SV_T19M raptor_strike 186270 8561441 28466 9.84 119611 239184 49.3 49.3 45.2% 0.0% 0.0% 0.0% 6.12sec 12586130 300.76sec
Hunter_SV_T19M Hunter_SV_T19M snake_hunter 201078 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 95.56sec 0 300.76sec
Hunter_SV_T19M Hunter_SV_T19M summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Hunter_SV_T19M Hunter_SV_T19M_cat claw 16827 3492207 11611 20.10 22317 44645 100.8 100.8 55.3% 0.0% 0.0% 0.0% 3.00sec 5133874 300.76sec
Hunter_SV_T19M Hunter_SV_T19M_cat flanking_strike 204740 3543912 11783 5.91 71097 142216 29.6 29.6 68.4% 0.0% 0.0% 0.0% 9.78sec 5209886 300.76sec
Hunter_SV_T19M Hunter_SV_T19M_cat melee 0 4165597 13850 47.32 11306 22610 237.2 237.2 55.3% 0.0% 0.0% 0.0% 1.26sec 6123822 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M aegwynns_ascendance 187677 1145769 3810 0.66 345138 0 3.3 3.3 0.0% 0.0% 0.0% 0.0% 98.46sec 1145769 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_barrage 44425 3268291 10867 1.95 262385 525269 9.8 9.8 27.7% 0.0% 0.0% 0.0% 27.23sec 3268291 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_blast 30451 46566288 154826 19.45 374072 750011 96.5 97.5 27.5% 0.0% 0.0% 0.0% 3.11sec 46566288 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_explosion 1449 665539 2213 0.50 205345 410755 2.5 2.5 28.1% 0.0% 0.0% 0.0% 69.66sec 665539 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_missiles ticks -5143 36382242 121274 55.13 103892 207691 46.0 275.6 27.5% 0.0% 0.0% 0.0% 6.30sec 36382242 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.16sec 0 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.24sec 0 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M deadly_grace 188091 6357478 21138 7.85 126750 253220 39.4 39.4 27.5% 0.0% 0.0% 0.0% 5.93sec 6357478 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M evocation 12051 0 0 0.00 0 0 3.3 0.0 0.0% 0.0% 0.0% 0.0% 98.02sec 0 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M mark_of_aluneth ticks -224968 2943385 9811 6.21 74463 148505 5.2 31.0 27.5% 0.0% 0.0% 0.0% 62.25sec 2943385 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M mark_of_aluneth_explosion 210726 2722447 9052 1.04 407876 814487 5.2 5.2 27.8% 0.0% 0.0% 0.0% 62.19sec 2722447 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M mark_of_the_hidden_satyr 191259 3130861 10410 4.24 115882 231331 21.3 21.3 27.2% 0.0% 0.0% 0.0% 14.08sec 3130861 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M nether_tempest ticks -114923 6392080 21307 84.46 11873 23747 25.8 422.3 27.5% 0.0% 0.0% 0.0% 11.62sec 6392080 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M nether_tempest_aoe ticks -114954 6397018 21323 0.00 11937 23876 422.3 0.0 27.5% 0.0% 0.0% 0.0% 0.70sec 6397018 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M plague_swarm ticks -221812 5088292 16961 14.43 55355 110755 17.0 72.1 27.4% 0.0% 0.0% 0.0% 17.49sec 5088292 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M rune_of_power 116011 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 35.30sec 0 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M summon_arcane_familiar 205022 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M supernova 157980 2297790 7640 1.88 190585 382149 9.4 9.4 27.5% 0.0% 0.0% 0.0% 31.09sec 2297790 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M tormenting_cyclone 221857 2208309 7342 17.32 19971 39904 12.6 86.8 27.4% 0.0% 0.0% 0.0% 23.00sec 2208309 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M touch_of_the_magi 210833 3684744 12251 1.66 442702 0 8.3 8.3 0.0% 0.0% 0.0% 0.0% 34.14sec 3684744 300.76sec
Mage_Arcane_T19M Mage_Arcane_T19M_arcane_familiar arcane_assault 205235 3176355 10561 29.47 16869 33739 148.3 147.7 27.5% 0.0% 0.0% 0.0% 2.04sec 3176355 300.76sec
Mage_Fire_T19M Mage_Fire_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Fire_T19M Mage_Fire_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 238.39sec 0 300.76sec
Mage_Fire_T19M Mage_Fire_T19M blast_furance ticks -194522 1377916 4593 44.56 3043 7892 36.4 222.8 64.8% 0.0% 0.0% 0.0% 8.33sec 1377916 300.76sec
Mage_Fire_T19M Mage_Fire_T19M combustion 190319 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 79.59sec 0 300.76sec
Mage_Fire_T19M Mage_Fire_T19M deadly_grace 188091 6441729 21418 5.97 94317 256679 29.9 29.9 74.4% 0.0% 0.0% 0.0% 3.72sec 6441729 300.76sec
Mage_Fire_T19M Mage_Fire_T19M fire_blast 108853 7927159 26357 7.26 0 217948 36.4 36.4 100.0% 0.0% 0.0% 0.0% 8.33sec 7927159 300.76sec
Mage_Fire_T19M Mage_Fire_T19M fireball 133 10947462 36399 15.05 79202 175930 75.6 75.5 68.1% 0.0% 0.0% 0.0% 3.68sec 10947462 300.76sec
Mage_Fire_T19M Mage_Fire_T19M flame_on 205029 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 76.35sec 0 300.76sec
Mage_Fire_T19M Mage_Fire_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Fire_T19M Mage_Fire_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Fire_T19M Mage_Fire_T19M ignite ticks -12846 26432504 88108 59.90 88257 0 224.1 299.5 0.0% 0.0% 0.0% 0.0% 1.35sec 26432504 300.76sec
Mage_Fire_T19M Mage_Fire_T19M maddening_whispers 222050 6272577 20855 0.46 730373 2738422 2.3 2.3 100.0% 0.0% 0.0% 0.0% 160.15sec 6272577 300.76sec
Mage_Fire_T19M Mage_Fire_T19M mark_of_the_hidden_satyr 191259 3362210 11179 3.42 97496 249520 17.2 17.2 64.8% 0.0% 0.0% 0.0% 17.33sec 3362210 300.76sec
Mage_Fire_T19M Mage_Fire_T19M phoenix_reborn 215773 1075809 3577 4.97 21653 55069 24.9 24.9 64.3% 0.0% 0.0% 0.0% 11.73sec 1075809 300.76sec
Mage_Fire_T19M Mage_Fire_T19M phoenixs_flames 194466 5914120 19664 2.71 0 435234 13.6 13.6 100.0% 0.0% 0.0% 0.0% 22.88sec 5914120 300.76sec
Mage_Fire_T19M Mage_Fire_T19M phoenixs_flames_splash 224637 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 22.91sec 0 300.76sec
Mage_Fire_T19M Mage_Fire_T19M plague_swarm ticks -221812 5728283 19094 12.04 48534 120957 13.7 60.2 64.4% 0.0% 0.0% 0.0% 21.53sec 5728283 300.76sec
Mage_Fire_T19M Mage_Fire_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Fire_T19M Mage_Fire_T19M pyroblast 11366 52288774 173853 19.56 272393 622380 97.3 98.0 74.5% 0.0% 0.0% 0.0% 3.08sec 52288774 300.76sec
Mage_Fire_T19M Mage_Fire_T19M rune_of_power 116011 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 37.76sec 0 300.76sec
Mage_Fire_T19M Mage_Fire_T19M scorch 2948 56349 187 0.15 0 76551 0.7 0.7 100.0% 0.0% 0.0% 0.0% 142.90sec 56349 300.76sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_arcane_blast 0 329068 1094 0.09 671842 1412008 0.4 0.4 8.8% 0.0% 0.0% 0.0% 318.58sec 329068 300.76sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_fireball 0 196972 655 0.09 383910 805646 0.5 0.5 9.8% 0.0% 0.0% 0.0% 318.36sec 400638 300.76sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_fireball ticks 0 203666 679 0.75 54554 0 0.5 3.7 0.0% 0.0% 0.0% 0.0% 318.36sec 400638 300.76sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_frostbolt 0 322467 1072 0.09 633451 1320540 0.5 0.5 10.1% 0.0% 0.0% 0.0% 319.14sec 322467 300.76sec
Mage_Fire_T19M Mage_Fire_T19M unstable_magic_explosion 157976 1366227 4543 3.76 72556 0 18.8 18.8 0.0% 0.0% 0.0% 0.0% 14.29sec 1366227 300.76sec
Mage_Fire_T19M Mage_Fire_T19M wanton_sorcery 222276 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 318.67sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.40sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M blizzard ticks -190356 4183283 13944 21.36 26427 52181 13.4 106.8 49.4% 0.0% 0.0% 0.0% 6.83sec 4183283 300.76sec
Mage_Frost_T19M Mage_Frost_T19M deadly_grace 188091 6770389 22511 9.27 110852 221346 46.5 46.5 31.5% 0.0% 0.0% 0.0% 1.89sec 6770389 300.76sec
Mage_Frost_T19M Mage_Frost_T19M ebonbolt 214634 3742069 12442 1.29 438269 876229 6.5 6.5 31.6% 0.0% 0.0% 0.0% 48.50sec 3742069 300.76sec
Mage_Frost_T19M Mage_Frost_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M flurry 44614 0 0 0.00 0 0 19.7 0.0 0.0% 0.0% 0.0% 0.0% 14.24sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M flurry_bolt 228354 12625700 41979 11.73 126100 252441 58.8 58.8 70.1% 0.0% 0.0% 0.0% 4.59sec 12625700 300.76sec
Mage_Frost_T19M Mage_Frost_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M frost_bomb 112948 0 0 0.00 0 0 19.8 0.0 0.0% 0.0% 0.0% 0.0% 15.37sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M frost_bomb_explosion 113092 11167104 37129 20.67 78201 154465 103.6 103.6 38.8% 0.0% 0.0% 0.0% 2.86sec 11167104 300.76sec
Mage_Frost_T19M Mage_Frost_T19M frostbolt 116 20509360 68191 23.84 110425 221017 119.0 119.5 55.3% 0.0% 0.0% 0.0% 2.45sec 20509360 300.76sec
Mage_Frost_T19M Mage_Frost_T19M icicle 148022 9576115 31839 28.20 67736 0 142.1 141.4 0.0% 0.0% 0.0% 0.0% 2.11sec 9576115 300.76sec
Mage_Frost_T19M Mage_Frost_T19M frozen_orb 84714 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.61sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M frozen_orb_bolt ticks -84721 1753789 5846 0.00 12766 25540 0.0 0.0 31.6% 0.0% 0.0% 0.0% 0.00sec 1753789 300.76sec
Mage_Frost_T19M Mage_Frost_T19M frozen_touch 205030 0 0 0.00 0 0 10.1 0.0 0.0% 0.0% 0.0% 0.0% 31.05sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M ice_lance 30455 39030780 129772 21.72 119274 411455 109.2 108.9 81.9% 0.0% 0.0% 0.0% 2.73sec 39030780 300.76sec
Mage_Frost_T19M Mage_Frost_T19M icy_veins 12472 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 137.28sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M maddening_whispers 222050 3715347 12353 0.57 996526 1989050 2.8 2.8 31.4% 0.0% 0.0% 0.0% 121.33sec 3715347 300.76sec
Mage_Frost_T19M Mage_Frost_T19M mark_of_the_hidden_satyr 191259 3604796 11985 4.92 111040 221953 24.7 24.7 31.6% 0.0% 0.0% 0.0% 12.22sec 3604796 300.76sec
Mage_Frost_T19M Mage_Frost_T19M plague_swarm ticks -221812 6023496 20078 17.26 53047 106118 20.0 86.3 31.5% 0.0% 0.0% 0.0% 15.02sec 6023496 300.76sec
Mage_Frost_T19M Mage_Frost_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M rune_of_power 116011 0 0 0.00 0 0 8.9 0.0 0.0% 0.0% 0.0% 0.0% 35.98sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_arcane_blast 0 386758 1286 0.10 709130 1411095 0.5 0.5 10.1% 0.0% 0.0% 0.0% 300.27sec 386758 300.76sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_fireball 0 218570 727 0.10 402672 822865 0.5 0.5 9.6% 0.0% 0.0% 0.0% 300.25sec 587377 300.76sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_fireball ticks 0 368808 1229 1.24 59654 0 0.5 6.2 0.0% 0.0% 0.0% 0.0% 300.25sec 587377 300.76sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_frostbolt 0 371670 1236 0.10 666311 1329316 0.5 0.5 10.9% 0.0% 0.0% 0.0% 300.24sec 371670 300.76sec
Mage_Frost_T19M Mage_Frost_T19M time_warp 80353 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 259.84sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M wanton_sorcery 222276 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.26sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M water_elemental 31687 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Mage_Frost_T19M Mage_Frost_T19M_water_elemental water_jet ticks -135029 1695539 5652 8.09 31874 63705 10.2 40.4 31.6% 0.0% 0.0% 0.0% 29.25sec 1695539 300.76sec
Mage_Frost_T19M Mage_Frost_T19M_water_elemental waterbolt 31707 14476669 48133 38.23 57476 114963 192.8 191.6 31.4% 0.0% 0.0% 0.0% 1.55sec 14476669 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M arcane_torrent 155145 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.59sec 0 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M blade_of_justice 184575 11432700 38012 9.77 188283 376896 49.0 49.0 24.0% 0.0% 0.0% 0.0% 6.10sec 16807152 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M blessing_of_might_proc 205729 9952237 33090 32.46 61170 0 189.3 162.7 0.0% 0.0% 0.0% 0.0% 1.99sec 9952237 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M brutal_haymaker 214169 767000 2550 0.95 129605 258375 4.8 4.8 24.3% 0.0% 0.0% 0.0% 54.49sec 1127562 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M brutal_haymaker_vulnerability 228784 2536217 8433 10.33 48987 0 53.9 51.8 0.0% 0.0% 0.0% 0.0% 4.06sec 2536217 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M cleansed_drakes_breath 222520 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 63.59sec 0 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M crusade 231895 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.41sec 0 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M crusader_strike 35395 15126169 50292 21.18 92540 185000 106.2 106.2 54.0% 0.0% 0.0% 0.0% 2.82sec 22236901 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M echoed_verdict 224266 5234801 17405 17.70 47596 95155 88.7 88.7 24.0% 0.0% 0.0% 0.0% 3.38sec 5234801 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M greater_blessing_of_might 203528 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M judgment 20271 8872943 29501 6.88 207721 415598 34.5 34.5 23.9% 0.0% 0.0% 0.0% 8.82sec 8872943 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M judgment_aoe 228288 0 0 0.00 0 0 34.5 0.0 0.0% 0.0% 0.0% 0.0% 8.82sec 0 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M melee 0 5656898 18808 25.33 35923 71875 127.0 127.0 24.0% 0.0% 0.0% 0.0% 2.36sec 8316176 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M potion_of_the_old_war 188028 7892263 26241 7.33 172965 345789 36.7 36.7 24.2% 0.0% 0.0% 0.0% 4.05sec 11602374 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M shield_of_vengeance 184662 0 0 0.76 0 0 3.8 3.8 23.6% 0.0% 0.0% 0.0% 90.00sec 2622256 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M shield_of_vengeance_proc 184689 3726011 12388 0.72 828715 1662912 3.8 3.6 24.1% 0.0% 0.0% 0.0% 89.44sec 3726011 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M templars_verdict 85256 49594300 164894 17.70 450492 901511 88.7 88.7 24.0% 0.0% 0.0% 0.0% 3.38sec 49594300 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M wake_of_ashes 205273 2559756 8511 1.95 211136 422261 9.8 9.8 23.9% 0.0% 0.0% 0.0% 32.49sec 5143978 300.76sec
Paladin_Retribution_T19M Paladin_Retribution_T19M wake_of_ashes ticks -205273 2584222 8614 11.61 35861 71693 9.8 58.0 24.2% 0.0% 0.0% 0.0% 32.49sec 5143978 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.01sec 0 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M deadly_grace 188091 4872293 16200 8.16 95379 190819 40.9 40.9 24.8% 0.0% 0.0% 0.0% 7.50sec 4872293 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M mental_fortitude 194018 0 0 35.39 0 0 177.4 177.4 24.9% 0.0% 0.0% 0.0% 1.68sec 13054789 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M mind_blast 8092 27662654 91974 22.23 198922 397743 110.4 111.4 24.8% 0.0% 0.0% 0.0% 2.71sec 27662654 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M mind_flay ticks -15407 10024390 33415 44.82 35840 71673 76.0 224.1 24.8% 0.0% 0.0% 0.0% 3.89sec 10024390 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M plague_swarm ticks -221812 5312962 17710 16.93 50296 100599 20.5 84.7 24.8% 0.0% 0.0% 0.0% 14.32sec 5312962 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M power_infusion 10060 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 126.19sec 0 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M shadow_word_death 32379 1610150 5354 1.07 240565 481889 5.4 5.4 24.7% 0.0% 0.0% 0.0% 10.66sec 1610150 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M shadow_word_pain 589 163292 543 0.71 36847 73408 3.5 3.5 25.1% 0.0% 0.0% 0.0% 107.21sec 16733453 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M shadow_word_pain ticks -589 16570161 55234 53.03 50059 100062 3.5 265.2 24.9% 0.0% 0.0% 0.0% 107.21sec 16733453 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M sphere_of_insanity 194182 1947296 6474 20.80 18675 0 188.9 104.3 0.0% 0.0% 0.0% 0.0% 1.53sec 0 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M shadowfiend 34433 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 198.62sec 0 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M shadowy_apparitions 78203 1677870 5579 16.85 15915 31834 85.7 84.5 24.8% 0.0% 0.0% 0.0% 3.46sec 1677870 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M tormenting_cyclone 221857 3006274 9995 21.11 22767 45512 15.4 105.8 24.8% 0.0% 0.0% 0.0% 18.99sec 3006274 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M vampiric_touch ticks -34914 20907418 69691 35.48 94449 188762 1.0 177.4 24.8% 0.0% 0.0% 0.0% 0.00sec 20907418 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M void_bolt 205448 19301555 64175 15.07 204828 409645 75.9 75.5 24.8% 0.0% 0.0% 0.0% 3.76sec 19301555 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M void_eruption 228360 1307098 4346 2.91 71786 143573 7.3 14.6 24.8% 0.0% 0.0% 0.0% 42.56sec 1307098 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M void_torrent ticks -205065 6456253 21521 8.04 128855 257529 5.1 40.2 24.7% 0.0% 0.0% 0.0% 62.68sec 6456253 300.76sec
Priest_Shadow_T19M Priest_Shadow_T19M_shadowfiend melee 0 2859239 127589 74.79 82069 164085 27.9 27.9 24.7% 0.0% 0.0% 0.0% 7.01sec 2859239 22.41sec
Priest_Shadow_T19M Priest_Shadow_T19M_shadowfiend shadowcrawl 63619 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 66.67sec 0 22.41sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 3172943 10576 13.00 39147 78294 7.3 65.0 24.7% 0.0% 0.0% 0.0% 38.52sec 3172943 72.19sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 785103 2617 3.21 39147 78294 1.8 16.0 25.0% 0.0% 0.0% 0.0% 84.63sec 785103 17.83sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 460569 1535 1.88 39147 78294 1.1 9.4 25.2% 0.0% 0.0% 0.0% 124.14sec 460569 10.44sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 434769 1449 1.80 39147 78294 1.0 9.0 23.4% 0.0% 0.0% 0.0% 0.00sec 434769 10.00sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 391470 1305 1.80 39147 78294 1.0 9.0 11.1% 0.0% 0.0% 0.0% 0.00sec 391470 10.00sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M berserking 26297 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 261.15sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M deadly_grace 188091 5595306 18604 9.21 97185 194365 46.2 46.2 24.7% 0.0% 0.0% 0.0% 6.28sec 5595306 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M dispersion 47585 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 90.18sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mental_fortitude 194018 0 0 34.90 0 0 174.9 174.9 24.8% 0.0% 0.0% 0.0% 1.68sec 18151124 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mind_blast 8092 26046673 86602 20.35 204402 408756 101.0 102.0 24.9% 0.0% 0.0% 0.0% 2.80sec 26046673 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mind_flay ticks -15407 7624849 25416 34.36 35572 71151 58.7 171.8 24.8% 0.0% 0.0% 0.0% 4.24sec 7624849 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mindbender 200174 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 64.32sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M plague_swarm ticks -221812 5268529 17562 16.74 50474 100931 20.3 83.7 24.7% 0.0% 0.0% 0.0% 14.29sec 5268529 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadow_word_death 32379 2658283 8838 1.70 249361 498711 8.5 8.5 24.9% 0.0% 0.0% 0.0% 10.70sec 2658283 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadow_word_pain 589 111558 371 0.55 32468 64913 2.8 2.8 24.4% 0.0% 0.0% 0.0% 73.40sec 23359263 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadow_word_pain ticks -589 23247704 77492 52.56 70911 141822 2.8 262.8 24.8% 0.0% 0.0% 0.0% 73.40sec 23359263 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M sphere_of_insanity 194182 2074126 6896 22.36 18504 0 206.1 112.1 0.0% 0.0% 0.0% 0.0% 1.35sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadowy_apparitions 78203 1714934 5702 16.69 16421 32834 84.6 83.6 24.9% 0.0% 0.0% 0.0% 3.45sec 1714934 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M surrender_to_madness 193223 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M tormenting_cyclone 221857 3061889 10180 21.00 23326 46644 15.3 105.3 24.7% 0.0% 0.0% 0.0% 18.87sec 3061889 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M vampiric_touch ticks -34914 29085815 96953 34.99 133293 266221 1.2 174.9 24.8% 0.0% 0.0% 0.0% 148.01sec 29085815 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M void_bolt 205448 20658626 68687 15.73 209891 419838 79.0 78.8 24.8% 0.0% 0.0% 0.0% 3.51sec 20658626 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M void_eruption 228360 867830 2885 2.06 67269 134532 5.2 10.3 24.8% 0.0% 0.0% 0.0% 38.75sec 867830 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M void_torrent ticks -205065 4589459 15298 5.59 131597 263112 3.3 28.0 24.8% 0.0% 0.0% 0.0% 78.67sec 4589459 300.76sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_mindbender melee 0 6811596 94290 68.40 66272 132553 82.4 82.4 24.8% 0.0% 0.0% 0.0% 3.24sec 6811596 72.24sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_mindbender shadowcrawl 63619 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 19.38sec 0 72.24sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 2710440 9035 11.11 39147 78294 6.2 55.5 24.7% 0.0% 0.0% 0.0% 40.09sec 2710440 61.72sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 710002 2367 2.91 39147 78294 1.6 14.5 24.7% 0.0% 0.0% 0.0% 84.63sec 710002 16.15sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 460393 1535 1.88 39147 78294 1.0 9.4 24.9% 0.0% 0.0% 0.0% 102.54sec 460393 10.46sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 447491 1492 1.80 39147 78294 1.0 9.0 27.0% 0.0% 0.0% 0.0% 0.00sec 447491 10.00sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M auto_attack_mh 0 5356900 17811 40.49 21070 42141 203.0 203.0 44.2% 19.0% 0.0% 0.0% 1.49sec 7875150 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M auto_attack_oh 1 2644415 8792 40.06 10516 21036 200.8 200.8 44.2% 19.0% 0.0% 0.0% 1.50sec 3887541 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M blood_fury 20572 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.69sec 0 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M deadly_poison_dot ticks -2818 4610526 15368 19.91 32094 64145 373.1 99.6 44.4% 0.0% 0.0% 0.0% 0.92sec 4610526 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M deadly_poison_instant 113780 10861502 36113 74.23 20243 40473 372.1 372.1 44.2% 0.0% 0.0% 0.0% 0.92sec 10861502 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M envenom 32645 11988427 39860 5.59 296434 592798 28.0 28.0 44.4% 0.0% 0.0% 0.0% 10.47sec 11988427 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M exsanguinate 200806 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 46.46sec 0 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M from_the_shadows 192434 3076824 10230 28.43 14960 29921 142.5 142.5 44.3% 0.0% 0.0% 0.0% 3.76sec 3076824 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M from_the_shadows_driver 192432 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.49sec 0 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M garrote ticks -703 10376030 34587 34.64 41526 83039 20.0 173.2 44.3% 0.0% 0.0% 0.0% 15.45sec 10376030 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M kingsbane ticks -192759 4908379 16361 9.30 73137 146292 6.8 46.5 44.3% 0.0% 0.0% 0.0% 46.46sec 4908379 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M kingsbane_mh 222062 1149263 3821 1.36 116923 233812 6.8 6.8 44.2% 0.0% 0.0% 0.0% 46.46sec 1149263 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M kingsbane_oh 192760 575230 1913 1.36 58454 116925 6.8 6.8 44.4% 0.0% 0.0% 0.0% 46.46sec 575230 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mark_of_the_hidden_satyr 191259 1701789 5658 3.45 68272 136532 17.3 17.3 44.1% 0.0% 0.0% 0.0% 17.34sec 1701789 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mutilate 1329 0 0 0.00 0 0 92.3 0.0 0.0% 0.0% 0.0% 0.0% 3.26sec 0 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mutilate_mh 5374 11857163 39423 18.40 85506 171017 92.3 92.3 50.3% 0.0% 0.0% 0.0% 3.26sec 17431153 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mutilate_oh 27576 5924747 19699 18.40 42751 85504 92.3 92.3 50.2% 0.0% 0.0% 0.0% 3.26sec 8709939 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M poison_bomb 192660 4847219 16116 7.04 95076 190165 35.3 35.3 44.4% 0.0% 0.0% 0.0% 6.28sec 4847219 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M potion_of_the_old_war 188028 5760967 19154 4.92 161812 323633 24.7 24.7 44.4% 0.0% 0.0% 0.0% 5.26sec 8469167 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M rupture ticks -1943 37166109 123887 41.51 116132 232094 20.6 207.6 54.3% 0.0% 0.0% 0.0% 14.80sec 37166109 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M vanish 1856 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 139.40sec 0 300.76sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M vendetta 79140 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.49sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M agonizing_poison 200803 0 0 0.00 0 0 200.2 0.0 0.0% 0.0% 0.0% 0.0% 1.60sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M auto_attack_mh 0 6363976 21159 39.69 26257 52525 199.0 199.0 40.8% 19.0% 0.0% 0.0% 1.52sec 9355648 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M auto_attack_oh 1 3151146 10477 39.33 13131 26257 197.2 197.2 40.7% 19.0% 0.0% 0.0% 1.53sec 4632483 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M blood_fury 20572 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 124.14sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M envenom 32645 18032214 59955 6.62 386016 770778 33.2 33.2 40.9% 0.0% 0.0% 0.0% 8.91sec 18032214 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M from_the_shadows 192434 5264294 17503 40.72 18326 36647 204.1 204.1 40.7% 0.0% 0.0% 0.0% 2.77sec 5264294 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M from_the_shadows_driver 192432 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 62.05sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M garrote ticks -703 10868926 36230 29.98 51521 103040 17.5 149.9 40.7% 0.0% 0.0% 0.0% 17.84sec 10868926 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M horrific_slam 222168 6067495 20174 23.78 36145 72308 119.2 119.2 40.8% 0.0% 0.0% 0.0% 2.18sec 6067495 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M kingsbane ticks -192759 4395788 14653 9.38 66551 133204 6.9 46.9 40.8% 0.0% 0.0% 0.0% 46.48sec 4395788 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M kingsbane_mh 222062 1456569 4843 1.37 150194 300074 6.9 6.9 41.1% 0.0% 0.0% 0.0% 46.48sec 1456569 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M kingsbane_oh 192760 726504 2416 1.37 75205 150282 6.9 6.9 40.5% 0.0% 0.0% 0.0% 46.48sec 726504 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mark_of_the_hidden_satyr 191259 2114327 7030 3.39 88373 176739 17.0 17.0 40.7% 0.0% 0.0% 0.0% 17.59sec 2114327 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mutilate 1329 0 0 0.00 0 0 78.7 0.0 0.0% 0.0% 0.0% 0.0% 3.83sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mutilate_mh 5374 12130497 40332 15.69 105100 210113 78.7 78.7 46.8% 0.0% 0.0% 0.0% 3.83sec 17832979 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mutilate_oh 27576 6074556 20197 15.69 52557 105156 78.7 78.7 46.9% 0.0% 0.0% 0.0% 3.83sec 8930173 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M poison_bomb 192660 7098410 23601 7.59 132605 265213 38.0 38.0 40.7% 0.0% 0.0% 0.0% 5.96sec 7098410 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M potion_of_the_old_war 188028 6936344 23062 4.81 204310 408815 24.1 24.1 40.6% 0.0% 0.0% 0.0% 4.09sec 10197082 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M rupture ticks -1943 29414117 98047 29.38 132837 265906 11.8 146.9 50.7% 0.0% 0.0% 0.0% 26.12sec 29414117 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.66sec 0 300.76sec
Rogue_Assassination_T19M Rogue_Assassination_T19M vendetta 79140 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 62.05sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M adrenaline_rush 13750 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.89sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M ambush 8676 1154248 3838 1.20 133223 265846 6.0 6.0 44.8% 0.0% 0.0% 0.0% 56.68sec 1696854 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M auto_attack_mh 0 8370447 27831 40.58 32296 64577 203.4 203.4 46.4% 19.0% 0.0% 0.0% 1.48sec 12305350 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M auto_attack_oh 1 4103757 13644 39.80 16147 32286 199.5 199.5 46.4% 19.0% 0.0% 0.0% 1.51sec 6032911 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M curse_of_the_dreadblades 202665 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 87.10sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M darkstrikes 215659 2861840 9515 7.28 53412 106817 36.5 36.5 46.7% 0.0% 0.0% 0.0% 7.79sec 2861840 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M darkstrikes_absorb 215659 0 0 7.28 0 0 36.5 36.5 0.0% 0.0% 0.0% 0.0% 7.79sec 1971000 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M ghostly_strike 196937 1758122 5846 4.14 57940 115777 20.8 20.8 46.3% 0.0% 0.0% 0.0% 14.79sec 2584606 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M greed 202822 4612759 15337 5.93 106089 212135 29.7 29.7 46.4% 0.0% 0.0% 0.0% 9.91sec 6781192 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M greed_oh 202823 2307932 7674 5.93 53044 106068 29.7 29.7 46.5% 0.0% 0.0% 0.0% 9.91sec 3392879 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M main_gauche 86392 9967416 33140 32.83 41378 82738 164.6 164.6 46.4% 0.0% 0.0% 0.0% 1.82sec 14653045 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M mark_of_the_hidden_satyr 191259 1724253 5733 4.08 57610 115226 20.4 20.4 46.5% 0.0% 0.0% 0.0% 14.59sec 1724253 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M marked_for_death 137619 0 0 0.00 0 0 14.2 0.0 0.0% 0.0% 0.0% 0.0% 20.30sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M pistol_shot 185763 2109736 7015 4.43 57813 115616 22.2 22.2 64.5% 0.0% 0.0% 0.0% 12.04sec 3101511 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M blunderbuss 202895 3507109 11661 11.50 37128 74139 14.4 57.6 64.1% 0.0% 0.0% 0.0% 18.67sec 5155783 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M potion_of_the_old_war 188028 5470897 18190 5.55 134100 268227 27.8 27.8 46.8% 0.0% 0.0% 0.0% 4.21sec 8042737 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M roll_the_bones 193316 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 24.72sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M run_through 2098 50984562 169517 16.96 409232 818682 85.0 85.0 46.5% 0.0% 0.0% 0.0% 3.52sec 74952136 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M saber_slash 193315 28446838 94582 36.82 105321 210611 184.6 184.6 46.3% 0.0% 0.0% 0.0% 1.62sec 41819547 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M shadowmeld 58984 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 139.56sec 0 300.76sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M vanish 1856 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 56.68sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M auto_attack_mh 0 3422726 11380 32.41 18154 36307 162.4 162.4 35.1% 19.0% 0.0% 0.0% 1.86sec 5031731 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M auto_attack_oh 1 1682597 5594 31.88 9077 18154 159.8 159.8 35.0% 19.0% 0.0% 0.0% 1.88sec 2473577 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M backstab 53 5818371 19345 9.32 92184 184362 44.1 46.7 35.1% 0.0% 0.0% 0.0% 6.13sec 8553557 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M eviscerate 196819 37123855 123432 11.09 445525 890682 52.5 55.6 49.9% 0.0% 0.0% 0.0% 5.68sec 54575583 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M goremaws_bite 209782 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 63.75sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M goremaws_bite_mh 209783 1615202 5370 1.02 230553 469276 4.9 5.1 35.1% 0.0% 0.0% 0.0% 63.75sec 1615202 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M goremaws_bite_oh 209784 786766 2616 1.02 114341 226307 4.9 5.1 35.0% 0.0% 0.0% 0.0% 63.75sec 786766 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M horrific_slam 222168 4326868 14386 23.76 26916 53831 119.1 119.1 35.0% 0.0% 0.0% 0.0% 2.18sec 4326868 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M mark_of_the_hidden_satyr 191259 1466223 4875 3.38 64009 128009 16.9 16.9 35.2% 0.0% 0.0% 0.0% 17.67sec 1466223 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M nightblade ticks -195452 25504348 85014 28.85 131015 262051 17.3 144.2 35.0% 0.0% 0.0% 0.0% 17.25sec 25504348 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M weaponmaster 193536 1487527 4946 1.68 176885 0 8.4 8.4 0.0% 0.0% 0.0% 0.0% 30.71sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M potion_of_the_old_war 188028 5064338 16838 4.81 155498 310994 24.1 24.1 35.1% 0.0% 0.0% 0.0% 9.30sec 7445056 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_blades 121471 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.89sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_blade_mh 121473 1354588 4504 7.50 26706 53411 35.5 37.6 34.9% 0.0% 0.0% 0.0% 6.08sec 1354588 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_blade_offhand 121474 677776 2254 7.50 13353 26706 35.6 37.6 35.1% 0.0% 0.0% 0.0% 6.06sec 677776 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_dance 185313 0 0 0.00 0 0 26.0 0.0 0.0% 0.0% 0.0% 0.0% 11.62sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_nova 197800 2367499 7872 6.21 56334 112668 29.4 31.1 35.1% 0.0% 0.0% 0.0% 10.23sec 2367499 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadowmeld 58984 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 122.67sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadowstrike 185438 26200594 87113 20.95 177824 355652 99.2 105.0 40.3% 0.0% 0.0% 0.0% 3.04sec 38517354 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M soul_rip 220893 6577638 21870 20.70 46951 93901 103.8 103.8 35.0% 0.0% 0.0% 0.0% 3.02sec 6577638 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M symbols_of_death 212283 0 0 0.00 0 0 9.0 0.0 0.0% 0.0% 0.0% 0.0% 35.49sec 0 300.76sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.56sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.46sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M deadly_grace 188091 3711895 12342 6.90 80915 161830 35.1 34.6 32.6% 0.0% 0.0% 0.0% 8.74sec 3711895 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M earth_shock 8042 16565680 55079 5.22 425011 1062431 26.2 26.2 32.6% 0.0% 0.0% 0.0% 11.41sec 16565680 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M earthquake 61882 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 23.49sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M earthquake_ 77478 8020905 26668 36.07 29784 74459 180.8 180.8 32.6% 0.0% 0.0% 0.0% 1.51sec 8020905 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M elemental_mastery 16166 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.48sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 236.12sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M flame_shock 188389 1486058 4941 4.08 48879 122155 20.5 20.5 32.4% 0.0% 0.0% 0.0% 15.01sec 10052164 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M flame_shock ticks -188389 8566106 28554 43.16 26652 66630 20.5 215.8 32.6% 0.0% 0.0% 0.0% 15.01sec 10052164 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lava_burst 51505 11647491 38726 8.19 0 283714 41.2 41.1 100.0% 0.0% 0.0% 0.0% 7.31sec 11647491 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lava_burst_overload 77451 3904575 12982 3.34 0 232999 16.8 16.8 100.0% 0.0% 0.0% 0.0% 17.24sec 3904575 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lightning_bolt 188196 20171573 67068 26.45 102096 255262 132.6 132.6 32.7% 0.0% 0.0% 0.0% 2.25sec 20171573 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lightning_bolt_overload 45284 11014169 36621 16.97 86779 217401 85.1 85.1 32.7% 0.0% 0.0% 0.0% 3.91sec 11014169 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lightning_rod 197568 9935591 33034 35.05 56545 0 175.7 175.7 0.0% 0.0% 0.0% 0.0% 1.74sec 9935591 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M mark_of_the_hidden_satyr 191259 2509971 8345 4.17 90596 181192 20.9 20.9 32.7% 0.0% 0.0% 0.0% 14.39sec 2509971 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M pepper_breath ticks -225622 1395837 4653 16.54 16969 0 16.6 82.7 0.0% 0.0% 0.0% 0.0% 18.06sec 1395837 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M plague_swarm ticks -221812 4298672 14329 14.36 45087 90163 16.7 71.8 32.8% 0.0% 0.0% 0.0% 17.94sec 4298672 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M stormkeeper 205495 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 62.01sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M tormenting_cyclone 221857 1779267 5916 17.06 15689 31377 12.4 85.5 32.6% 0.0% 0.0% 0.0% 23.68sec 1779267 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 111.66sec 0 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M volcanic_inferno 205533 972429 3233 6.09 24009 48019 30.6 30.6 32.6% 0.0% 0.0% 0.0% 8.56sec 972429 300.76sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_primal_fire_elemental fire_blast 57984 13275281 125603 29.24 194435 388870 51.5 51.5 32.6% 0.0% 0.0% 0.0% 5.36sec 13275281 105.69sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_primal_fire_elemental immolate 118297 410771 3886 3.06 57610 115221 5.4 5.4 32.3% 0.0% 0.0% 0.0% 60.18sec 2037528 105.69sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_primal_fire_elemental immolate ticks -118297 1626758 5423 12.04 20376 40728 5.4 60.2 32.7% 0.0% 0.0% 0.0% 60.18sec 2037528 105.69sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_greater_lightning_elemental lightning_blast 191726 4535107 107728 60.93 80014 160029 42.7 42.7 32.6% 0.0% 0.0% 0.0% 6.57sec 4535107 42.10sec
Warrior_Arms_T19M Warrior_Arms_T19M arcane_torrent 69179 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.24sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M auto_attack_mh 0 8600407 28595 19.82 64411 129243 99.3 99.3 34.2% 0.0% 0.0% 0.0% 3.05sec 12643413 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M avatar 107574 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 90.02sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M battle_cry 1719 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 27.66sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M bladestorm 227847 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 123.02sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M bladestorm_mh 50622 875044 2909 1.22 120914 241797 0.0 6.1 18.6% 0.0% 0.0% 0.0% 0.00sec 1286398 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M colossus_smash 167105 19073655 63417 10.82 275244 542117 54.2 54.2 28.7% 0.0% 0.0% 0.0% 5.62sec 28040080 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M corrupted_blood_of_zakajz ticks -209569 12647131 42157 12.15 208191 0 0.0 60.7 0.0% 0.0% 0.0% 0.0% 0.00sec 12647131 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M execute 163201 18687881 62135 5.34 428209 912792 26.7 26.7 55.8% 0.0% 0.0% 0.0% 2.12sec 27472955 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M focused_rage 207982 0 0 0.00 0 0 196.0 0.0 0.0% 0.0% 0.0% 0.0% 1.49sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M heroic_leap 6544 0 0 0.00 0 0 10.2 0.0 0.0% 0.0% 0.0% 0.0% 30.97sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M horrific_slam 222168 7114698 23655 23.84 44449 89101 119.5 119.5 33.8% 0.0% 0.0% 0.0% 2.18sec 7114698 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M mortal_strike 12294 52495448 174540 12.83 492490 1061683 64.3 64.3 56.8% 0.0% 0.0% 0.0% 4.61sec 77173280 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M potion_of_the_old_war 188028 8739331 29057 4.67 270134 558138 23.4 23.4 36.0% 0.0% 0.0% 0.0% 12.96sec 12847645 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M shadow_wave 215047 5965282 19834 2.64 332077 672173 13.2 13.2 35.1% 0.0% 0.0% 0.0% 19.72sec 5965282 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M slam 1464 16969023 56420 15.67 158914 313294 78.6 78.6 37.0% 0.0% 0.0% 0.0% 3.07sec 24946070 300.76sec
Warrior_Arms_T19M Warrior_Arms_T19M warbreaker 209577 1751204 5823 0.87 303443 623217 4.4 4.4 30.8% 0.0% 0.0% 0.0% 70.36sec 1751204 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M auto_attack_mh 0 15220897 50607 45.13 46342 99766 226.2 226.2 40.1% 1.1% 0.0% 0.0% 1.33sec 22376160 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M auto_attack_oh 1 7609522 25301 45.13 23171 49886 226.2 226.2 40.1% 1.1% 0.0% 0.0% 1.33sec 11186719 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M avatar 107574 0 0 0.00 0 0 4.1 0.0 0.0% 0.0% 0.0% 0.0% 86.13sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M battle_cry 1719 0 0 0.00 0 0 7.4 0.0 0.0% 0.0% 0.0% 0.0% 43.66sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.22sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M bloodthirst 23881 9937242 33040 10.09 129224 265291 50.6 50.6 49.5% 0.0% 0.0% 0.0% 5.23sec 14608687 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M dragon_roar 118000 2026341 6737 2.73 0 147817 13.7 13.7 100.0% 0.0% 0.0% 0.0% 22.68sec 2026341 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M execute 5308 20867208 69381 8.80 302215 631205 44.1 44.1 51.9% 0.0% 0.0% 0.0% 6.82sec 30676773 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M execute_offhand 163558 10438104 34705 8.80 151268 315292 0.0 44.1 52.0% 0.0% 0.0% 0.0% 0.00sec 15345002 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M felcrazed_rage 225777 436373 1451 0.57 77958 156586 2.9 2.9 94.6% 0.0% 0.0% 0.0% 129.11sec 436373 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M furious_slash 100130 3163647 10519 5.49 84135 178132 27.5 27.5 32.9% 0.0% 0.0% 0.0% 8.72sec 4650861 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M heroic_leap 6544 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 26.35sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M mark_of_the_hidden_satyr 191259 2024978 6733 3.87 71543 156230 19.4 19.4 38.9% 0.0% 0.0% 0.0% 15.56sec 2024978 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury 205545 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 44.30sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury_mh 205546 3150777 10476 1.45 0 434634 0.0 7.2 100.0% 0.0% 0.0% 0.0% 0.00sec 6092537 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury_mh ticks -205546 2941760 9806 5.75 52877 112670 0.0 28.7 82.8% 0.0% 0.0% 0.0% 0.00sec 6092537 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury_oh 205547 1575389 5238 1.45 0 217317 0.0 7.2 100.0% 0.0% 0.0% 0.0% 0.00sec 1575389 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M potion_of_the_old_war 188028 7847545 26092 5.51 180332 403262 27.6 27.6 46.5% 0.0% 0.0% 0.0% 11.01sec 11536635 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M raging_blow 85288 0 0 0.00 0 0 61.7 0.0 0.0% 0.0% 0.0% 0.0% 4.73sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M raging_blow_oh 85384 9407212 31278 12.30 108054 230990 0.0 61.7 36.2% 0.0% 0.0% 0.0% 0.00sec 13829492 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M raging_blow_mh 96103 18817207 62565 12.30 216181 461685 0.0 61.7 36.2% 0.0% 0.0% 0.0% 0.00sec 27663076 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage 184367 0 0 0.00 0 0 49.5 0.0 0.0% 0.0% 0.0% 0.0% 6.11sec 0 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage1 218617 1859579 6183 9.88 25962 55357 0.0 49.5 39.5% 0.0% 0.0% 0.0% 0.00sec 2733757 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage2 184707 2951775 9814 9.87 41302 87878 0.0 49.5 39.5% 0.0% 0.0% 0.0% 0.00sec 4339389 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage3 184709 3909026 12997 9.86 54656 116327 0.0 49.4 39.7% 0.0% 0.0% 0.0% 0.00sec 5746638 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage4 201364 5920400 19685 9.83 82609 176866 0.0 49.3 39.8% 0.0% 0.0% 0.0% 0.00sec 8703548 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage5 201363 6898384 22936 9.83 96256 206106 0.0 49.3 39.8% 0.0% 0.0% 0.0% 0.00sec 10141277 300.76sec
Warrior_Fury_T19M Warrior_Fury_T19M rend_flesh ticks -221770 3388668 11296 26.55 17406 37983 45.4 132.7 39.5% 0.0% 0.0% 0.0% 6.65sec 3388668 300.76sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.55% 9.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.34% 9.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.70% 10.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.37% 11.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.37%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.42% 11.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.36% 11.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.37% 11.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.37%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.51% 11.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.10% 8.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.28% 5.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Agonizing Poison 1.0 199.2 173.0sec 1.5sec 99.40% 100.00% 195.1(195.1) 0.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_agonizing_poison
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • agonizing_poison_1:0.60%
  • agonizing_poison_2:0.58%
  • agonizing_poison_3:0.52%
  • agonizing_poison_4:0.44%
  • agonizing_poison_5:97.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:200803
  • name:Agonizing Poison
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=20}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${$200803s1}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Blood of the Assassinated 4.0 0.1 61.8sec 60.2sec 13.38% 12.67% 0.1(0.1) 3.9

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:13.38%

Trigger Attempt Success

  • trigger_pct:34.72%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood of the Assassinated 6.3 0.8 44.8sec 39.0sec 22.48% 18.86% 0.8(0.8) 6.1

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:22.48%

Trigger Attempt Success

  • trigger_pct:34.85%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Brutal Haymaker 4.8 0.0 54.2sec 54.2sec 19.59% 19.59% 0.0(0.0) 2.4

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_brutal_haymaker
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:605058.69

Stack Uptimes

  • brutal_haymaker_1:19.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214169
  • name:Brutal Haymaker
  • tooltip:Damage taken from the caster increased by $s2%.
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal $214169s1 Physical damage and increase all damage the target takes from you by $214169s2% for {$214169d=15 seconds}, up to $214169s3 extra damage dealt.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Chilled 1.0 388.5 1.1sec 0.8sec 99.64% 99.64% 388.5(388.5) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_chilled
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chilled_1:99.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205708
  • name:Chilled
  • tooltip:Movement speed reduced by $s1%.
  • description:Chilled, reducing movement speed by $s1% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 8.7 49.9 35.5sec 5.2sec 89.92% 90.04% 49.9(49.9) 7.7

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:89.92%

Trigger Attempt Success

  • trigger_pct:100.00%
Frost Bomb 19.6 0.3 15.6sec 15.4sec 77.58% 77.58% 38.5(38.5) 18.8

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_frost_bomb
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frost_bomb_1:77.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112948
  • name:Frost Bomb
  • tooltip:The Mage's Ice Lances that hit the target while frozen will cause the Frost Bomb to release a wave of freezing ice that deals $113092s1 Frost damage to the target, $113092s2 Frost damage to all other enemies within $113092A2 yards.
  • description:Places a Frost Bomb on the target for {$d=12 seconds}. Limit 1 target. Your Ice Lances that benefit from Shatter will trigger the release of a wave of freezing ice, dealing $113092s1 Frost damage to the target and $113092s2 Frost damage to all other enemies within $113092A2 yards.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Ghostly Strike 3.9 16.9 63.1sec 14.8sec 97.48% 97.48% 73.2(73.2) 2.9

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_ghostly_strike
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • ghostly_strike_1:97.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196937
  • name:Ghostly Strike
  • tooltip:Taking $s5% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take $s5% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards $s1 combo $lpoint:points;.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 29.1 0.1 10.3sec 10.3sec 52.35% 100.00% 0.1(0.1) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:52.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 26.4 42.5 11.6sec 4.3sec 86.61% 100.00% 42.5(42.5) 25.5

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:86.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Kingsbane 6.9 61.1 46.4sec 4.2sec 44.11% 84.44% 0.0(0.0) 6.4

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:3.20%
  • kingsbane_2:3.53%
  • kingsbane_3:3.44%
  • kingsbane_4:3.45%
  • kingsbane_5:3.52%
  • kingsbane_6:3.59%
  • kingsbane_7:3.62%
  • kingsbane_8:3.61%
  • kingsbane_9:3.47%
  • kingsbane_10:3.07%
  • kingsbane_11:2.65%
  • kingsbane_12:2.19%
  • kingsbane_13:1.65%
  • kingsbane_14:1.18%
  • kingsbane_15:0.80%
  • kingsbane_16:0.52%
  • kingsbane_17:0.30%
  • kingsbane_18:0.17%
  • kingsbane_19:0.08%
  • kingsbane_20:0.04%
  • kingsbane_21:0.01%
  • kingsbane_22:0.01%
  • kingsbane_23:0.00%
  • kingsbane_24:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%. |cFFFFFFFFAwards $s6 combo $lpoint:points;.|r}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Kingsbane 6.8 139.1 46.5sec 1.9sec 43.84% 87.02% 0.0(0.0) 6.4

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:1.19%
  • kingsbane_2:1.68%
  • kingsbane_3:1.59%
  • kingsbane_4:1.57%
  • kingsbane_5:1.59%
  • kingsbane_6:1.53%
  • kingsbane_7:1.51%
  • kingsbane_8:1.51%
  • kingsbane_9:1.49%
  • kingsbane_10:1.48%
  • kingsbane_11:1.47%
  • kingsbane_12:1.47%
  • kingsbane_13:1.50%
  • kingsbane_14:1.51%
  • kingsbane_15:1.56%
  • kingsbane_16:1.67%
  • kingsbane_17:1.83%
  • kingsbane_18:1.96%
  • kingsbane_19:2.16%
  • kingsbane_20:2.26%
  • kingsbane_21:2.25%
  • kingsbane_22:2.13%
  • kingsbane_23:1.88%
  • kingsbane_24:1.58%
  • kingsbane_25:1.19%
  • kingsbane_26:0.85%
  • kingsbane_27:0.59%
  • kingsbane_28:0.36%
  • kingsbane_29:0.23%
  • kingsbane_30:0.13%
  • kingsbane_31:0.06%
  • kingsbane_32:0.03%
  • kingsbane_33:0.01%
  • kingsbane_34:0.00%
  • kingsbane_35:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%. |cFFFFFFFFAwards $s6 combo $lpoint:points;.|r}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lacerate 8.8 16.4 34.7sec 11.9sec 91.14% 91.14% 16.4(16.4) 8.0

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_lacerate
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lacerate_1:91.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185855
  • name:Lacerate
  • tooltip:Bleeding for $s1 damage every $t1 sec.
  • description:Tears a bleeding wound in the target, dealing ${$o1+$s2} Physical damage over {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:10.00
  • default_chance:0.00%
Lightning Rod 10.5 29.2 29.0sec 7.4sec 76.49% 80.87% 29.2(29.2) 9.8

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_lightning_rod
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.40

Stack Uptimes

  • lightning_rod_1:76.49%

Trigger Attempt Success

  • trigger_pct:29.98%

Spelldata details

  • id:197209
  • name:Lightning Rod
  • tooltip:Casting Shaman's Lightning Bolt and Chain Lightning also deal $210689s2% of their damage to the Lightning Rod.
  • description:{$@spelldesc210689=Your Lightning Bolt and Chain Lightning have a $s1% chance to make the primary target a Lightning Rod for {$197209d=10 seconds}. Lightning Rods take $s2% of all damage you deal with Lightning Bolt and Chain Lightning.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Maddening Whispers 2.4 20.9 158.7sec 10.0sec 4.64% 4.64% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.50%
  • maddening_whispers_2:0.45%
  • maddening_whispers_3:0.47%
  • maddening_whispers_4:0.45%
  • maddening_whispers_5:0.47%
  • maddening_whispers_6:0.45%
  • maddening_whispers_7:0.47%
  • maddening_whispers_8:0.59%
  • maddening_whispers_9:0.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222050
  • name:Maddening Whispers
  • tooltip:Deals $222046s1 Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals $s1 Shadow damage.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Maddening Whispers 3.0 26.1 121.2sec 8.9sec 11.58% 11.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:1.86%
  • maddening_whispers_2:0.97%
  • maddening_whispers_3:1.16%
  • maddening_whispers_4:1.17%
  • maddening_whispers_5:1.33%
  • maddening_whispers_6:1.27%
  • maddening_whispers_7:1.29%
  • maddening_whispers_8:1.16%
  • maddening_whispers_9:1.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222050
  • name:Maddening Whispers
  • tooltip:Deals $222046s1 Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals $s1 Shadow damage.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Marked for Death 1.7 12.5 149.3sec 20.3sec 99.69% 99.69% 12.5(12.5) 0.7

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:99.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Surge of Toxins 33.1 11.9 9.1sec 6.7sec 70.18% 71.27% 11.9(11.9) 32.4

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_surge_of_toxins
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • surge_of_toxins_1:70.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192425
  • name:Surge of Toxins
  • tooltip:Damage taken from Poison effects increased by $w1%.
  • description:{$@spelldesc192424=Finishing moves increase Poison damage you deal to the target by $192425s1% for {$192425d=5 seconds}.{$?s200802=false}[ Agonizing Poison's effect is increased by ${$m1/10}.1% increased damage per application on the target.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Surge of Toxins 35.5 13.1 8.5sec 6.2sec 75.38% 100.00% 13.1(13.1) 34.7

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_surge_of_toxins
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • surge_of_toxins_1:75.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192425
  • name:Surge of Toxins
  • tooltip:Damage taken from Poison effects increased by $w1%.
  • description:{$@spelldesc192424=Finishing moves increase Poison damage you deal to the target by $192425s1% for {$192425d=5 seconds}.{$?s200802=false}[ Agonizing Poison's effect is increased by ${$m1/10}.1% increased damage per application on the target.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Touch of the Magi 8.3 0.0 34.1sec 34.2sec 16.45% 16.45% 0.0(0.0) 8.1

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • touch_of_the_magi_1:16.45%

Trigger Attempt Success

  • trigger_pct:10.20%

Spelldata details

  • id:210824
  • name:Touch of the Magi
  • tooltip:Accumulating Damage...
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=6 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Vendetta 5.3 0.0 62.0sec 62.0sec 33.98% 32.83% 0.0(0.0) 4.9

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:33.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Vendetta 3.6 0.0 93.5sec 93.5sec 23.75% 22.52% 0.0(0.0) 3.5

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:23.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Vulnerable (vulnerability) 8.7 67.5 34.5sec 4.0sec 95.97% 99.06% 67.5(67.5) 7.7

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:95.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Water Jet 10.2 0.0 29.2sec 29.2sec 7.68% 16.98% 0.0(0.0) 0.1

Buff details

  • buff initial source:Mage_Frost_T19M_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • water_jet_1:7.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $w1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, {$?s198146=false}[slowing the target by $m2% and ][]dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
winters_chill 19.6 39.2 14.2sec 4.6sec 9.09% 20.96% 39.2(39.2) 19.5

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_winters_chill
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • winters_chill_1:9.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 6769065.72
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 12103
death count pct 161.35
avg death time 300.36
min death time 227.31
max death time 377.83
dmg taken 2036198978.50

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7499
Mean 300.76
Minimum 227.31
Maximum 377.83
Spread ( max - min ) 150.52
Range [ ( max - min ) / 2 * 100% ] 25.02%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 6782514.98
Minimum 6425533.60
Maximum 7244706.26
Spread ( max - min ) 819172.66
Range [ ( max - min ) / 2 * 100% ] 6.04%
Standard Deviation 119216.2968
5th Percentile 6580433.52
95th Percentile 6973169.14
( 95th Percentile - 5th Percentile ) 392735.62
Mean Distribution
Standard Deviation 1376.6830
95.00% Confidence Intervall ( 6779816.73 - 6785213.23 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1186
0.1 Scale Factor Error with Delta=300 121326291
0.05 Scale Factor Error with Delta=300 485305166
0.01 Scale Factor Error with Delta=300 -
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 3757
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 2439668408 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.