close

SimulationCraft 710-01

for World of Warcraft 7.1.0 Live (wow build level 22900, git build 354ae31)

Current simulator hotfixes

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mark of the Hidden Satyr

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 In-game testing shows that the damage from this ability is roughly 10% higher than what spelldata shows.
Mark of the Hidden Satyr (effect#1) average 29.13 26.49

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Hunter_BM_T19M : 379285 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
379285.0 379285.0 263.3 / 0.069% 45933.9 / 12.1% 6982.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.9 14.9 Focus 30.75% 40.4 100.0% 100%
Talents
  • 15: Big Game Hunter (Beast Mastery Hunter)
  • 30: Stomp (Beast Mastery Hunter)
  • 60: Bestial Fury (Beast Mastery Hunter)
  • 90: A Murder of Crows
  • 100: Killer Cobra (Beast Mastery Hunter)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hunter_BM_T19M 379285
A Murder of Crows 0 (27259) 0.0% (7.2%) 5.5 60.33sec 1486688 1209050

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.50 0.00 85.56 0.00 1.2297 0.9358 0.00 0.00 0.00 94092.13 1209049.81
 
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target, dealing ${{$131900s1=1}*16} Physical damage over {$d=15 seconds}. When a target dies while affected by this ability, its cooldown will reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    A Murder of Crows (crow_peck) 27259 7.2% 0.0 0.00sec 0 0 Direct 85.6 74233 151239 95480 27.6%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 85.56 0.00 0.00 0.0000 0.0000 8169549.53 12010011.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.96 72.41% 74233.29 58455 104905 74303.18 66073 86531 4599175 6761223 31.98
crit 23.61 27.59% 151239.34 116909 209811 151380.71 125644 184899 3570374 5248788 31.98
 
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.620000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
auto_shot 16849 4.4% 122.8 2.46sec 41218 16934 Direct 122.8 29923 62405 41218 34.8%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.77 122.77 0.00 0.00 2.4340 0.0000 5060445.97 7439334.91 31.98 16934.14 16934.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.08 65.23% 29922.87 25164 36740 29933.11 28400 31944 2396302 3522791 31.98
crit 42.69 34.77% 62404.68 50328 73479 62437.21 56116 67692 2664144 3916544 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Cobra Shot 38298 10.1% 70.2 4.25sec 163797 134357 Direct 70.0 117226 241865 164278 37.7%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.19 69.98 0.00 0.00 1.2191 0.0000 11496395.73 16900790.69 31.98 134357.05 134357.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.56 62.25% 117225.95 89840 131167 117255.75 109288 128317 5106794 7507471 31.98
crit 26.42 37.75% 241864.93 179680 262333 242014.77 216415 262333 6389602 9393320 31.98
 
 

Action details: cobra_shot

Static Values
  • id:193455
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90
Spelldata
  • id:193455
  • name:Cobra Shot
  • school:physical
  • tooltip:
  • description:A quick shot causing ${$sw2*$<mult>} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.40
 
Deadly Grace 12353 3.2% 28.5 3.23sec 128142 0 Direct 28.5 99422 202991 128145 27.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.49 28.49 0.00 0.00 0.0000 0.0000 3651402.38 3651402.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.59 72.27% 99421.61 79173 115593 99329.96 85600 115593 2047404 2047404 0.00
crit 7.90 27.73% 202991.26 158346 231185 202972.28 158346 231185 1603998 1603998 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Dire Beast 0 (48956) 0.0% (12.9%) 34.2 8.87sec 429779 419285

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.21 0.00 0.00 0.00 1.0251 0.0000 0.00 0.00 0.00 419285.20 419285.20
 
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.bestial_wrath.remains>2
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r
 
    dire_beast_melee (dire_beast) 32370 6.5% 183.3 1.64sec 40591 25082 Direct 183.3 32049 64091 40591 26.7%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.26 183.26 0.00 0.00 1.6183 0.0000 7438796.93 10935736.11 31.98 25082.09 25082.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.41 73.34% 32048.62 31174 38319 32048.84 31174 34285 4307496 6332427 31.98
crit 48.86 26.66% 64090.85 62347 76638 64095.61 62347 69005 3131301 4603309 31.98
 
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stomp (dire_beast) 31592 6.4% 34.2 8.87sec 212308 0 Direct 34.2 168189 336553 212307 26.2%  

Stats details: stomp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.21 34.21 0.00 0.00 0.0000 0.0000 7262180.64 10676093.44 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.24 73.80% 168188.65 163671 201186 168185.49 163671 181175 4245462 6241232 31.98
crit 8.96 26.20% 336552.76 327341 402372 336620.21 327341 402372 3016718 4434862 31.98
 
 

Action details: stomp

Static Values
  • id:201754
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201754
  • name:Stomp
  • school:physical
  • tooltip:
  • description:{$@spelldesc199530=When your Dire Beasts charge in, they will stomp the ground, dealing ${($76657m1/100+1)*({$201754s1=1})*1.35} Physical damage to all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Kill Command 0 (140183) 0.0% (37.0%) 73.3 4.10sec 573701 561080

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.31 0.00 0.00 0.00 1.0225 0.0000 0.00 0.00 0.00 561079.72 561079.72
 
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:7.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.
 
    Kill Command (cat) 89565 23.6% 73.3 4.10sec 366543 0 Direct 73.3 260472 530620 366546 39.3%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.31 73.31 0.00 0.00 0.0000 0.0000 26872635.93 39505320.26 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.53 60.74% 260472.23 194844 349677 260470.86 239190 295924 11598218 17050479 31.98
crit 28.79 39.26% 530619.67 389689 699354 530829.98 474568 605198 15274418 22454841 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (cat) 17927 4.7% 29.4 10.09sec 183257 0 Direct 29.4 183260 0 183260 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.35 29.35 0.00 0.00 0.0000 0.0000 5378688.64 5378688.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.35 100.00% 183260.17 97422 349677 183353.76 135244 249472 5378689 5378689 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:168325.28
  • base_dd_max:168325.28
 
    Kill Command (hati) 27238 7.2% 73.3 4.10sec 111474 0 Direct 73.3 87186 176361 111473 27.2%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.31 73.31 0.00 0.00 0.0000 0.0000 8172572.80 12014456.14 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.35 72.76% 87186.50 64948 116559 87194.50 81973 94760 4651045 6837477 31.98
crit 19.97 27.24% 176361.22 129896 233118 176400.13 146227 203309 3521528 5176979 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (hati) 5454 1.4% 29.3 10.11sec 55775 0 Direct 29.3 55774 0 55774 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.34 29.34 0.00 0.00 0.0000 0.0000 1636321.98 1636321.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.34 100.00% 55773.91 32474 116559 55788.37 42841 75736 1636322 1636322 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:37684.87
  • base_dd_max:37684.87
 
Pepper Breath 3917 1.0% 14.0 21.17sec 83920 0 Periodic 69.3 16975 0 16975 0.0% 5.8%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.02 0.00 69.80 69.31 0.0000 0.2498 1176475.04 1176475.04 0.00 67477.78 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.3 100.00% 16975.24 68 16990 16976.26 16561 16990 1176475 1176475 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Titan's Thunder 0 (20610) 0.0% (5.4%) 5.4 61.04sec 1146387 0

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
 
    Titan's Thunder (cat) 5601 1.5% 5.4 61.04sec 311348 0 Periodic 42.5 30778 62464 39510 27.6% 14.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 42.47 42.47 0.0000 1.0000 1677972.53 1677972.53 0.00 39508.67 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.8 72.45% 30777.84 23873 42843 30815.08 26130 36635 946974 946974 0.00
crit 11.7 27.55% 62464.09 47745 85686 62562.20 47745 78766 730999 730999 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 9296 1.9% 5.1 63.75sec 414833 0 Periodic 40.6 41231 82442 52631 27.7% 13.5%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.15 0.00 40.59 40.59 0.0000 1.0000 2136288.71 2136288.71 0.00 52630.91 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.4 72.34% 41230.60 40104 49296 41233.23 40104 46998 1210620 1210620 0.00
crit 11.2 27.66% 82442.17 80207 98592 82436.47 80207 95732 925669 925669 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 3860 0.2% 0.5 112.11sec 409728 0 Periodic 3.7 41301 82602 52115 26.2% 1.2%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.47 0.00 3.66 3.66 0.0000 1.0000 190929.43 190929.43 0.00 52123.79 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.7 73.82% 41301.23 40104 49296 15863.50 0 49296 111709 111709 0.00
crit 1.0 26.18% 82602.40 80207 98592 29301.20 0 98592 79221 79221 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 1813 0.0% 0.1 63.14sec 412926 0 Periodic 0.4 41354 82515 52276 26.5% 0.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.05 0.00 0.41 0.41 0.0000 1.0000 21252.77 21252.77 0.00 52346.72 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 73.47% 41353.94 40104 49296 2094.81 0 48114 12351 12351 0.00
crit 0.1 26.53% 82515.00 80207 98592 3717.31 0 96755 8901 8901 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 725 0.0% 0.0 0.00sec 378299 0 Periodic 0.1 40631 82046 47287 16.1% 0.0%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.02 0.00 0.13 0.13 0.0000 1.0000 6144.07 6144.07 0.00 47628.47 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.1 83.93% 40631.45 40104 45618 660.93 0 42401 4431 4431 0.00
crit 0.0 16.07% 82046.39 80207 89404 1135.78 0 88484 1713 1713 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (hati) 7162 1.9% 5.4 61.04sec 398141 0 Periodic 42.5 39311 79882 50524 27.6% 14.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 42.47 42.47 0.0000 1.0000 2145734.55 2145734.55 0.00 50522.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.7 72.36% 39310.81 30502 54741 39357.46 33381 47216 1208182 1208182 0.00
crit 11.7 27.64% 79882.44 61005 109482 80013.87 62636 101899 937553 937553 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 5609 1.5% 10.4 28.04sec 162013 0 Direct 71.5 18523 37521 23558 26.5%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.40 71.50 0.00 0.00 0.0000 0.0000 1684378.90 1684378.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.55 73.50% 18522.95 15351 22412 18526.73 15351 22185 973363 973363 0.00
crit 18.95 26.50% 37521.01 30702 44825 37505.84 30702 44825 711016 711016 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
pet - cat 155690 / 155690
Claw 21299 5.6% 100.7 3.00sec 63547 63263 Direct 100.7 45589 93481 63548 37.5%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.69 100.69 0.00 0.00 1.0045 0.0000 6398433.18 9406302.85 31.98 63262.51 63262.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.93 62.50% 45588.80 19845 71231 45596.03 41167 51419 2869070 4217805 31.98
crit 37.76 37.50% 93480.96 39691 142461 93552.56 76173 108278 3529363 5188498 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 21299 5.6% 201.1 1.49sec 31804 21336 Direct 201.1 22847 46610 31803 37.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.10 201.10 0.00 0.00 1.4906 0.0000 6395619.48 9402166.44 31.98 21335.66 21335.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.30 62.31% 22847.47 18557 33303 22852.55 21433 24632 2862864 4208682 31.98
crit 75.79 37.69% 46610.13 37113 66605 46631.97 43210 50985 3532755 5193484 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - hati 62559 / 62559
hati_melee 22706 6.0% 182.8 1.64sec 37291 22747 Direct 183.8 29226 59118 37088 26.3%  

Stats details: hati_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 182.82 183.82 0.00 0.00 1.6394 0.0000 6817403.17 10022228.42 31.98 22746.97 22746.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.47 73.70% 29225.72 23435 42551 29231.80 27789 31627 3959126 5820291 31.98
crit 48.35 26.30% 59118.32 46870 85102 59137.10 52092 65845 2858277 4201937 31.98
 
 

Action details: hati_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Hunter_BM_T19M
Aspect of the Wild 2.8 127.30sec

Stats details: aspect_of_the_wild

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 37.46 0.00 0.0000 0.7446 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_wild

Static Values
  • id:193530
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bestial_wrath.up
Spelldata
  • id:193530
  • name:Aspect of the Wild
  • school:physical
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_BM_T19M
  • harmful:false
  • if_expr:
 
Bestial Wrath 8.9 35.38sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.93 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=true}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_BM_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Wild 2.8 0.0 127.3sec 127.3sec 12.06% 7.11% 36.1(36.1) 2.7

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:13.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:12.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bestial Wrath 8.9 0.0 35.4sec 35.4sec 43.59% 62.06% 0.0(0.0) 8.5

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • bestial_wrath_1:43.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=true}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Big Game Hunter 1.0 0.0 0.0sec 0.0sec 13.28% 18.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_big_game_hunter
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • big_game_hunter_1:13.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204308
  • name:Big Game Hunter
  • tooltip:
  • description:Increases the critical strike chance of your auto shot and Cobra Shot by {$s1=50}% on targets who are above {$s2=80}% health.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 11.83% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dire Beast 34.2 0.0 12.2sec 8.9sec 81.25% 77.80% 0.0(0.0) 24.2

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_dire_beast
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.50

Stack Uptimes

  • dire_beast_1:73.12%
  • dire_beast_2:7.58%
  • dire_beast_3:0.53%
  • dire_beast_4:0.02%
  • dire_beast_5:0.00%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:120694
  • name:Dire Beast
  • tooltip:Your Dire Beast is granting you {$s1=3} Focus every $t1 sec.
  • description:{$@spelldesc120679=Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Focused Lightning 3.5 0.0 69.7sec 69.0sec 22.37% 22.37% 3.4(3.4) 0.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_focused_lightning
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:643.16

Stack Uptimes

  • focused_lightning_1:2.24%
  • focused_lightning_2:2.24%
  • focused_lightning_3:2.24%
  • focused_lightning_4:2.24%
  • focused_lightning_5:2.24%
  • focused_lightning_6:2.24%
  • focused_lightning_7:2.24%
  • focused_lightning_8:2.24%
  • focused_lightning_9:2.24%
  • focused_lightning_10:2.24%

Trigger Attempt Success

  • trigger_pct:99.95%

Spelldata details

  • id:215632
  • name:Focused Lightning
  • tooltip:Mastery increased by {$s1=608}.
  • description:{$@spelldesc215630=Your ranged attacks and spells have a chance to trigger Focused Lightning, granting you {$215632s1=608} Mastery every $215631t1 sec. After {$215631d=10 seconds}, this bonus decreases every $215632t2 sec.}
  • max_stacks:10
  • duration:11.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.5 2.9 25.9sec 20.3sec 25.83% 25.83% 2.9(2.9) 11.2

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 58.3sec 0.0sec 19.62% 19.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
cat: Aspect of the Wild 2.8 0.0 127.3sec 127.3sec 12.06% 14.70% 36.1(36.1) 2.7

Buff details

  • buff initial source:Hunter_BM_T19M_cat
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:13.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:12.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
cat: Bestial Wrath 8.9 0.0 35.4sec 35.4sec 43.59% 49.52% 0.0(0.0) 8.5

Buff details

  • buff initial source:Hunter_BM_T19M_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • bestial_wrath_1:43.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=false}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
hati: Bestial Wrath 8.9 0.0 35.4sec 35.4sec 43.59% 51.31% 0.0(0.0) 8.5

Buff details

  • buff initial source:Hunter_BM_T19M_hati
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • bestial_wrath_1:43.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=false}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_BM_T19M
a_murder_of_crows Focus 5.5 154.5 28.1 28.1 52894.0
cobra_shot Focus 70.2 2416.5 34.4 34.4 4757.5
kill_command Focus 73.3 1903.2 26.0 26.0 22099.7
pet - cat
claw Focus 100.7 4724.3 46.9 46.9 1354.4
Resource Gains Type Count Total Average Overflow
dire_beast Focus 1159.43 390.14 (8.86%) 0.34 1.82 0.47%
aspect_of_the_wild Focus 105.66 353.06 (8.02%) 3.34 8.42 2.33%
focus_regen Focus 1491.29 3660.10 (83.12%) 2.45 4.27 0.12%
pet - cat
focus_regen Focus 625.52 4380.69 (94.29%) 7.00 197.47 4.31%
aspect_of_the_wild Focus 91.64 265.34 (5.71%) 2.90 96.14 26.60%
Resource RPS-Gain RPS-Loss
Focus 14.65 14.89
Combat End Resource Mean Min Max
Focus 69.22 0.02 140.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 87.6%
Uptimes %
Focus Cap 0.1%
cat-Focus Cap 2.2%

Procs

Count Interval
starved: a_murder_of_crows 3.0 5.4sec
wild_call 8.5 32.1sec

Statistics & Data Analysis

Fight Length
Sample Data Hunter_BM_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Hunter_BM_T19M Damage Per Second
Count 7499
Mean 379285.03
Minimum 343905.10
Maximum 431475.29
Spread ( max - min ) 87570.19
Range [ ( max - min ) / 2 * 100% ] 11.54%
Standard Deviation 11631.1532
5th Percentile 360917.07
95th Percentile 399605.23
( 95th Percentile - 5th Percentile ) 38688.16
Mean Distribution
Standard Deviation 134.3139
95.00% Confidence Intervall ( 379021.78 - 379548.28 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3612
0.1 Scale Factor Error with Delta=300 1154859
0.05 Scale Factor Error with Delta=300 4619438
0.01 Scale Factor Error with Delta=300 115485969
Priority Target DPS
Sample Data Hunter_BM_T19M Priority Target Damage Per Second
Count 7499
Mean 379285.03
Minimum 343905.10
Maximum 431475.29
Spread ( max - min ) 87570.19
Range [ ( max - min ) / 2 * 100% ] 11.54%
Standard Deviation 11631.1532
5th Percentile 360917.07
95th Percentile 399605.23
( 95th Percentile - 5th Percentile ) 38688.16
Mean Distribution
Standard Deviation 134.3139
95.00% Confidence Intervall ( 379021.78 - 379548.28 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3612
0.1 Scale Factor Error with Delta=300 1154859
0.05 Scale Factor Error with Delta=300 4619438
0.01 Scale Factor Error with Delta=300 115485969
DPS(e)
Sample Data Hunter_BM_T19M Damage Per Second (Effective)
Count 7499
Mean 379285.03
Minimum 343905.10
Maximum 431475.29
Spread ( max - min ) 87570.19
Range [ ( max - min ) / 2 * 100% ] 11.54%
Damage
Sample Data Hunter_BM_T19M Damage
Count 7499
Mean 31238647.55
Minimum 23048876.54
Maximum 40002351.33
Spread ( max - min ) 16953474.79
Range [ ( max - min ) / 2 * 100% ] 27.14%
DTPS
Sample Data Hunter_BM_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hunter_BM_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hunter_BM_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hunter_BM_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hunter_BM_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hunter_BM_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hunter_BM_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hunter_BM_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
7 1.00 potion,name=deadly_grace
8 5.50 a_murder_of_crows
0.00 stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
9 34.22 dire_beast,if=cooldown.bestial_wrath.remains>2
0.00 dire_frenzy,if=cooldown.bestial_wrath.remains>2
A 2.84 aspect_of_the_wild,if=buff.bestial_wrath.up
0.00 barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
B 5.39 titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
C 8.93 bestial_wrath
0.00 multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
D 73.32 kill_command
0.00 multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
0.00 chimaera_shot,if=focus<90
E 70.19 cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

Sample Sequence

024568C9ABDED9EDEDEDED9E9DEDEED9CEDEDEDE9DEDED9D9EDED79CE8BDEDEDE9DED9DED9EDEE9CDEDEDED9EDE9D8BD9DEE9CAD9EDEDEDED9EDEED9EDE9CDED9EDED89BEDED9DED9CEDEDEDED9EDED9DE9DE8D9BCEDEDEDE9DEADED9EDEED9EEDE9CDEDEDED

Sample Sequence Table

time name target resources buffs
Pre flask Hunter_BM_T19M 140.0/140: 100% focus
Pre summon_pet Fluffy_Pillow 140.0/140: 100% focus
Pre potion Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
Pre augmentation Hunter_BM_T19M 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 a_murder_of_crows Fluffy_Pillow 140.0/140: 100% focus bloodlust, potion_of_deadly_grace
0:00.993 bestial_wrath Fluffy_Pillow 125.3/140: 90% focus bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:00.993 dire_beast Fluffy_Pillow 125.3/140: 90% focus bloodlust, bestial_wrath, mark_of_the_claw, potion_of_deadly_grace
0:01.749 aspect_of_the_wild Fluffy_Pillow 138.1/140: 99% focus bloodlust, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:01.749 titans_thunder Fluffy_Pillow 138.1/140: 99% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:01.749 kill_command Fluffy_Pillow 138.1/140: 99% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:02.501 cobra_shot Fluffy_Pillow 134.3/140: 96% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:03.479 kill_command Fluffy_Pillow 128.7/140: 92% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:04.234 dire_beast Fluffy_Pillow 125.0/140: 89% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:04.989 cobra_shot Fluffy_Pillow 140.0/140: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), mark_of_the_claw, potion_of_deadly_grace
0:05.966 kill_command Fluffy_Pillow 135.8/140: 97% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), mark_of_the_claw, potion_of_deadly_grace
0:06.719 cobra_shot Fluffy_Pillow 133.2/140: 95% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), mark_of_the_claw, potion_of_deadly_grace
0:07.696 kill_command Fluffy_Pillow 128.9/140: 92% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), mark_of_the_claw, potion_of_deadly_grace
0:08.449 cobra_shot Fluffy_Pillow 126.3/140: 90% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), mark_of_the_claw, potion_of_deadly_grace
0:09.425 kill_command Fluffy_Pillow 121.4/140: 87% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:10.179 cobra_shot Fluffy_Pillow 117.7/140: 84% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:11.156 kill_command Fluffy_Pillow 112.0/140: 80% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:11.910 dire_beast Fluffy_Pillow 108.3/140: 77% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:12.664 cobra_shot Fluffy_Pillow 128.7/140: 92% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:13.640 dire_beast Fluffy_Pillow 123.0/140: 88% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning, mark_of_the_claw, potion_of_deadly_grace
0:14.403 kill_command Fluffy_Pillow 140.0/140: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), focused_lightning(2), potion_of_deadly_grace
0:15.159 cobra_shot Fluffy_Pillow 133.2/140: 95% focus bloodlust, bestial_wrath, dire_beast(2), focused_lightning(3), potion_of_deadly_grace
0:16.151 kill_command Fluffy_Pillow 119.3/140: 85% focus bloodlust, dire_beast(2), focused_lightning(4), potion_of_deadly_grace
0:16.907 Waiting 0.900 sec 103.0/140: 74% focus bloodlust, dire_beast(2), focused_lightning(5), potion_of_deadly_grace
0:17.807 cobra_shot Fluffy_Pillow 119.4/140: 85% focus bloodlust, dire_beast(2), focused_lightning(6), potion_of_deadly_grace
0:18.799 Waiting 1.200 sec 97.5/140: 70% focus bloodlust, dire_beast(2), focused_lightning(7), potion_of_deadly_grace
0:19.999 cobra_shot Fluffy_Pillow 119.1/140: 85% focus bloodlust, dire_beast, focused_lightning(8), potion_of_deadly_grace
0:20.991 kill_command Fluffy_Pillow 95.7/140: 68% focus bloodlust, dire_beast, focused_lightning(9), potion_of_deadly_grace
0:21.841 dire_beast Fluffy_Pillow 79.4/140: 57% focus bloodlust, focused_lightning(10), potion_of_deadly_grace
0:22.595 bestial_wrath Fluffy_Pillow 92.0/140: 66% focus bloodlust, dire_beast, focused_lightning(10), potion_of_deadly_grace
0:22.595 cobra_shot Fluffy_Pillow 92.0/140: 66% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(10), potion_of_deadly_grace
0:23.587 kill_command Fluffy_Pillow 76.5/140: 55% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(10), potion_of_deadly_grace
0:24.341 cobra_shot Fluffy_Pillow 65.1/140: 47% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(9), potion_of_deadly_grace
0:25.332 kill_command Fluffy_Pillow 49.7/140: 35% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(8), potion_of_deadly_grace
0:26.086 cobra_shot Fluffy_Pillow 38.3/140: 27% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(7), potion_of_deadly_grace
0:27.079 Waiting 0.100 sec 22.8/140: 16% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(6), potion_of_deadly_grace
0:27.179 kill_command Fluffy_Pillow 24.5/140: 18% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(6), potion_of_deadly_grace
0:27.934 Waiting 1.200 sec 13.1/140: 9% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(5), potion_of_deadly_grace
0:29.134 cobra_shot Fluffy_Pillow 33.2/140: 24% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(4)
0:30.125 dire_beast Fluffy_Pillow 16.6/140: 12% focus bloodlust, bestial_wrath, focused_lightning(3)
0:30.879 kill_command Fluffy_Pillow 29.2/140: 21% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(2)
0:31.632 Waiting 0.900 sec 17.8/140: 13% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(2)
0:32.532 cobra_shot Fluffy_Pillow 32.8/140: 23% focus bloodlust, bestial_wrath, dire_beast, focused_lightning
0:33.523 Waiting 0.400 sec 17.4/140: 12% focus bloodlust, bestial_wrath, dire_beast
0:33.923 kill_command Fluffy_Pillow 24.0/140: 17% focus bloodlust, bestial_wrath, dire_beast
0:34.678 Waiting 1.200 sec 12.6/140: 9% focus bloodlust, bestial_wrath, dire_beast
0:35.878 cobra_shot Fluffy_Pillow 32.7/140: 23% focus bloodlust, bestial_wrath, dire_beast
0:36.870 Waiting 0.500 sec 17.2/140: 12% focus bloodlust, bestial_wrath, dire_beast
0:37.370 kill_command Fluffy_Pillow 25.6/140: 18% focus bloodlust, bestial_wrath, dire_beast
0:38.126 dire_beast Fluffy_Pillow 14.2/140: 10% focus bloodlust, dire_beast
0:38.880 Waiting 3.900 sec 26.8/140: 19% focus bloodlust, dire_beast
0:42.780 kill_command Fluffy_Pillow 82.1/140: 59% focus dire_beast
0:44.097 Waiting 3.500 sec 69.5/140: 50% focus dire_beast
0:47.597 dire_beast Fluffy_Pillow 113.4/140: 81% focus
0:48.928 cobra_shot Fluffy_Pillow 130.6/140: 93% focus dire_beast
0:50.215 kill_command Fluffy_Pillow 107.6/140: 77% focus dire_beast
0:51.316 Waiting 2.100 sec 92.1/140: 66% focus dire_beast
0:53.416 cobra_shot Fluffy_Pillow 119.8/140: 86% focus dire_beast
0:54.704 Waiting 1.700 sec 96.8/140: 69% focus dire_beast
0:56.404 kill_command Fluffy_Pillow 118.3/140: 84% focus
0:57.732 Waiting 0.100 sec 103.8/140: 74% focus
0:57.832 potion Fluffy_Pillow 105.0/140: 75% focus
0:58.000 dire_beast Fluffy_Pillow 106.9/140: 76% focus potion_of_deadly_grace
0:59.194 bestial_wrath Fluffy_Pillow 122.6/140: 88% focus dire_beast, potion_of_deadly_grace
0:59.194 cobra_shot Fluffy_Pillow 122.6/140: 88% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:00.481 a_murder_of_crows Fluffy_Pillow 107.8/140: 77% focus bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:01.751 titans_thunder Fluffy_Pillow 100.7/140: 72% focus bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:01.751 kill_command Fluffy_Pillow 100.7/140: 72% focus bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:02.821 cobra_shot Fluffy_Pillow 91.0/140: 65% focus bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:04.088 kill_command Fluffy_Pillow 75.9/140: 54% focus bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:05.156 cobra_shot Fluffy_Pillow 66.2/140: 47% focus bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:06.425 kill_command Fluffy_Pillow 49.6/140: 35% focus bestial_wrath, potion_of_deadly_grace
1:07.528 cobra_shot Fluffy_Pillow 38.5/140: 28% focus bestial_wrath, potion_of_deadly_grace
1:08.816 dire_beast Fluffy_Pillow 21.6/140: 15% focus bestial_wrath, potion_of_deadly_grace
1:09.917 kill_command Fluffy_Pillow 36.1/140: 26% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:11.018 Waiting 0.500 sec 26.6/140: 19% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:11.518 cobra_shot Fluffy_Pillow 33.2/140: 24% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:12.804 Waiting 0.500 sec 18.2/140: 13% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:13.304 kill_command Fluffy_Pillow 24.8/140: 18% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:14.403 Waiting 4.400 sec 15.3/140: 11% focus dire_beast, potion_of_deadly_grace
1:18.803 dire_beast Fluffy_Pillow 70.9/140: 51% focus mark_of_the_claw, potion_of_deadly_grace
1:20.090 kill_command Fluffy_Pillow 87.8/140: 63% focus dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:21.159 Waiting 3.600 sec 72.1/140: 51% focus dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:24.759 cobra_shot Fluffy_Pillow 120.2/140: 86% focus dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:26.028 Waiting 0.200 sec 97.1/140: 69% focus dire_beast, potion_of_deadly_grace
1:26.228 kill_command Fluffy_Pillow 99.8/140: 71% focus dire_beast, potion_of_deadly_grace
1:27.520 Waiting 1.400 sec 85.2/140: 61% focus potion_of_deadly_grace
1:28.920 dire_beast Fluffy_Pillow 101.7/140: 73% focus mark_of_the_claw
1:30.232 Waiting 0.100 sec 118.9/140: 85% focus dire_beast, mark_of_the_claw
1:30.332 cobra_shot Fluffy_Pillow 120.2/140: 86% focus dire_beast, mark_of_the_claw
1:31.601 Waiting 1.000 sec 97.2/140: 69% focus dire_beast, mark_of_the_claw
1:32.601 kill_command Fluffy_Pillow 110.6/140: 79% focus dire_beast, mark_of_the_claw
1:33.832 Waiting 1.700 sec 97.0/140: 69% focus dire_beast
1:35.532 cobra_shot Fluffy_Pillow 119.4/140: 85% focus dire_beast
1:36.820 Waiting 1.900 sec 96.4/140: 69% focus dire_beast
1:38.720 cobra_shot Fluffy_Pillow 119.2/140: 85% focus mark_of_the_claw
1:39.989 dire_beast Fluffy_Pillow 94.2/140: 67% focus mark_of_the_claw
1:41.059 bestial_wrath Fluffy_Pillow 108.5/140: 78% focus dire_beast, mark_of_the_claw
1:41.059 kill_command Fluffy_Pillow 108.5/140: 78% focus bestial_wrath, dire_beast, mark_of_the_claw
1:42.129 cobra_shot Fluffy_Pillow 98.8/140: 71% focus bestial_wrath, dire_beast, mark_of_the_claw
1:43.399 kill_command Fluffy_Pillow 83.8/140: 60% focus bestial_wrath, dire_beast, mark_of_the_claw
1:44.469 cobra_shot Fluffy_Pillow 74.1/140: 53% focus bestial_wrath, dire_beast, mark_of_the_claw
1:45.736 kill_command Fluffy_Pillow 59.0/140: 42% focus bestial_wrath, dire_beast, mark_of_the_claw
1:46.804 cobra_shot Fluffy_Pillow 49.3/140: 35% focus bestial_wrath, dire_beast, mark_of_the_claw
1:48.072 kill_command Fluffy_Pillow 33.9/140: 24% focus bestial_wrath, mark_of_the_claw
1:49.155 Waiting 0.800 sec 22.6/140: 16% focus bestial_wrath
1:49.955 dire_beast Fluffy_Pillow 31.9/140: 23% focus bestial_wrath
1:51.238 cobra_shot Fluffy_Pillow 48.6/140: 35% focus bestial_wrath, dire_beast
1:52.526 kill_command Fluffy_Pillow 33.5/140: 24% focus bestial_wrath, dire_beast
1:53.625 Waiting 0.700 sec 24.0/140: 17% focus bestial_wrath, dire_beast
1:54.325 cobra_shot Fluffy_Pillow 33.3/140: 24% focus bestial_wrath, dire_beast
1:55.611 dire_beast Fluffy_Pillow 18.2/140: 13% focus bestial_wrath, dire_beast
1:56.712 kill_command Fluffy_Pillow 34.4/140: 25% focus dire_beast(2)
1:57.814 Waiting 2.500 sec 20.6/140: 15% focus dire_beast(2)
2:00.314 a_murder_of_crows Fluffy_Pillow 54.0/140: 39% focus dire_beast
2:01.767 titans_thunder Fluffy_Pillow 43.2/140: 31% focus dire_beast, focused_lightning(2)
2:01.767 Waiting 1.200 sec 43.2/140: 31% focus dire_beast, focused_lightning(2)
2:02.967 kill_command Fluffy_Pillow 59.0/140: 42% focus dire_beast, focused_lightning(3)
2:04.230 Waiting 1.400 sec 44.5/140: 32% focus focused_lightning(4)
2:05.630 dire_beast Fluffy_Pillow 60.9/140: 44% focus focused_lightning(6)
2:06.977 Waiting 2.400 sec 78.3/140: 56% focus dire_beast, focused_lightning(7)
2:09.377 kill_command Fluffy_Pillow 110.0/140: 79% focus dire_beast, focused_lightning(9)
2:10.644 Waiting 1.700 sec 96.7/140: 69% focus dire_beast, focused_lightning(10)
2:12.344 cobra_shot Fluffy_Pillow 119.1/140: 85% focus dire_beast, focused_lightning(9)
2:13.633 Waiting 2.000 sec 96.1/140: 69% focus dire_beast, focused_lightning(7)
2:15.633 cobra_shot Fluffy_Pillow 119.8/140: 86% focus focused_lightning(5)
2:16.921 dire_beast Fluffy_Pillow 94.8/140: 68% focus focused_lightning(4)
2:18.022 bestial_wrath Fluffy_Pillow 109.4/140: 78% focus dire_beast, focused_lightning(3)
2:18.022 aspect_of_the_wild Fluffy_Pillow 109.4/140: 78% focus bestial_wrath, dire_beast, focused_lightning(3)
2:18.022 kill_command Fluffy_Pillow 109.4/140: 78% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(3)
2:19.124 dire_beast Fluffy_Pillow 110.9/140: 79% focus aspect_of_the_wild, bestial_wrath, dire_beast, focused_lightning(2)
2:20.225 cobra_shot Fluffy_Pillow 138.1/140: 99% focus aspect_of_the_wild, bestial_wrath, dire_beast(2), focused_lightning
2:21.512 kill_command Fluffy_Pillow 137.9/140: 98% focus aspect_of_the_wild, bestial_wrath, dire_beast(2)
2:22.614 cobra_shot Fluffy_Pillow 140.0/140: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast(2)
2:23.902 kill_command Fluffy_Pillow 139.8/140: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast(2)
2:25.004 cobra_shot Fluffy_Pillow 140.0/140: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:26.290 kill_command Fluffy_Pillow 137.8/140: 98% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:27.375 cobra_shot Fluffy_Pillow 137.6/140: 98% focus aspect_of_the_wild, bestial_wrath, mark_of_the_claw
2:28.643 kill_command Fluffy_Pillow 133.3/140: 95% focus aspect_of_the_wild, bestial_wrath, mark_of_the_claw
2:29.713 dire_beast Fluffy_Pillow 132.7/140: 95% focus aspect_of_the_wild, bestial_wrath, mark_of_the_claw
2:30.782 cobra_shot Fluffy_Pillow 140.0/140: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw
2:32.051 kill_command Fluffy_Pillow 127.4/140: 91% focus bestial_wrath, dire_beast, mark_of_the_claw
2:33.132 Waiting 0.200 sec 117.7/140: 84% focus dire_beast
2:33.332 cobra_shot Fluffy_Pillow 120.3/140: 86% focus dire_beast
2:34.621 Waiting 1.700 sec 97.3/140: 69% focus dire_beast
2:36.321 cobra_shot Fluffy_Pillow 119.7/140: 86% focus dire_beast
2:37.609 Waiting 0.700 sec 96.7/140: 69% focus dire_beast
2:38.309 kill_command Fluffy_Pillow 105.0/140: 75% focus
2:39.563 Waiting 0.200 sec 89.7/140: 64% focus
2:39.763 dire_beast Fluffy_Pillow 92.0/140: 66% focus
2:41.041 Waiting 0.800 sec 108.6/140: 78% focus dire_beast
2:41.841 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast
2:43.130 Waiting 1.500 sec 96.2/140: 69% focus dire_beast
2:44.630 kill_command Fluffy_Pillow 116.0/140: 83% focus dire_beast
2:45.979 Waiting 1.200 sec 103.8/140: 74% focus dire_beast
2:47.179 cobra_shot Fluffy_Pillow 119.6/140: 85% focus dire_beast
2:48.467 Waiting 1.500 sec 94.6/140: 68% focus
2:49.967 dire_beast Fluffy_Pillow 112.2/140: 80% focus
2:51.306 bestial_wrath Fluffy_Pillow 129.5/140: 92% focus dire_beast
2:51.306 kill_command Fluffy_Pillow 129.5/140: 92% focus bestial_wrath, dire_beast
2:52.398 cobra_shot Fluffy_Pillow 120.0/140: 86% focus bestial_wrath, dire_beast, mark_of_the_claw
2:53.667 kill_command Fluffy_Pillow 104.9/140: 75% focus bestial_wrath, dire_beast, mark_of_the_claw
2:54.736 dire_beast Fluffy_Pillow 95.2/140: 68% focus bestial_wrath, dire_beast, mark_of_the_claw
2:55.806 cobra_shot Fluffy_Pillow 111.1/140: 79% focus bestial_wrath, dire_beast(2), mark_of_the_claw
2:57.075 kill_command Fluffy_Pillow 98.0/140: 70% focus bestial_wrath, dire_beast(2), mark_of_the_claw
2:58.145 cobra_shot Fluffy_Pillow 89.9/140: 64% focus bestial_wrath, dire_beast(2), mark_of_the_claw
2:59.412 kill_command Fluffy_Pillow 74.8/140: 53% focus bestial_wrath, dire_beast, mark_of_the_claw
3:00.482 a_murder_of_crows Fluffy_Pillow 65.1/140: 46% focus bestial_wrath, dire_beast, mark_of_the_claw
3:01.750 dire_beast Fluffy_Pillow 58.0/140: 41% focus bestial_wrath, dire_beast, mark_of_the_claw
3:02.834 titans_thunder Fluffy_Pillow 73.4/140: 52% focus bestial_wrath, dire_beast
3:02.834 cobra_shot Fluffy_Pillow 73.4/140: 52% focus bestial_wrath, dire_beast
3:04.121 kill_command Fluffy_Pillow 58.4/140: 42% focus bestial_wrath, dire_beast
3:05.223 cobra_shot Fluffy_Pillow 48.9/140: 35% focus bestial_wrath, dire_beast
3:06.510 kill_command Fluffy_Pillow 33.9/140: 24% focus dire_beast
3:07.611 Waiting 4.200 sec 18.4/140: 13% focus dire_beast
3:11.811 dire_beast Fluffy_Pillow 70.7/140: 50% focus focused_lightning
3:13.117 kill_command Fluffy_Pillow 87.6/140: 63% focus dire_beast, focused_lightning(2)
3:14.219 Waiting 3.600 sec 72.1/140: 52% focus dire_beast, focused_lightning(3)
3:17.819 cobra_shot Fluffy_Pillow 119.6/140: 85% focus dire_beast, focused_lightning(7)
3:19.107 Waiting 0.200 sec 96.6/140: 69% focus dire_beast, focused_lightning(8)
3:19.307 kill_command Fluffy_Pillow 99.2/140: 71% focus dire_beast, focused_lightning(8)
3:20.634 Waiting 1.400 sec 85.8/140: 61% focus focused_lightning(10)
3:22.034 dire_beast Fluffy_Pillow 102.1/140: 73% focus focused_lightning(10)
3:23.380 bestial_wrath Fluffy_Pillow 119.5/140: 85% focus dire_beast, focused_lightning(9)
3:23.380 cobra_shot Fluffy_Pillow 119.5/140: 85% focus bestial_wrath, dire_beast, focused_lightning(9)
3:24.669 kill_command Fluffy_Pillow 104.5/140: 75% focus bestial_wrath, dire_beast, focused_lightning(7)
3:25.770 cobra_shot Fluffy_Pillow 95.0/140: 68% focus bestial_wrath, dire_beast, focused_lightning(6)
3:27.057 kill_command Fluffy_Pillow 80.0/140: 57% focus bestial_wrath, dire_beast, focused_lightning(5)
3:28.158 cobra_shot Fluffy_Pillow 70.5/140: 50% focus bestial_wrath, dire_beast, focused_lightning(4)
3:29.445 kill_command Fluffy_Pillow 55.5/140: 40% focus bestial_wrath, dire_beast, focused_lightning(3)
3:30.548 cobra_shot Fluffy_Pillow 45.6/140: 33% focus bestial_wrath, focused_lightning
3:31.837 kill_command Fluffy_Pillow 28.7/140: 20% focus bestial_wrath
3:32.939 dire_beast Fluffy_Pillow 17.5/140: 13% focus bestial_wrath, focused_lightning
3:34.041 cobra_shot Fluffy_Pillow 32.1/140: 23% focus bestial_wrath, dire_beast, focused_lightning(2)
3:35.329 Waiting 0.600 sec 17.1/140: 12% focus bestial_wrath, dire_beast, focused_lightning(3)
3:35.929 kill_command Fluffy_Pillow 25.1/140: 18% focus bestial_wrath, dire_beast, focused_lightning(4), mark_of_the_claw
3:36.997 Waiting 1.300 sec 15.3/140: 11% focus bestial_wrath, dire_beast, focused_lightning(5), mark_of_the_claw
3:38.297 cobra_shot Fluffy_Pillow 32.7/140: 23% focus bestial_wrath, dire_beast, focused_lightning(6), mark_of_the_claw
3:39.564 Waiting 1.000 sec 17.6/140: 13% focus dire_beast, focused_lightning(7), mark_of_the_claw
3:40.564 kill_command Fluffy_Pillow 31.0/140: 22% focus dire_beast, focused_lightning(8), mark_of_the_claw
3:41.637 Waiting 1.300 sec 13.7/140: 10% focus focused_lightning(9)
3:42.937 dire_beast Fluffy_Pillow 28.9/140: 21% focus focused_lightning(10)
3:44.216 Waiting 2.600 sec 45.5/140: 32% focus dire_beast, focused_lightning(9)
3:46.816 kill_command Fluffy_Pillow 79.8/140: 57% focus dire_beast, focused_lightning(6)
3:48.070 Waiting 4.100 sec 66.3/140: 47% focus dire_beast, focused_lightning(5)
3:52.170 cobra_shot Fluffy_Pillow 119.4/140: 85% focus focused_lightning, mark_of_the_claw
3:53.438 dire_beast Fluffy_Pillow 94.5/140: 67% focus mark_of_the_claw
3:54.508 kill_command Fluffy_Pillow 108.8/140: 78% focus dire_beast, mark_of_the_claw
3:55.579 Waiting 2.000 sec 93.1/140: 66% focus dire_beast, mark_of_the_claw
3:57.579 cobra_shot Fluffy_Pillow 119.8/140: 86% focus dire_beast, mark_of_the_claw
3:58.848 Waiting 1.400 sec 96.6/140: 69% focus dire_beast
4:00.248 a_murder_of_crows Fluffy_Pillow 115.1/140: 82% focus dire_beast
4:01.770 kill_command Fluffy_Pillow 103.7/140: 74% focus
4:02.872 Waiting 0.600 sec 86.6/140: 62% focus
4:03.472 dire_beast Fluffy_Pillow 93.6/140: 67% focus
4:04.735 titans_thunder Fluffy_Pillow 110.0/140: 79% focus dire_beast
4:04.735 bestial_wrath Fluffy_Pillow 110.0/140: 79% focus dire_beast
4:04.735 cobra_shot Fluffy_Pillow 110.0/140: 79% focus bestial_wrath, dire_beast
4:06.024 kill_command Fluffy_Pillow 95.0/140: 68% focus bestial_wrath, dire_beast
4:07.126 cobra_shot Fluffy_Pillow 85.5/140: 61% focus bestial_wrath, dire_beast
4:08.412 kill_command Fluffy_Pillow 70.5/140: 50% focus bestial_wrath, dire_beast
4:09.514 cobra_shot Fluffy_Pillow 61.0/140: 44% focus bestial_wrath, dire_beast
4:10.803 kill_command Fluffy_Pillow 46.0/140: 33% focus bestial_wrath, dire_beast
4:11.905 cobra_shot Fluffy_Pillow 35.9/140: 26% focus bestial_wrath
4:13.193 Waiting 0.500 sec 19.0/140: 14% focus bestial_wrath
4:13.693 dire_beast Fluffy_Pillow 24.8/140: 18% focus bestial_wrath
4:14.794 kill_command Fluffy_Pillow 39.4/140: 28% focus bestial_wrath, dire_beast
4:15.895 Waiting 0.200 sec 29.9/140: 21% focus bestial_wrath, dire_beast
4:16.095 cobra_shot Fluffy_Pillow 32.5/140: 23% focus bestial_wrath, dire_beast
4:17.383 Waiting 0.400 sec 17.5/140: 13% focus bestial_wrath, dire_beast
4:17.783 aspect_of_the_wild Fluffy_Pillow 22.8/140: 16% focus bestial_wrath, dire_beast
4:18.022 kill_command Fluffy_Pillow 25.9/140: 19% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:19.124 Waiting 0.200 sec 27.5/140: 20% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:19.324 cobra_shot Fluffy_Pillow 32.1/140: 23% focus aspect_of_the_wild, bestial_wrath, dire_beast
4:20.613 kill_command Fluffy_Pillow 30.0/140: 21% focus aspect_of_the_wild, dire_beast
4:21.713 Waiting 2.000 sec 25.5/140: 18% focus aspect_of_the_wild, dire_beast
4:23.713 dire_beast Fluffy_Pillow 68.9/140: 49% focus aspect_of_the_wild
4:25.059 Waiting 0.900 sec 99.8/140: 71% focus aspect_of_the_wild, dire_beast
4:25.959 cobra_shot Fluffy_Pillow 120.6/140: 86% focus aspect_of_the_wild, dire_beast
4:27.248 kill_command Fluffy_Pillow 110.5/140: 79% focus aspect_of_the_wild, dire_beast
4:28.350 Waiting 0.600 sec 106.1/140: 76% focus aspect_of_the_wild, dire_beast
4:28.950 cobra_shot Fluffy_Pillow 120.0/140: 86% focus aspect_of_the_wild, dire_beast
4:30.238 Waiting 0.400 sec 110.1/140: 79% focus aspect_of_the_wild, dire_beast, mark_of_the_claw
4:30.638 cobra_shot Fluffy_Pillow 119.4/140: 85% focus aspect_of_the_wild, dire_beast, mark_of_the_claw
4:31.908 Waiting 1.500 sec 100.2/140: 72% focus dire_beast, mark_of_the_claw
4:33.408 kill_command Fluffy_Pillow 118.0/140: 84% focus mark_of_the_claw
4:34.665 dire_beast Fluffy_Pillow 102.9/140: 74% focus mark_of_the_claw
4:35.735 Waiting 0.200 sec 117.2/140: 84% focus dire_beast, mark_of_the_claw
4:35.935 cobra_shot Fluffy_Pillow 119.9/140: 86% focus dire_beast, mark_of_the_claw
4:37.205 Waiting 1.700 sec 96.8/140: 69% focus dire_beast
4:38.905 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast
4:40.192 kill_command Fluffy_Pillow 96.1/140: 69% focus dire_beast
4:41.294 Waiting 3.100 sec 80.7/140: 58% focus dire_beast
4:44.394 cobra_shot Fluffy_Pillow 119.0/140: 85% focus
4:45.681 dire_beast Fluffy_Pillow 94.1/140: 67% focus
4:46.783 bestial_wrath Fluffy_Pillow 108.6/140: 78% focus dire_beast
4:46.783 kill_command Fluffy_Pillow 108.6/140: 78% focus bestial_wrath, dire_beast
4:47.871 cobra_shot Fluffy_Pillow 99.1/140: 71% focus bestial_wrath, dire_beast, mark_of_the_claw
4:49.138 kill_command Fluffy_Pillow 84.0/140: 60% focus bestial_wrath, dire_beast, mark_of_the_claw
4:50.207 cobra_shot Fluffy_Pillow 74.3/140: 53% focus bestial_wrath, dire_beast, mark_of_the_claw
4:51.477 kill_command Fluffy_Pillow 59.3/140: 42% focus bestial_wrath, dire_beast, mark_of_the_claw
4:52.548 cobra_shot Fluffy_Pillow 49.6/140: 35% focus bestial_wrath, dire_beast, mark_of_the_claw
4:53.818 kill_command Fluffy_Pillow 32.7/140: 23% focus bestial_wrath, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6231 6231 0
Agility 29075 27710 17363 (13690)
Stamina 41882 41882 25957
Intellect 6005 6005 0
Spirit 2 2 0
Health 2512920 2512920 0
Focus 140 140 0
Crit 24.67% 24.67% 3384
Haste 16.90% 16.90% 5491
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 29075 27710 0
Mastery 80.32% 80.32% 9694
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1448 Sta, +1115 Mastery, +939 Haste }, enchant: mark_of_the_claw
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 880, stats: { 341 Armor, +1930 Sta, +1287 AgiInt, +735 Mastery, +360 Haste }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist Roar of the Seven Lions
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 Agi, +626 Haste, +469 Mastery }
Local Legs Singular Chain Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +1012 Mastery, +448 Haste }
Local Feet Black Venom Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +759 Haste, +336 Mastery }
Local Wrists Manacles of the Nightmare Colossus
ilevel: 880, stats: { 199 Armor, +1447 Sta, +965 AgiInt, +481 Haste, +340 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Finger1 Mindrend Band
ilevel: 880, stats: { +1448 Sta, +1292 Mastery, +763 Haste }, enchant: { +200 Mastery }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Trinket2 Stormsinger Fulmination Charge
ilevel: 840, stats: { +1123 AgiInt }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand Titanstrike
ilevel: 906, weapon: { 11779 - 11781, 3 }, stats: { +2186 Agi, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Big Game Hunter (Beast Mastery Hunter) Way of the Cobra (Beast Mastery Hunter) Dire Stable (Beast Mastery Hunter)
30 Stomp (Beast Mastery Hunter) Dire Frenzy (Beast Mastery Hunter) Chimaera Shot (Beast Mastery Hunter)
45 Posthaste Farstrider Trailblazer
60 One with the Pack (Beast Mastery Hunter) Bestial Fury (Beast Mastery Hunter) Blink Strikes (Beast Mastery Hunter)
75 Binding Shot Wyvern Sting Intimidation (Beast Mastery Hunter)
90 A Murder of Crows Barrage Volley
100 Stampede (Beast Mastery Hunter) Killer Cobra (Beast Mastery Hunter) Aspect of the Beast

Profile

hunter="Hunter_BM_T19M"
level=110
race=pandaren
role=attack
position=ranged_back
talents=1102012
artifact=56:0:0:0:0:868:3:869:3:870:3:871:3:872:3:873:3:874:3:875:3:876:1:877:1:878:1:879:1:880:1:881:1:882:1:1095:3:1336:1
spec=beast_mastery

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=deadly_grace
actions+=/a_murder_of_crows
actions+=/stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
actions+=/dire_beast,if=cooldown.bestial_wrath.remains>2
actions+=/dire_frenzy,if=cooldown.bestial_wrath.remains>2
actions+=/aspect_of_the_wild,if=buff.bestial_wrath.up
actions+=/barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
actions+=/titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
actions+=/bestial_wrath
actions+=/multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
actions+=/kill_command
actions+=/multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
actions+=/chimaera_shot,if=focus<90
actions+=/cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806,enchant=mark_of_the_claw
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=manacles_of_the_nightmare_colossus,id=139222,bonus_id=1806
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1806
waist=roar_of_the_seven_lions,id=137080,bonus_id=1806
legs=singular_chain_leggings,id=139215,bonus_id=1806
feet=black_venom_sabatons,id=139219,bonus_id=1806
finger1=mindrend_band,id=138220,bonus_id=1806,enchant=200mastery
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200mastery
trinket1=twisting_wind,id=139323,bonus_id=1806
trinket2=stormsinger_fulmination_charge,id=137367,bonus_id=1727
main_hand=titanstrike,id=128861,gem_id=139262/139269/139255,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=879.07
# gear_agility=17363
# gear_stamina=25957
# gear_crit_rating=3384
# gear_haste_rating=5491
# gear_mastery_rating=9694
# gear_armor=2758
summon_pet=cat

Hunter_MM_T19M : 359701 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
359701.0 359701.0 369.2 / 0.103% 64482.9 / 17.9% 19209.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
18.7 18.7 Focus 12.88% 37.0 100.0% 100%
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 60: Patient Sniper (Marksmanship Hunter)
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hunter_MM_T19M 359701
Aimed Shot 148212 (173638) 41.2% (48.3%) 91.6 3.26sec 569159 384275 Direct 91.4 325732 775139 486486 35.8%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.57 91.45 0.00 0.00 1.4811 0.0000 44489088.95 65403174.88 31.98 384274.58 384274.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.74 64.23% 325731.94 122561 456909 325774.23 301531 347011 19132386 28126420 31.98
crit 32.71 35.77% 775139.43 261055 1460387 775891.43 667698 925387 25356703 37276755 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 25426 7.1% 0.0 0.00sec 0 0 Direct 81.9 62295 148961 93198 35.7%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 81.86 0.00 0.00 0.0000 0.0000 7629688.42 11216364.68 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.67 64.34% 62295.02 24032 89590 62300.05 43442 70880 3281257 4823758 31.98
crit 29.19 35.66% 148960.85 51187 292063 148790.65 0 215943 4348432 6392606 31.97
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 16070 4.5% 119.3 2.52sec 40448 16161 Direct 119.3 29694 65651 40449 29.9%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.28 119.28 0.00 0.00 2.5029 0.0000 4824586.25 7092598.78 31.98 16160.98 16160.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.60 70.09% 29693.72 29694 29694 29693.72 29694 29694 2482449 3649435 31.98
crit 35.68 29.91% 65650.90 59387 89081 65693.26 59387 74234 2342137 3443164 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 42746 11.9% 13.7 22.85sec 937266 355354 Periodic 218.3 44093 93349 58813 29.9% 10.9%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.70 0.00 218.32 218.32 2.6376 0.1497 12840011.53 18876033.19 31.98 355354.15 355354.15
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.1 70.12% 44092.96 42914 53327 44090.96 42914 48201 6749503 9922409 31.98
crit 65.2 29.88% 93349.40 85827 159982 93356.91 85827 108376 6090508 8953624 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 14613 4.0% 33.9 8.94sec 127266 0 Direct 33.9 79173 204849 127380 38.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.94 33.91 0.00 0.00 0.0000 0.0000 4319695.35 4319695.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.90 61.64% 79173.00 79173 79173 79173.00 79173 79173 1654979 1654979 0.00
crit 13.01 38.36% 204848.81 158346 237519 204930.01 158346 237519 2664717 2664717 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 54472 (58448) 15.1% (16.3%) 28.9 10.43sec 606030 521107 Direct 28.9 375562 843249 564782 40.5%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.95 28.95 0.00 0.00 1.1630 0.0000 16348365.87 24033646.39 31.98 521107.23 521107.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.24 59.54% 375562.17 147515 458282 375550.54 327387 418311 6473033 9515971 31.98
crit 11.71 40.46% 843248.84 295031 1374846 844500.38 633640 1036554 9875333 14517675 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Call of the Hunter 3976 1.1% 12.0 46.84sec 99370 0 Direct 12.0 70835 163219 99371 30.9%  

Stats details: call_of_the_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.02 12.02 0.00 0.00 0.0000 0.0000 1194187.87 1755569.28 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.31 69.11% 70834.77 70835 70835 70815.88 0 70835 588319 864884 31.97
crit 3.71 30.89% 163219.43 141670 212504 158856.66 0 212504 605869 890685 31.10
 
 

Action details: call_of_the_hunter

Static Values
  • id:191070
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191070
  • name:Call of the Hunter
  • school:physical
  • tooltip:
  • description:{$@spelldesc191048=When you Marked Shot, |cFFFFCC99Thas'dorah|r has a chance to call forth a barrage of wind arrows to strike all Vulnerable targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 4059 1.1% 14.5 20.40sec 83913 0 Periodic 71.8 16972 0 16972 0.0% 6.0%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.53 0.00 72.31 71.84 0.0000 0.2497 1219232.80 1219232.80 0.00 67517.60 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.8 100.00% 16972.17 68 16990 16973.36 16581 16990 1219233 1219233 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Sidewinders 17287 4.8% 33.1 9.15sec 156872 134563 Direct 33.1 114546 255597 156872 30.0%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.07 33.07 0.00 0.00 1.1658 0.0000 5187956.44 5187956.44 0.00 134563.38 134563.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.15 69.99% 114545.90 114546 114546 114545.90 114546 114546 2651419 2651419 0.00
crit 9.92 30.01% 255597.45 229092 343638 255936.52 229092 343638 2536537 2536537 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Tormenting Cyclone 5182 1.4% 10.8 26.79sec 143786 0 Direct 74.5 15351 33680 20888 30.2%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.83 74.52 0.00 0.00 0.0000 0.0000 1556491.91 1556491.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.01 69.79% 15351.00 15351 15351 15351.00 15351 15351 798369 798369 0.00
crit 22.51 30.21% 33679.62 30702 46053 33656.00 30702 42013 758123 758123 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Windburst 27659 7.7% 13.2 21.88sec 628444 510298 Direct 14.2 440776 931924 585923 29.6%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.23 14.18 0.00 0.00 1.2316 0.0000 8311227.80 12218292.13 31.98 510298.26 510298.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.99 70.45% 440776.02 429136 533273 440721.59 429136 489014 4404594 6475170 31.98
crit 4.19 29.55% 931923.92 858272 1599820 927467.72 0 1599820 3906634 5743122 31.75
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Hunter_MM_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_MM_T19M
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_MM_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.3 157.65sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.28 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:140.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 17.84% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 1.0 114.5 0.0sec 0.5sec 18.60% 18.60% 85.5(85.5) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.23%
  • bullseye_2:0.25%
  • bullseye_3:0.23%
  • bullseye_4:0.21%
  • bullseye_5:0.22%
  • bullseye_6:0.19%
  • bullseye_7:0.18%
  • bullseye_8:0.18%
  • bullseye_9:0.17%
  • bullseye_10:0.17%
  • bullseye_11:0.17%
  • bullseye_12:0.17%
  • bullseye_13:0.15%
  • bullseye_14:0.15%
  • bullseye_15:0.14%
  • bullseye_16:0.14%
  • bullseye_17:0.13%
  • bullseye_18:0.14%
  • bullseye_19:0.14%
  • bullseye_20:0.14%
  • bullseye_21:0.15%
  • bullseye_22:0.15%
  • bullseye_23:0.16%
  • bullseye_24:0.16%
  • bullseye_25:0.16%
  • bullseye_26:0.16%
  • bullseye_27:0.15%
  • bullseye_28:0.14%
  • bullseye_29:0.13%
  • bullseye_30:13.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Lightning 3.5 0.0 69.7sec 68.8sec 22.18% 22.18% 3.3(3.3) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_focused_lightning
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:643.16

Stack Uptimes

  • focused_lightning_1:2.22%
  • focused_lightning_2:2.22%
  • focused_lightning_3:2.22%
  • focused_lightning_4:2.22%
  • focused_lightning_5:2.22%
  • focused_lightning_6:2.22%
  • focused_lightning_7:2.22%
  • focused_lightning_8:2.22%
  • focused_lightning_9:2.22%
  • focused_lightning_10:2.22%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:215632
  • name:Focused Lightning
  • tooltip:Mastery increased by {$s1=608}.
  • description:{$@spelldesc215630=Your ranged attacks and spells have a chance to trigger Focused Lightning, granting you {$215632s1=608} Mastery every $215631t1 sec. After {$215631d=10 seconds}, this bonus decreases every $215632t2 sec.}
  • max_stacks:10
  • duration:11.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 9.3 0.3 30.0sec 29.0sec 7.04% 11.19% 0.3(0.3) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.11%
  • lock_and_load_2:2.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.4 2.9 26.0sec 20.3sec 25.62% 25.62% 2.9(2.9) 11.1

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Marking Targets 27.6 8.3 11.0sec 8.5sec 34.97% 49.42% 8.3(8.3) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:34.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 257.5sec 0.0sec 19.61% 19.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rapid Killing 2.3 0.0 202.7sec 157.9sec 11.35% 19.08% 0.0(0.0) 2.3

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:11.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sentinel's Sight 32.9 0.2 9.2sec 9.1sec 37.48% 33.85% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_sentinels_sight
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • sentinels_sight_1:37.33%
  • sentinels_sight_2:0.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208913
  • name:Sentinel's Sight
  • tooltip:Increases the damage of your next Aimed Shot by {$s1=10}%.
  • description:{$@spelldesc208912=Each enemy you hit with Multi-Shot increases the damage of your next Aimed Shot by {$208913s1=10}%, stacking up to {$208913u=20} times.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Trueshot 2.3 0.0 202.7sec 157.9sec 11.35% 19.80% 0.0(0.0) 2.3

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:11.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_MM_T19M
aimed_shot Focus 91.6 3643.2 39.8 39.8 14305.9
barrage Focus 13.7 822.0 60.0 60.0 15621.2
marked_shot Focus 28.9 868.4 30.0 30.0 20201.1
windburst Focus 14.2 284.5 20.0 21.5 29213.4
Resource Gains Type Count Total Average Overflow
sidewinders Focus 33.07 1801.27 (32.48%) 54.47 17.64 0.97%
focus_regen Focus 1159.19 3744.29 (67.52%) 3.23 99.42 2.59%
Resource RPS-Gain RPS-Loss
Focus 18.45 18.69
Combat End Resource Mean Min Max
Focus 76.93 0.08 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 1.9%

Procs

Count Interval
starved: barrage 226.9 2.2sec
lock_and_load 9.6 29.0sec
no_vuln_aimed_shot 2.1 79.3sec
no_vuln_marked_shot 0.5 86.7sec
marking_targets 35.9 8.4sec
wasted_marking_targets 8.3 32.5sec

Statistics & Data Analysis

Fight Length
Sample Data Hunter_MM_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Hunter_MM_T19M Damage Per Second
Count 7499
Mean 359700.98
Minimum 310199.83
Maximum 429537.31
Spread ( max - min ) 119337.48
Range [ ( max - min ) / 2 * 100% ] 16.59%
Standard Deviation 16312.5741
5th Percentile 333965.46
95th Percentile 388013.87
( 95th Percentile - 5th Percentile ) 54048.41
Mean Distribution
Standard Deviation 188.3739
95.00% Confidence Intervall ( 359331.78 - 360070.19 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7900
0.1 Scale Factor Error with Delta=300 2271583
0.05 Scale Factor Error with Delta=300 9086333
0.01 Scale Factor Error with Delta=300 227158328
Priority Target DPS
Sample Data Hunter_MM_T19M Priority Target Damage Per Second
Count 7499
Mean 359700.98
Minimum 310199.83
Maximum 429537.31
Spread ( max - min ) 119337.48
Range [ ( max - min ) / 2 * 100% ] 16.59%
Standard Deviation 16312.5741
5th Percentile 333965.46
95th Percentile 388013.87
( 95th Percentile - 5th Percentile ) 54048.41
Mean Distribution
Standard Deviation 188.3739
95.00% Confidence Intervall ( 359331.78 - 360070.19 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7900
0.1 Scale Factor Error with Delta=300 2271583
0.05 Scale Factor Error with Delta=300 9086333
0.01 Scale Factor Error with Delta=300 227158328
DPS(e)
Sample Data Hunter_MM_T19M Damage Per Second (Effective)
Count 7499
Mean 359700.98
Minimum 310199.83
Maximum 429537.31
Spread ( max - min ) 119337.48
Range [ ( max - min ) / 2 * 100% ] 16.59%
Damage
Sample Data Hunter_MM_T19M Damage
Count 7499
Mean 107920533.21
Minimum 77649474.32
Maximum 147680529.09
Spread ( max - min ) 70031054.77
Range [ ( max - min ) / 2 * 100% ] 32.45%
DTPS
Sample Data Hunter_MM_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hunter_MM_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hunter_MM_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hunter_MM_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hunter_MM_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hunter_MM_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hunter_MM_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hunter_MM_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
0.00 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
8 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
9 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
A 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
B 4.18 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
C 8.52 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
D 13.29 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
E 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
F 8.02 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
0.00 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
G 52.28 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
H 28.92 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
I 21.72 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
J 2.94 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
K 20.53 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
L 0.38 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
M 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
N 1.28 trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
O 1.00 trueshot
P 1.73 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
Q 3.46 marked_shot
R 1.03 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
S 1.00 barrage
T 7.91 aimed_shot,if=execute_time<debuff.vulnerability.remains
U 1.97 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
V 0.83 marked_shot
0.00 windburst
W 1.42 aimed_shot,if=execute_time<debuff.vulnerability.remains
X 0.82 sidewinders
Y 0.03 aimed_shot
0.00 arcane_shot

Sample Sequence

04567OSTPQTTTUQTTUQTRTTHKGGDJKCGIKGGGIHHKGGDGJKCGIKGGIDHKGCIKGGGIHHDKGCIKGGIHKDGCIKGGIHDHBHKGGGIHHFHHDKCGIKGGIHHHDHFBHKGGIHDHFBHKGGIKGGIDHKCGIHDFGCIHMHHFNGGGGIFGDGCIFGGIKGGIKGDCIHKVWWX

Sample Sequence Table

time name target resources buffs
Pre flask Hunter_MM_T19M 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Hunter_MM_T19M 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus bloodlust, potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:01.546 aimed_shot Fluffy_Pillow 102.9/150: 69% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:02.490 sidewinders Fluffy_Pillow 73.0/150: 49% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.245 marked_shot Fluffy_Pillow 144.0/150: 96% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:04.001 aimed_shot Fluffy_Pillow 130.1/150: 87% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:04.945 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:05.890 aimed_shot Fluffy_Pillow 70.2/150: 47% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:06.835 sidewinders Fluffy_Pillow 40.3/150: 27% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:07.589 marked_shot Fluffy_Pillow 111.3/150: 74% focus bloodlust, marking_targets, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:08.345 aimed_shot Fluffy_Pillow 97.4/150: 65% focus bloodlust, marking_targets, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:09.290 aimed_shot Fluffy_Pillow 67.5/150: 45% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:10.233 sidewinders Fluffy_Pillow 37.6/150: 25% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:10.987 marked_shot Fluffy_Pillow 108.6/150: 72% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:11.741 aimed_shot Fluffy_Pillow 94.7/150: 63% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:12.685 aimed_shot Fluffy_Pillow 114.8/150: 77% focus bloodlust, lock_and_load, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:13.438 aimed_shot Fluffy_Pillow 130.8/150: 87% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.383 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:15.328 aimed_shot Fluffy_Pillow 68.2/150: 45% focus bloodlust, marking_targets, potion_of_deadly_grace
0:16.650 sidewinders Fluffy_Pillow 38.3/150: 26% focus bloodlust, marking_targets, potion_of_deadly_grace
0:17.641 aimed_shot Fluffy_Pillow 108.4/150: 72% focus bloodlust, sentinels_sight, potion_of_deadly_grace
0:18.962 aimed_shot Fluffy_Pillow 78.4/150: 52% focus bloodlust, marking_targets, potion_of_deadly_grace
0:20.282 windburst Fluffy_Pillow 48.5/150: 32% focus bloodlust, marking_targets, potion_of_deadly_grace
0:21.274 marked_shot Fluffy_Pillow 43.6/150: 29% focus bloodlust, marking_targets, potion_of_deadly_grace
0:22.264 sidewinders Fluffy_Pillow 28.6/150: 19% focus bloodlust, marking_targets, potion_of_deadly_grace
0:23.256 barrage Fluffy_Pillow 98.7/150: 66% focus bloodlust, sentinels_sight, potion_of_deadly_grace
0:25.425 aimed_shot Fluffy_Pillow 71.7/150: 48% focus bloodlust, sentinels_sight, potion_of_deadly_grace
0:26.745 Waiting 0.600 sec 41.7/150: 28% focus bloodlust, marking_targets, potion_of_deadly_grace
0:27.345 marked_shot Fluffy_Pillow 50.8/150: 34% focus bloodlust, marking_targets, potion_of_deadly_grace
0:28.335 sidewinders Fluffy_Pillow 35.9/150: 24% focus bloodlust, marking_targets
0:29.327 aimed_shot Fluffy_Pillow 106.0/150: 71% focus bloodlust, sentinels_sight
0:30.650 aimed_shot Fluffy_Pillow 76.1/150: 51% focus bloodlust
0:31.970 Waiting 0.300 sec 46.1/150: 31% focus bloodlust, marking_targets
0:32.270 aimed_shot Fluffy_Pillow 50.7/150: 34% focus bloodlust, marking_targets
0:33.590 Waiting 0.700 sec 20.7/150: 14% focus bloodlust, marking_targets
0:34.290 marked_shot Fluffy_Pillow 31.4/150: 21% focus bloodlust, lock_and_load(2), marking_targets
0:35.281 aimed_shot Fluffy_Pillow 16.4/150: 11% focus bloodlust, lock_and_load(2), marking_targets
0:36.273 aimed_shot Fluffy_Pillow 31.5/150: 21% focus bloodlust, lock_and_load, marking_targets
0:37.265 sidewinders Fluffy_Pillow 46.6/150: 31% focus bloodlust, marking_targets
0:38.255 aimed_shot Fluffy_Pillow 116.6/150: 78% focus bloodlust, marking_targets, sentinels_sight
0:39.575 aimed_shot Fluffy_Pillow 86.7/150: 58% focus bloodlust, marking_targets
0:40.896 Waiting 0.200 sec 52.1/150: 35% focus marking_targets
0:41.096 windburst Fluffy_Pillow 54.5/150: 36% focus marking_targets
0:42.556 aimed_shot Fluffy_Pillow 51.5/150: 34% focus marking_targets
0:44.270 Waiting 1.900 sec 21.6/150: 14% focus marking_targets
0:46.170 marked_shot Fluffy_Pillow 43.8/150: 29% focus marking_targets
0:47.458 sidewinders Fluffy_Pillow 28.9/150: 19% focus marking_targets, mark_of_the_claw
0:48.724 barrage Fluffy_Pillow 98.9/150: 66% focus sentinels_sight, mark_of_the_claw
0:51.550 aimed_shot Fluffy_Pillow 72.4/150: 48% focus sentinels_sight, mark_of_the_claw
0:53.241 marked_shot Fluffy_Pillow 42.4/150: 28% focus marking_targets
0:54.528 sidewinders Fluffy_Pillow 27.5/150: 18% focus marking_targets
0:55.814 aimed_shot Fluffy_Pillow 97.5/150: 65% focus sentinels_sight
0:57.530 aimed_shot Fluffy_Pillow 67.6/150: 45% focus
0:59.245 Waiting 0.300 sec 37.6/150: 25% focus
0:59.545 marked_shot Fluffy_Pillow 41.1/150: 27% focus
1:00.831 Waiting 1.500 sec 26.2/150: 17% focus
1:02.331 windburst Fluffy_Pillow 43.8/150: 29% focus mark_of_the_claw
1:03.820 Waiting 0.800 sec 41.4/150: 28% focus mark_of_the_claw
1:04.620 aimed_shot Fluffy_Pillow 50.9/150: 34% focus marking_targets, mark_of_the_claw
1:06.311 sidewinders Fluffy_Pillow 21.0/150: 14% focus marking_targets, mark_of_the_claw
1:07.582 aimed_shot Fluffy_Pillow 91.0/150: 61% focus sentinels_sight, mark_of_the_claw
1:09.272 barrage Fluffy_Pillow 60.9/150: 41% focus
1:12.038 marked_shot Fluffy_Pillow 33.2/150: 22% focus
1:13.325 Waiting 1.200 sec 18.2/150: 12% focus marking_targets
1:14.525 sidewinders Fluffy_Pillow 32.3/150: 22% focus marking_targets
1:16.039 aimed_shot Fluffy_Pillow 105.0/150: 70% focus lock_and_load(2), sentinels_sight
1:17.325 aimed_shot Fluffy_Pillow 120.0/150: 80% focus lock_and_load
1:18.613 aimed_shot Fluffy_Pillow 135.1/150: 90% focus marking_targets
1:20.328 marked_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
1:21.617 aimed_shot Fluffy_Pillow 85.1/150: 57% focus marking_targets
1:23.332 aimed_shot Fluffy_Pillow 55.2/150: 37% focus marking_targets
1:25.045 windburst Fluffy_Pillow 25.2/150: 17% focus marking_targets
1:26.331 sidewinders Fluffy_Pillow 20.2/150: 13% focus marking_targets
1:27.617 aimed_shot Fluffy_Pillow 90.3/150: 60% focus sentinels_sight
1:29.333 barrage Fluffy_Pillow 60.3/150: 40% focus
1:32.304 marked_shot Fluffy_Pillow 35.1/150: 23% focus
1:33.591 Waiting 1.500 sec 20.1/150: 13% focus marking_targets
1:35.091 sidewinders Fluffy_Pillow 37.6/150: 25% focus marking_targets
1:36.570 aimed_shot Fluffy_Pillow 109.9/150: 73% focus sentinels_sight
1:38.285 aimed_shot Fluffy_Pillow 80.0/150: 53% focus
1:40.000 Waiting 0.300 sec 50.0/150: 33% focus
1:40.300 marked_shot Fluffy_Pillow 53.5/150: 36% focus marking_targets
1:41.587 Waiting 1.000 sec 38.6/150: 26% focus marking_targets
1:42.587 aimed_shot Fluffy_Pillow 50.3/150: 34% focus marking_targets
1:44.301 Waiting 1.000 sec 20.6/150: 14% focus marking_targets, mark_of_the_claw
1:45.301 sidewinders Fluffy_Pillow 32.4/150: 22% focus marking_targets, mark_of_the_claw
1:46.774 windburst Fluffy_Pillow 104.9/150: 70% focus sentinels_sight, mark_of_the_claw
1:48.042 aimed_shot Fluffy_Pillow 99.9/150: 67% focus sentinels_sight, mark_of_the_claw
1:49.734 barrage Fluffy_Pillow 70.0/150: 47% focus mark_of_the_claw
1:52.483 Waiting 0.600 sec 42.4/150: 28% focus
1:53.083 marked_shot Fluffy_Pillow 49.4/150: 33% focus
1:54.369 Waiting 1.100 sec 34.4/150: 23% focus
1:55.469 sidewinders Fluffy_Pillow 47.3/150: 32% focus marking_targets, mark_of_the_claw
1:56.952 aimed_shot Fluffy_Pillow 119.9/150: 80% focus sentinels_sight, mark_of_the_claw
1:58.642 aimed_shot Fluffy_Pillow 89.9/150: 60% focus focused_lightning, mark_of_the_claw
2:00.333 Waiting 0.400 sec 60.0/150: 40% focus focused_lightning(3), mark_of_the_claw
2:00.733 marked_shot Fluffy_Pillow 64.7/150: 43% focus focused_lightning(3), mark_of_the_claw
2:02.002 Waiting 0.100 sec 49.7/150: 33% focus focused_lightning(5)
2:02.102 aimed_shot Fluffy_Pillow 50.8/150: 34% focus focused_lightning(5)
2:03.817 Waiting 4.000 sec 20.9/150: 14% focus focused_lightning(6)
2:07.817 windburst Fluffy_Pillow 67.6/150: 45% focus focused_lightning(10)
2:09.324 aimed_shot Fluffy_Pillow 65.3/150: 44% focus lock_and_load(2), focused_lightning(9)
2:10.609 barrage Fluffy_Pillow 80.3/150: 54% focus lock_and_load, focused_lightning(8)
2:13.423 aimed_shot Fluffy_Pillow 53.2/150: 35% focus lock_and_load, focused_lightning(5)
2:14.711 sidewinders Fluffy_Pillow 68.2/150: 45% focus lock_and_load(2), marking_targets, focused_lightning(4)
2:15.999 aimed_shot Fluffy_Pillow 138.3/150: 92% focus lock_and_load(2), sentinels_sight, focused_lightning(2)
2:17.286 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, focused_lightning
2:18.572 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
2:20.286 marked_shot Fluffy_Pillow 100.0/150: 67% focus
2:21.574 aimed_shot Fluffy_Pillow 85.1/150: 57% focus
2:23.287 aimed_shot Fluffy_Pillow 55.1/150: 37% focus
2:25.002 Waiting 0.400 sec 25.2/150: 17% focus
2:25.402 sidewinders Fluffy_Pillow 29.9/150: 20% focus
2:26.689 aimed_shot Fluffy_Pillow 99.9/150: 67% focus sentinels_sight
2:28.405 aimed_shot Fluffy_Pillow 70.0/150: 47% focus
2:30.119 windburst Fluffy_Pillow 40.0/150: 27% focus marking_targets
2:31.406 sidewinders Fluffy_Pillow 35.0/150: 23% focus marking_targets
2:32.694 barrage Fluffy_Pillow 105.1/150: 70% focus marking_targets, sentinels_sight
2:35.386 aimed_shot Fluffy_Pillow 76.7/150: 51% focus marking_targets, sentinels_sight, mark_of_the_claw
2:37.075 marked_shot Fluffy_Pillow 46.8/150: 31% focus marking_targets, mark_of_the_claw
2:38.345 sidewinders Fluffy_Pillow 31.8/150: 21% focus marking_targets, mark_of_the_claw
2:39.612 aimed_shot Fluffy_Pillow 101.8/150: 68% focus sentinels_sight, mark_of_the_claw
2:41.304 aimed_shot Fluffy_Pillow 71.8/150: 48% focus
2:43.020 Waiting 0.400 sec 41.8/150: 28% focus
2:43.420 marked_shot Fluffy_Pillow 46.5/150: 31% focus lock_and_load(2)
2:44.709 aimed_shot Fluffy_Pillow 31.6/150: 21% focus lock_and_load(2)
2:45.996 aimed_shot Fluffy_Pillow 46.6/150: 31% focus lock_and_load
2:47.285 aimed_shot Fluffy_Pillow 61.7/150: 41% focus
2:48.999 Waiting 2.200 sec 31.7/150: 21% focus
2:51.199 windburst Fluffy_Pillow 57.4/150: 38% focus
2:52.691 aimed_shot Fluffy_Pillow 54.9/150: 37% focus
2:54.406 Waiting 1.700 sec 24.9/150: 17% focus
2:56.106 sidewinders Fluffy_Pillow 44.8/150: 30% focus
2:57.395 barrage Fluffy_Pillow 114.8/150: 77% focus marking_targets, sentinels_sight
3:00.234 aimed_shot Fluffy_Pillow 88.0/150: 59% focus marking_targets, sentinels_sight
3:01.948 sidewinders Fluffy_Pillow 58.1/150: 39% focus marking_targets, mark_of_the_claw
3:03.218 aimed_shot Fluffy_Pillow 128.1/150: 85% focus sentinels_sight, mark_of_the_claw
3:04.910 aimed_shot Fluffy_Pillow 98.2/150: 65% focus mark_of_the_claw
3:06.601 Waiting 0.400 sec 68.3/150: 46% focus mark_of_the_claw
3:07.001 marked_shot Fluffy_Pillow 73.0/150: 49% focus mark_of_the_claw
3:08.268 aimed_shot Fluffy_Pillow 58.0/150: 39% focus
3:09.983 Waiting 2.500 sec 28.0/150: 19% focus
3:12.483 windburst Fluffy_Pillow 57.2/150: 38% focus
3:13.972 aimed_shot Fluffy_Pillow 54.6/150: 36% focus
3:15.686 Waiting 0.800 sec 24.7/150: 16% focus
3:16.486 sidewinders Fluffy_Pillow 34.0/150: 23% focus
3:17.775 barrage Fluffy_Pillow 104.1/150: 69% focus sentinels_sight
3:20.571 aimed_shot Fluffy_Pillow 76.8/150: 51% focus sentinels_sight
3:22.286 sidewinders Fluffy_Pillow 46.8/150: 31% focus marking_targets, mark_of_the_claw
3:23.553 aimed_shot Fluffy_Pillow 116.9/150: 78% focus sentinels_sight, mark_of_the_claw
3:25.243 aimed_shot Fluffy_Pillow 86.9/150: 58% focus focused_lightning, mark_of_the_claw
3:26.933 Waiting 0.400 sec 56.9/150: 38% focus focused_lightning(2), mark_of_the_claw
3:27.333 marked_shot Fluffy_Pillow 61.7/150: 41% focus focused_lightning(3), mark_of_the_claw
3:28.602 sidewinders Fluffy_Pillow 46.7/150: 31% focus marking_targets, focused_lightning(4), mark_of_the_claw
3:29.869 aimed_shot Fluffy_Pillow 116.8/150: 78% focus sentinels_sight, focused_lightning(5), mark_of_the_claw
3:31.560 aimed_shot Fluffy_Pillow 86.8/150: 58% focus focused_lightning(7), mark_of_the_claw
3:33.250 Waiting 0.400 sec 56.8/150: 38% focus focused_lightning(9)
3:33.650 marked_shot Fluffy_Pillow 61.5/150: 41% focus focused_lightning(9)
3:34.938 windburst Fluffy_Pillow 46.5/150: 31% focus focused_lightning(10)
3:36.227 Waiting 0.800 sec 41.6/150: 28% focus marking_targets, focused_lightning(10)
3:37.027 aimed_shot Fluffy_Pillow 50.9/150: 34% focus marking_targets, focused_lightning(9)
3:38.741 sidewinders Fluffy_Pillow 21.0/150: 14% focus marking_targets, focused_lightning(7)
3:40.026 barrage Fluffy_Pillow 91.0/150: 61% focus sentinels_sight, focused_lightning(6)
3:42.826 aimed_shot Fluffy_Pillow 63.8/150: 43% focus sentinels_sight, focused_lightning(3), mark_of_the_claw
3:44.516 marked_shot Fluffy_Pillow 33.8/150: 23% focus focused_lightning, mark_of_the_claw
3:45.785 Waiting 2.700 sec 18.9/150: 13% focus mark_of_the_claw
3:48.485 aimed_shot Fluffy_Pillow 50.9/150: 34% focus
3:50.199 Waiting 5.800 sec 20.9/150: 14% focus
3:55.999 windburst Fluffy_Pillow 88.8/150: 59% focus marking_targets, mark_of_the_claw
3:57.489 sidewinders Fluffy_Pillow 86.4/150: 58% focus marking_targets, mark_of_the_claw
3:58.760 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(2), lock_and_load(2), sentinels_sight, mark_of_the_claw
4:00.028 barrage Fluffy_Pillow 150.0/150: 100% focus bullseye(3), lock_and_load, mark_of_the_claw
4:02.852 marked_shot Fluffy_Pillow 123.3/150: 82% focus bullseye(20), lock_and_load
4:04.139 aimed_shot Fluffy_Pillow 108.4/150: 72% focus bullseye(22), lock_and_load
4:05.426 potion Fluffy_Pillow 123.4/150: 82% focus bullseye(23)
4:05.426 aimed_shot Fluffy_Pillow 123.4/150: 82% focus bullseye(23), potion_of_deadly_grace
4:07.141 aimed_shot Fluffy_Pillow 93.5/150: 62% focus bullseye(24), marking_targets, potion_of_deadly_grace
4:08.857 sidewinders Fluffy_Pillow 63.5/150: 42% focus bullseye(26), marking_targets, potion_of_deadly_grace
4:10.145 trueshot Fluffy_Pillow 133.6/150: 89% focus bullseye(28), sentinels_sight, potion_of_deadly_grace
4:10.145 aimed_shot Fluffy_Pillow 133.6/150: 89% focus bullseye(28), rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
4:11.373 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30), lock_and_load, rapid_killing, trueshot, potion_of_deadly_grace
4:12.295 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
4:13.522 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:14.747 marked_shot Fluffy_Pillow 70.1/150: 47% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:15.666 sidewinders Fluffy_Pillow 55.2/150: 37% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:16.586 aimed_shot Fluffy_Pillow 125.2/150: 83% focus bullseye(30), rapid_killing, trueshot, sentinels_sight, focused_lightning, potion_of_deadly_grace
4:17.812 windburst Fluffy_Pillow 95.3/150: 64% focus bullseye(30), rapid_killing, trueshot, focused_lightning(2), potion_of_deadly_grace
4:18.734 aimed_shot Fluffy_Pillow 90.4/150: 60% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(3), potion_of_deadly_grace
4:19.962 barrage Fluffy_Pillow 60.5/150: 40% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(4), potion_of_deadly_grace
4:22.078 marked_shot Fluffy_Pillow 35.1/150: 23% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(6), potion_of_deadly_grace
4:22.998 sidewinders Fluffy_Pillow 20.2/150: 13% focus bullseye(30), marking_targets, rapid_killing, trueshot, focused_lightning(7), potion_of_deadly_grace
4:23.919 aimed_shot Fluffy_Pillow 90.2/150: 60% focus bullseye(30), rapid_killing, trueshot, sentinels_sight, focused_lightning(8), potion_of_deadly_grace
4:25.146 aimed_shot Fluffy_Pillow 60.3/150: 40% focus bullseye(30), focused_lightning(9), potion_of_deadly_grace
4:26.859 Waiting 1.200 sec 30.3/150: 20% focus bullseye(30), focused_lightning(10), potion_of_deadly_grace
4:28.059 marked_shot Fluffy_Pillow 44.4/150: 30% focus bullseye(30), focused_lightning(9), potion_of_deadly_grace
4:29.348 sidewinders Fluffy_Pillow 29.4/150: 20% focus bullseye(30), marking_targets, focused_lightning(7), potion_of_deadly_grace
4:30.636 aimed_shot Fluffy_Pillow 99.5/150: 66% focus bullseye(30), sentinels_sight, focused_lightning(6), potion_of_deadly_grace
4:32.351 aimed_shot Fluffy_Pillow 69.5/150: 46% focus bullseye(30), marking_targets, focused_lightning(4), potion_of_deadly_grace
4:34.066 Waiting 0.300 sec 39.6/150: 26% focus bullseye(30), marking_targets, focused_lightning(3), mark_of_the_claw, potion_of_deadly_grace
4:34.366 marked_shot Fluffy_Pillow 43.2/150: 29% focus bullseye(30), marking_targets, focused_lightning(2), mark_of_the_claw, potion_of_deadly_grace
4:35.635 sidewinders Fluffy_Pillow 28.2/150: 19% focus bullseye(30), marking_targets, focused_lightning, mark_of_the_claw
4:36.904 aimed_shot Fluffy_Pillow 98.3/150: 66% focus bullseye(30), sentinels_sight, mark_of_the_claw
4:38.594 windburst Fluffy_Pillow 68.3/150: 46% focus bullseye(30), mark_of_the_claw
4:39.998 barrage Fluffy_Pillow 64.9/150: 43% focus bullseye(30)
4:42.894 Waiting 2.100 sec 38.8/150: 26% focus bullseye(30)
4:44.994 marked_shot Fluffy_Pillow 63.3/150: 42% focus bullseye(30)
4:46.282 Waiting 0.200 sec 48.4/150: 32% focus bullseye(30)
4:46.482 aimed_shot Fluffy_Pillow 50.7/150: 34% focus bullseye(30)
4:48.197 Waiting 0.100 sec 20.8/150: 14% focus bullseye(30)
4:48.297 sidewinders Fluffy_Pillow 21.9/150: 15% focus bullseye(30), marking_targets
4:49.585 marked_shot Fluffy_Pillow 92.0/150: 61% focus bullseye(30), sentinels_sight
4:50.872 aimed_shot Fluffy_Pillow 77.0/150: 51% focus bullseye(30), sentinels_sight
4:52.587 Waiting 0.300 sec 47.1/150: 31% focus bullseye(30)
4:52.887 aimed_shot Fluffy_Pillow 50.6/150: 34% focus bullseye(30)
4:54.601 sidewinders Fluffy_Pillow 20.6/150: 14% focus bullseye(30)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6231 6231 0
Agility 29075 27710 17363 (13690)
Stamina 41882 41882 25957
Intellect 6005 6005 0
Spirit 2 2 0
Health 2512920 2512920 0
Focus 150 150 0
Crit 24.67% 24.67% 3384
Haste 16.90% 16.90% 5491
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 29075 27710 0
Mastery 22.31% 22.31% 9694
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1448 Sta, +1115 Mastery, +939 Haste }, enchant: mark_of_the_claw
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 880, stats: { 341 Armor, +1930 Sta, +1287 AgiInt, +735 Mastery, +360 Haste }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist War Belt of the Sentinel Army
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 Agi, +626 Haste, +469 Mastery }
Local Legs Singular Chain Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +1012 Mastery, +448 Haste }
Local Feet Black Venom Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +759 Haste, +336 Mastery }
Local Wrists Manacles of the Nightmare Colossus
ilevel: 880, stats: { 199 Armor, +1447 Sta, +965 AgiInt, +481 Haste, +340 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Finger1 Mindrend Band
ilevel: 880, stats: { +1448 Sta, +1292 Mastery, +763 Haste }, enchant: { +200 Mastery }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Trinket2 Stormsinger Fulmination Charge
ilevel: 840, stats: { +1123 AgiInt }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 906, weapon: { 11779 - 11781, 3 }, stats: { +2186 Agi, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Hunter_MM_T19M"
level=110
race=pandaren
role=attack
position=ranged_back
talents=1103021
artifact=55:0:0:0:0:307:1:308:1:309:1:310:1:311:1:312:3:313:3:314:3:315:3:316:3:317:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=/trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806,enchant=mark_of_the_claw
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=manacles_of_the_nightmare_colossus,id=139222,bonus_id=1806
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1806
waist=war_belt_of_the_sentinel_army,id=137081,bonus_id=1806
legs=singular_chain_leggings,id=139215,bonus_id=1806
feet=black_venom_sabatons,id=139219,bonus_id=1806
finger1=mindrend_band,id=138220,bonus_id=1806,enchant=200mastery
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200mastery
trinket1=twisting_wind,id=139323,bonus_id=1806
trinket2=stormsinger_fulmination_charge,id=137367,bonus_id=1727
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,gem_id=139262/139257/138228,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=879.07
# gear_agility=17363
# gear_stamina=25957
# gear_crit_rating=3384
# gear_haste_rating=5491
# gear_mastery_rating=9694
# gear_armor=2758
summon_pet=cat

Hunter_SV_T19M : 333999 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
333999.0 333999.0 181.5 / 0.054% 31472.4 / 9.4% 24784.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.0 12.0 Focus 19.70% 40.5 100.0% 100%
Talents
  • 15: Way of the Mok'Nathal (Survival Hunter)
  • 30: Snake Hunter (Survival Hunter)
  • 60: Improved Traps (Survival Hunter)
  • 90: Dragonsfire Grenade (Survival Hunter)
  • 100: Expert Trapper (Survival Hunter)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hunter_SV_T19M 333999
auto_attack_mh 18897 (23966) 5.7% (7.2%) 104.2 2.88sec 69071 24033 Direct 104.2 37485 74981 54460 45.3%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.22 104.22 0.00 0.00 2.8740 0.0000 5675737.12 8343871.19 31.98 24033.12 24033.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.04 54.73% 37485.48 33078 46472 37483.83 35946 39596 2138129 3143252 31.98
crit 47.18 45.27% 74981.12 66156 92944 74980.53 71672 79340 3537608 5200619 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Talon Strike 5070 1.5% 20.8 26.52sec 73379 0 Direct 20.8 50501 100978 73379 45.3%  

Stats details: talon_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.75 20.75 0.00 0.00 0.0000 0.0000 1522759.48 2238600.68 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.35 54.68% 50501.27 43262 62990 50469.80 0 62427 573006 842374 31.96
crit 9.41 45.32% 100978.22 86524 125979 100939.20 0 125979 949753 1396227 31.96
 
 

Action details: talon_strike

Static Values
  • id:203525
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203525
  • name:Talon Strike
  • school:physical
  • tooltip:
  • description:Deals $m1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Dragonsfire Grenade 19924 6.0% 10.3 30.57sec 581154 586180 Direct 10.2 100428 0 100428 0.0%  
Periodic 80.7 42250 84529 61421 45.3% 26.9%

Stats details: dragonsfire_grenade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.30 10.23 80.71 80.71 0.9915 1.0000 5984900.59 5984900.59 0.00 65828.18 586180.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.23 100.00% 100427.92 88332 128612 100385.53 93632 106776 1027772 1027772 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.1 54.66% 42250.47 36069 52517 42251.71 39764 45067 1863701 1863701 0.00
crit 36.6 45.34% 84529.40 72138 105033 84542.69 78455 90850 3093428 3093428 0.00
 
 

Action details: dragonsfire_grenade

Static Values
  • id:194855
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194855
  • name:Dragonsfire Grenade
  • school:physical
  • tooltip:
  • description:Hurls a dragonsfire grenade at the target that explodes into flames, inflicting ${$194858o1+{$194858s3=0}} Fire damage over {$194858d=8 seconds} and reducing movement speed by {$194858s2=20}%. The volatile flames on the target also scorch nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.225000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Explosive Trap 53994 16.2% 24.8 12.37sec 655426 656445 Direct 24.8 223176 446111 323981 45.2%  
Periodic 243.2 23222 46451 33741 45.3% 80.9%

Stats details: explosive_trap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.76 24.76 243.19 243.19 0.9985 1.0000 16226665.06 16226665.06 0.00 60567.60 656445.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.56 54.78% 223175.99 198380 288841 223119.47 208795 264044 3026823 3026823 0.00
crit 11.19 45.22% 446110.90 396760 577682 445963.17 415804 503290 4994227 4994227 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.1 54.71% 23221.90 19838 28884 23221.69 22304 24191 3089949 3089949 0.00
crit 110.1 45.29% 46451.39 39676 57768 46451.42 44509 48388 5115666 5115666 0.00
 
 

Action details: explosive_trap

Static Values
  • id:13812
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:13812
  • name:Explosive Trap
  • school:fire
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:{$@spelldesc191433=Tosses a fire trap on the ground in front of you that explodes when an enemy approaches, causing {$13812s1=0} Fire damage and burning all enemies within $13812A1 yards for $13812o2 additional Fire damage over {$13812d=10 seconds}. Trap will exist for {$13813d=60 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.350000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Flanking Strike 26186 7.8% 29.6 9.78sec 266050 220545 Direct 29.6 167878 335940 266049 58.4%  

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.57 29.57 0.00 0.00 1.2063 0.0000 7867714.42 11566285.45 31.98 220544.78 220544.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.30 41.59% 167878.43 155199 213392 167829.16 157436 190611 2064535 3035062 31.98
crit 17.27 58.41% 335939.61 310398 426784 335819.94 318353 370960 5803179 8531223 31.98
 
 

Action details: flanking_strike

Static Values
  • id:202800
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains>=3)|!talent.way_of_the_moknathal.enabled
Spelldata
  • id:202800
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:A coordinated attack on the target, where you deal ${$sw1*$<mult>} Physical damage and your pet deals $<damage> Physical damage. If the target is attacking you, your pet's attack will deal {$s3=50}% increased damage and {$s4=400}% increased threat. Otherwise, your attack will deal {$s3=50}% increased damage.{$?s191334=false}[ Flanking strike has double the normal chance to trigger Hunting Companion.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.25
 
Fury of the Eagle 29616 8.9% 6.6 47.93sec 1353584 394396 Periodic 58.8 104060 208455 151290 45.2% 6.9%

Stats details: fury_of_the_eagle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.57 0.00 58.76 58.76 3.4321 0.3554 8890083.18 13069264.37 31.98 394396.13 394396.13
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.2 54.76% 104059.55 27039 157474 104215.82 63425 137548 3348296 4922312 31.98
crit 26.6 45.24% 208454.70 54078 314948 208649.10 120637 275523 5541787 8146952 31.98
 
 

Action details: fury_of_the_eagle

Static Values
  • id:203415
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.mongoose_fury.up&(buff.mongoose_fury.stack=6|action.mongoose_bite.charges=0&cooldown.snake_hunter.remains|buff.mongoose_fury.remains<=gcd.max*2)
Spelldata
  • id:203415
  • name:Fury of the Eagle
  • school:physical
  • tooltip:
  • description:Furiously strikes all enemies in front of you, dealing ${{$203413s1=0}*9} Physical damage. Damage increased by Mongoose Fury.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 

Action details: fury_of_the_eagle_tick

Static Values
  • id:203413
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203413
  • name:Fury of the Eagle
  • school:physical
  • tooltip:
  • description:{$@spelldesc203415=Furiously strikes all enemies in front of you, dealing ${{$203413s1=0}*9} Physical damage. Damage increased by Mongoose Fury.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Lacerate 44331 13.3% 25.2 11.86sec 528988 436919 Direct 25.2 44348 88708 64455 45.3%  
Periodic 287.8 27991 55979 40665 45.3% 95.4%

Stats details: lacerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.19 25.19 287.80 287.80 1.2108 0.9966 13326902.98 14090263.63 5.42 42000.03 436918.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.77 54.67% 44347.61 39275 55519 44342.72 40835 49018 610826 897972 31.98
crit 11.42 45.33% 88708.44 78550 111038 88702.84 81492 101734 1013019 1489233 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 157.5 54.72% 27990.84 25 35056 27990.48 26925 29074 4407896 4407896 0.00
crit 130.3 45.28% 55979.05 54 70111 55977.26 53831 57959 7295162 7295162 0.00
 
 

Action details: lacerate

Static Values
  • id:185855
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.lacerate.ticking&dot.lacerate.remains<=3|target.time_to_die>=5
Spelldata
  • id:185855
  • name:Lacerate
  • school:physical
  • tooltip:Bleeding for {$s1=1} damage every $t1 sec.
  • description:Tears a bleeding wound in the target, dealing ${$o1+{$s2=0}} Physical damage over {$d=12 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.670000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Mongoose Bite 45896 13.7% 44.9 6.61sec 306672 257839 Direct 44.9 211127 422392 306675 45.2%  

Stats details: mongoose_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.88 44.88 0.00 0.00 1.1894 0.0000 13764472.07 20235077.76 31.98 257838.90 257838.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.58 54.77% 211126.74 85866 481499 211291.01 147550 279537 5190225 7630123 31.98
crit 20.30 45.23% 422392.26 171731 962999 422682.71 262521 602657 8574247 12604955 31.98
 
 

Action details: mongoose_bite

Static Values
  • id:190928
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.aspect_of_the_eagle.up&(charges>=2|charges>=1&cooldown.mongoose_bite.remains<=2)|(buff.mongoose_fury.up|cooldown.fury_of_the_eagle.remains<5|charges=3)
Spelldata
  • id:190928
  • name:Mongoose Bite
  • school:physical
  • tooltip:
  • description:Attempts to sever the target's limbs with a brutal attack that deals $sw1 Physical damage and grants you Mongoose Fury. Mongoose Fury increases Mongoose Bite damage by $?a134735[{$190931s2=35}][{$190931s1=50}]% for {$190931d=14 seconds}, stacking up to {$190931u=6} times. Successive attacks do not increase duration.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
On the Trail 8158 2.4% 0.0 0.00sec 0 0 Periodic 300.1 8172 0 8172 0.0% 99.8%

Stats details: on_the_trail

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 300.05 300.05 0.0000 1.0000 2452058.13 2452058.13 0.00 8172.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 300.1 100.00% 8172.05 6996 10186 8171.94 7946 8342 2452058 2452058 0.00
 
 

Action details: on_the_trail

Static Values
  • id:204081
  • school:physical
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204081
  • name:On the Trail
  • school:physical
  • tooltip:Deals $m1 damage per $t sec. Melee attacks can extend this effect by 6 sec per melee attack.
  • description:{$@spelldesc203757=Harpoon applies On the Trail, a unique damage over time effect that deals ${$204081m1*12} damage over {$204081d=12 seconds} and your melee autoattacks extend its duration by 6 sec.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.220000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Potion of the Old War 16178 4.8% 23.3 3.78sec 204820 0 Direct 23.3 140942 282060 204821 45.3%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.34 23.34 0.00 0.00 0.0000 0.0000 4780465.10 7027736.51 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.77 54.73% 140941.72 130152 169198 140933.50 130152 159437 1800443 2646822 31.98
crit 10.57 45.27% 282059.66 260305 338396 282063.00 260305 322778 2980022 4380915 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Raptor Strike 28514 8.5% 49.3 6.12sec 173733 143371 Direct 49.3 119613 239199 173733 45.3%  

Stats details: raptor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.32 49.32 0.00 0.00 1.2118 0.0000 8567995.34 12595764.73 31.98 143371.02 143371.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.00 54.74% 119612.63 107722 151016 119574.96 112718 128230 3229296 4747371 31.98
crit 22.32 45.26% 239198.99 215445 302031 239118.25 223143 260501 5338699 7848394 31.98
 
 

Action details: raptor_strike

Static Values
  • id:186270
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.serpent_sting.enabled&active_enemies<=2&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)|talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains<gcd.max|buff.moknathal_tactics.down)
Spelldata
  • id:186270
  • name:Raptor Strike
  • school:physical
  • tooltip:
  • description:A vicious slash dealing $sw1 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
pet - cat 37236 / 37236
Claw 11604 3.5% 100.7 3.00sec 34621 34466 Direct 100.7 22313 44645 34621 55.1%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.69 100.69 0.00 0.00 1.0045 0.0000 3485955.45 5124684.71 31.98 34466.29 34466.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.20 44.89% 22313.15 11016 24675 22321.31 20052 24289 1008462 1482534 31.98
crit 55.49 55.11% 44645.28 22032 49351 44658.66 41640 48170 2477494 3642151 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
Flanking Strike 11775 3.5% 29.6 9.78sec 119577 0 Direct 29.6 71109 142198 119577 68.2%  

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.57 29.57 0.00 0.00 0.0000 0.0000 3536162.27 5198493.49 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.41 31.82% 71108.96 66593 72412 71113.63 66593 72412 669149 983712 31.98
crit 20.16 68.18% 142197.78 133187 144824 142207.13 137551 144824 2867013 4214781 31.98
 
 

Action details: flanking_strike

Static Values
  • id:204740
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204740
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.152000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 13856 4.2% 237.0 1.26sec 17558 13879 Direct 237.0 11305 22611 17558 55.3%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 237.04 237.04 0.00 0.00 1.2651 0.0000 4162080.38 6118652.40 31.98 13878.60 13878.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.93 44.69% 11305.30 10300 11537 11304.93 11018 11508 1197569 1760540 31.98
crit 131.11 55.31% 22610.51 20601 23073 22609.84 21997 23000 2964511 4358112 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Hunter_SV_T19M
Aspect of the Eagle 6.6 49.05sec

Stats details: aspect_of_the_eagle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_eagle

Static Values
  • id:186289
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:48.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:186289
  • name:Aspect of the Eagle
  • school:physical
  • tooltip:Critical Strike chance on abilities increased by {$s1=0}%.
  • description:$?a231555[Grants you and your pet {$s1=0}% increased Critical Strike chance on all abilities, and your][Your] pet's attacks have a{$?s191334=false}[n additional][] {$s2=25}% chance to grant you a charge of Mongoose Bite. Lasts {$d=10 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_SV_T19M
  • harmful:false
  • if_expr:
 
Cleansed Drake's Breath 3.1 62.99sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.12 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_SV_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_SV_T19M
  • harmful:false
  • if_expr:
 
Harpoon 1.0 0.00sec

Stats details: harpoon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: harpoon

Static Values
  • id:190925
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190925
  • name:Harpoon
  • school:physical
  • tooltip:
  • description:Hurls a harpoon at an enemy, rooting them in place for {$190927d=3 seconds} and pulling you to them.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Snake Hunter 3.6 95.61sec

Stats details: snake_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: snake_hunter

Static Values
  • id:201078
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:action.mongoose_bite.charges<=1&buff.mongoose_fury.remains>gcd.max*4|action.mongoose_bite.charges=0&buff.aspect_of_the_eagle.up
Spelldata
  • id:201078
  • name:Snake Hunter
  • school:physical
  • tooltip:
  • description:Instantly grants you {$s1=3} charges of Mongoose Bite.
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Eagle 6.6 0.0 49.1sec 49.1sec 21.56% 24.57% 0.0(0.0) 6.4

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_aspect_of_the_eagle
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • aspect_of_the_eagle_1:21.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:186289
  • name:Aspect of the Eagle
  • tooltip:Critical Strike chance on abilities increased by {$s1=0}%.
  • description:$?a231555[Grants you and your pet {$s1=0}% increased Critical Strike chance on all abilities, and your][Your] pet's attacks have a{$?s191334=false}[n additional][] {$s2=25}% chance to grant you a charge of Mongoose Bite. Lasts {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Blood Frenzy 10.7 6.5 28.1sec 17.1sec 45.63% 45.63% 6.5(6.5) 10.3

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 11.31% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cleansed Ancient's Blessing 2.8 0.0 72.6sec 72.6sec 9.10% 9.10% 0.0(0.0) 2.7

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:9.10%

Trigger Attempt Success

  • trigger_pct:95.30%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 2.8 0.0 72.7sec 72.7sec 9.03% 9.03% 0.0(0.0) 2.7

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:9.03%

Trigger Attempt Success

  • trigger_pct:95.21%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 2.8 0.0 72.6sec 72.6sec 9.16% 9.16% 0.0(0.0) 2.7

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.16%

Trigger Attempt Success

  • trigger_pct:95.46%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of the Eagle 6.6 0.0 48.0sec 48.0sec 6.94% 6.94% 27.8(121.3) 6.5

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_fury_of_the_eagle
  • max_stacks:6
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fury_of_the_eagle_1:0.26%
  • fury_of_the_eagle_2:0.31%
  • fury_of_the_eagle_3:0.46%
  • fury_of_the_eagle_4:0.46%
  • fury_of_the_eagle_5:0.32%
  • fury_of_the_eagle_6:5.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203415
  • name:Fury of the Eagle
  • tooltip:
  • description:Furiously strikes all enemies in front of you, dealing ${{$203413s1=0}*9} Physical damage. Damage increased by Mongoose Fury.
  • max_stacks:0
  • duration:4.00
  • cooldown:45.00
  • default_chance:100.00%
Mark of the Claw 11.4 3.0 26.1sec 20.2sec 25.37% 25.37% 3.0(3.0) 11.1

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Mok'Nathal Tactics 6.2 43.2 49.8sec 6.1sec 97.82% 97.82% 27.6(27.6) 5.2

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_moknathal_tactics
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03

Stack Uptimes

  • moknathal_tactics_1:12.79%
  • moknathal_tactics_2:9.18%
  • moknathal_tactics_3:8.86%
  • moknathal_tactics_4:66.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201081
  • name:Mok'Nathal Tactics
  • tooltip:Attack Power increased by {$s1=3}%
  • description:$@spelldesc109306
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Mongoose Fury 9.8 35.1 31.9sec 6.6sec 55.18% 90.49% 2.7(2.7) 9.2

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_mongoose_fury
  • max_stacks:6
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50

Stack Uptimes

  • mongoose_fury_1:10.40%
  • mongoose_fury_2:9.19%
  • mongoose_fury_3:14.05%
  • mongoose_fury_4:9.29%
  • mongoose_fury_5:3.41%
  • mongoose_fury_6:8.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190931
  • name:Mongoose Fury
  • tooltip:Damage dealt by Mongoose Bite increased by {$s1=50}%.
  • description:{$@spelldesc190928=Attempts to sever the target's limbs with a brutal attack that deals $sw1 Physical damage and grants you Mongoose Fury. Mongoose Fury increases Mongoose Bite damage by $?a134735[{$190931s2=35}][{$190931s1=50}]% for {$190931d=14 seconds}, stacking up to {$190931u=6} times. Successive attacks do not increase duration.}
  • max_stacks:6
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 59.2sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:750.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_SV_T19M
flanking_strike Focus 29.6 1478.6 50.0 50.0 5321.0
lacerate Focus 25.2 881.8 35.0 35.0 15114.0
raptor_strike Focus 49.3 1232.9 25.0 25.0 6949.4
pet - cat
claw Focus 100.7 4648.3 46.2 46.2 749.9
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1001.12 3520.59 (100.00%) 3.52 234.22 6.24%
pet - cat
focus_regen Focus 566.38 4577.81 (100.00%) 8.08 111.77 2.38%
Resource RPS-Gain RPS-Loss
Focus 11.71 11.96
Combat End Resource Mean Min Max
Focus 47.17 0.02 120.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 84.7%
Uptimes %
Focus Cap 4.5%
cat-Focus Cap 0.4%

Procs

Count Interval
hunting_companion 4.0 53.9sec

Statistics & Data Analysis

Fight Length
Sample Data Hunter_SV_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Hunter_SV_T19M Damage Per Second
Count 7499
Mean 333998.95
Minimum 311458.47
Maximum 365378.62
Spread ( max - min ) 53920.15
Range [ ( max - min ) / 2 * 100% ] 8.07%
Standard Deviation 8017.1456
5th Percentile 321524.92
95th Percentile 348065.49
( 95th Percentile - 5th Percentile ) 26540.57
Mean Distribution
Standard Deviation 92.5802
95.00% Confidence Intervall ( 333817.50 - 334180.41 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2213
0.1 Scale Factor Error with Delta=300 548685
0.05 Scale Factor Error with Delta=300 2194740
0.01 Scale Factor Error with Delta=300 54868515
Priority Target DPS
Sample Data Hunter_SV_T19M Priority Target Damage Per Second
Count 7499
Mean 333998.95
Minimum 311458.47
Maximum 365378.62
Spread ( max - min ) 53920.15
Range [ ( max - min ) / 2 * 100% ] 8.07%
Standard Deviation 8017.1456
5th Percentile 321524.92
95th Percentile 348065.49
( 95th Percentile - 5th Percentile ) 26540.57
Mean Distribution
Standard Deviation 92.5802
95.00% Confidence Intervall ( 333817.50 - 334180.41 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2213
0.1 Scale Factor Error with Delta=300 548685
0.05 Scale Factor Error with Delta=300 2194740
0.01 Scale Factor Error with Delta=300 54868515
DPS(e)
Sample Data Hunter_SV_T19M Damage Per Second (Effective)
Count 7499
Mean 333998.95
Minimum 311458.47
Maximum 365378.62
Spread ( max - min ) 53920.15
Range [ ( max - min ) / 2 * 100% ] 8.07%
Damage
Sample Data Hunter_SV_T19M Damage
Count 7499
Mean 89059753.49
Minimum 66583108.54
Maximum 112753106.60
Spread ( max - min ) 46169998.05
Range [ ( max - min ) / 2 * 100% ] 25.92%
DTPS
Sample Data Hunter_SV_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hunter_SV_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hunter_SV_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hunter_SV_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hunter_SV_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hunter_SV_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hunter_SV_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hunter_SV_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet
3 0.00 snapshot_stats
4 0.00 potion,name=potion_of_the_old_war
5 0.00 augmentation,type=defiled
6 0.00 harpoon
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_attack
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
8 1.00 potion,name=old_war
0.00 steel_trap
9 24.76 explosive_trap
A 10.30 dragonsfire_grenade
0.00 caltrops
0.00 carve,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies>=3&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)
B 32.06 raptor_strike,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies<=2&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)|talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains<gcd.max|buff.moknathal_tactics.down)
C 6.59 aspect_of_the_eagle
D 6.57 fury_of_the_eagle,if=buff.mongoose_fury.up&(buff.mongoose_fury.stack=6|action.mongoose_bite.charges=0&cooldown.snake_hunter.remains|buff.mongoose_fury.remains<=gcd.max*2)
E 44.88 mongoose_bite,if=buff.aspect_of_the_eagle.up&(charges>=2|charges>=1&cooldown.mongoose_bite.remains<=2)|(buff.mongoose_fury.up|cooldown.fury_of_the_eagle.remains<5|charges=3)
0.00 a_murder_of_crows
F 25.19 lacerate,if=dot.lacerate.ticking&dot.lacerate.remains<=3|target.time_to_die>=5
G 3.55 snake_hunter,if=action.mongoose_bite.charges<=1&buff.mongoose_fury.remains>gcd.max*4|action.mongoose_bite.charges=0&buff.aspect_of_the_eagle.up
H 29.57 flanking_strike,if=talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains>=3)|!talent.way_of_the_moknathal.enabled
0.00 butchery,if=spell_targets.butchery>=2
0.00 carve,if=spell_targets.carve>=4
0.00 spitting_cobra
0.00 throwing_axes
I 17.26 raptor_strike,if=!talent.throwing_axes.enabled&focus>75-cooldown.flanking_strike.remains*focus.regen

Sample Sequence

01245679ABCEEEFGEEEDB9EEHFIHIEH9FBHABH9FEEBEEHF9BCEHBE8D9ABFHEIIH9FBHB9FBAHIE9CEEFBGEEED9BFEHIIHA9FBHBE9EEFBHECI9HFAEBDH9FBEHBH9FBHAB9FHBEECEF9BEEGEDBE9EFABHIIH9FBHBE9EEFBHEACB9EDBEFHI9IHEEFBH9ABFHB9HEEEBFGCEE

Sample Sequence Table

time name target resources buffs
Pre flask Hunter_SV_T19M 120.0/120: 100% focus
Pre food Hunter_SV_T19M 120.0/120: 100% focus
Pre summon_pet Fluffy_Pillow 120.0/120: 100% focus
Pre potion Fluffy_Pillow 120.0/120: 100% focus potion_of_the_old_war
Pre augmentation Hunter_SV_T19M 120.0/120: 100% focus potion_of_the_old_war
0:00.000 harpoon Fluffy_Pillow 120.0/120: 100% focus blood_frenzy, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 120.0/120: 100% focus blood_frenzy, potion_of_the_old_war
0:00.000 explosive_trap Fluffy_Pillow 120.0/120: 100% focus bloodlust, blood_frenzy, potion_of_the_old_war
0:00.754 dragonsfire_grenade Fluffy_Pillow 120.0/120: 100% focus bloodlust, blood_frenzy, potion_of_the_old_war
0:01.511 raptor_strike Fluffy_Pillow 120.0/120: 100% focus bloodlust, blood_frenzy, potion_of_the_old_war
0:02.446 aspect_of_the_eagle Fluffy_Pillow 110.3/120: 92% focus bloodlust, moknathal_tactics, cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:02.446 mongoose_bite Fluffy_Pillow 110.3/120: 92% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:03.319 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury, cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:04.190 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(2), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:05.062 lacerate Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:05.933 snake_hunter Fluffy_Pillow 100.1/120: 83% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:05.933 mongoose_bite Fluffy_Pillow 100.1/120: 83% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:06.805 mongoose_bite Fluffy_Pillow 115.1/120: 96% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(4), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:07.677 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(5), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:08.550 fury_of_the_eagle Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(6), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:11.157 raptor_strike Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, mongoose_fury(6), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:12.027 explosive_trap Fluffy_Pillow 110.0/120: 92% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(6), cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:12.818 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, moknathal_tactics, mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:13.753 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, moknathal_tactics, mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:14.687 flanking_strike Fluffy_Pillow 120.0/120: 100% focus bloodlust, moknathal_tactics, mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:15.620 lacerate Fluffy_Pillow 85.1/120: 71% focus bloodlust, moknathal_tactics, mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:16.553 raptor_strike Fluffy_Pillow 64.4/120: 54% focus bloodlust, moknathal_tactics, mongoose_fury(6), potion_of_the_old_war
0:17.563 Waiting 0.700 sec 55.7/120: 46% focus bloodlust, moknathal_tactics(2), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:18.263 flanking_strike Fluffy_Pillow 66.9/120: 56% focus bloodlust, moknathal_tactics(2), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:19.383 raptor_strike Fluffy_Pillow 35.0/120: 29% focus bloodlust, moknathal_tactics(2), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:20.318 Waiting 0.700 sec 25.1/120: 21% focus bloodlust, moknathal_tactics(3), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:21.018 mongoose_bite Fluffy_Pillow 36.4/120: 30% focus bloodlust, moknathal_tactics(3), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:22.160 flanking_strike Fluffy_Pillow 54.8/120: 46% focus bloodlust, moknathal_tactics(3), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
0:23.101 Waiting 0.700 sec 20.0/120: 17% focus bloodlust, moknathal_tactics(3), cleansed_ancients_blessing, cleansed_wisps_blessing, blood_frenzy
0:23.801 explosive_trap Fluffy_Pillow 31.3/120: 26% focus bloodlust, moknathal_tactics(3), cleansed_ancients_blessing, cleansed_wisps_blessing, blood_frenzy
0:24.781 Waiting 0.600 sec 47.1/120: 39% focus bloodlust, moknathal_tactics(3), cleansed_ancients_blessing, cleansed_wisps_blessing, blood_frenzy
0:25.381 lacerate Fluffy_Pillow 56.8/120: 47% focus bloodlust, moknathal_tactics(3), cleansed_ancients_blessing, cleansed_wisps_blessing, blood_frenzy
0:26.554 raptor_strike Fluffy_Pillow 40.7/120: 34% focus bloodlust, moknathal_tactics(3), cleansed_ancients_blessing, cleansed_wisps_blessing
0:27.564 Waiting 1.300 sec 30.8/120: 26% focus bloodlust, moknathal_tactics(4), cleansed_ancients_blessing, cleansed_wisps_blessing
0:28.864 flanking_strike Fluffy_Pillow 50.2/120: 42% focus bloodlust, moknathal_tactics(4), cleansed_ancients_blessing, cleansed_wisps_blessing
0:29.873 Waiting 0.700 sec 15.2/120: 13% focus bloodlust, moknathal_tactics(4), cleansed_ancients_blessing, cleansed_wisps_blessing
0:30.573 dragonsfire_grenade Fluffy_Pillow 25.7/120: 21% focus bloodlust, moknathal_tactics(4), cleansed_ancients_blessing, cleansed_wisps_blessing
0:31.508 Waiting 2.100 sec 39.6/120: 33% focus bloodlust, moknathal_tactics(4), cleansed_ancients_blessing
0:33.608 raptor_strike Fluffy_Pillow 70.9/120: 59% focus bloodlust, moknathal_tactics(4)
0:34.619 flanking_strike Fluffy_Pillow 61.0/120: 51% focus bloodlust, moknathal_tactics(4)
0:35.629 Waiting 0.200 sec 26.1/120: 22% focus bloodlust, moknathal_tactics(4), cleansed_wisps_blessing
0:35.829 explosive_trap Fluffy_Pillow 29.0/120: 24% focus bloodlust, moknathal_tactics(4), cleansed_ancients_blessing, cleansed_wisps_blessing
0:36.782 lacerate Fluffy_Pillow 43.2/120: 36% focus bloodlust, moknathal_tactics(4), cleansed_ancients_blessing, cleansed_wisps_blessing
0:37.791 Waiting 1.300 sec 23.3/120: 19% focus bloodlust, moknathal_tactics(4), cleansed_ancients_blessing, cleansed_wisps_blessing
0:39.091 mongoose_bite Fluffy_Pillow 42.7/120: 36% focus bloodlust, moknathal_tactics(4), cleansed_ancients_blessing, cleansed_wisps_blessing
0:40.101 mongoose_bite Fluffy_Pillow 54.3/120: 45% focus moknathal_tactics(4), mongoose_fury, cleansed_ancients_blessing, cleansed_wisps_blessing
0:41.413 raptor_strike Fluffy_Pillow 69.3/120: 58% focus moknathal_tactics(4), mongoose_fury(2), cleansed_ancients_blessing, cleansed_wisps_blessing
0:42.725 mongoose_bite Fluffy_Pillow 59.4/120: 49% focus moknathal_tactics(4), mongoose_fury(2), cleansed_ancients_blessing, cleansed_wisps_blessing
0:44.037 mongoose_bite Fluffy_Pillow 74.6/120: 62% focus moknathal_tactics(4), mongoose_fury(3), cleansed_ancients_blessing, cleansed_wisps_blessing, mark_of_the_claw
0:45.328 flanking_strike Fluffy_Pillow 89.6/120: 75% focus moknathal_tactics(4), mongoose_fury(4), cleansed_ancients_blessing, mark_of_the_claw
0:46.620 lacerate Fluffy_Pillow 54.7/120: 46% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing, mark_of_the_claw
0:48.075 explosive_trap Fluffy_Pillow 36.6/120: 31% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing, mark_of_the_claw
0:49.191 raptor_strike Fluffy_Pillow 49.5/120: 41% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing
0:50.503 aspect_of_the_eagle Fluffy_Pillow 39.6/120: 33% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing
0:50.503 mongoose_bite Fluffy_Pillow 39.6/120: 33% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing
0:51.815 flanking_strike Fluffy_Pillow 54.6/120: 46% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(5), cleansed_wisps_blessing
0:53.127 Waiting 2.900 sec 19.7/120: 16% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_wisps_blessing
0:56.027 raptor_strike Fluffy_Pillow 55.6/120: 46% focus aspect_of_the_eagle, moknathal_tactics(4), blood_frenzy
0:57.241 mongoose_bite Fluffy_Pillow 45.7/120: 38% focus aspect_of_the_eagle, moknathal_tactics(4), blood_frenzy
0:58.453 potion Fluffy_Pillow 60.8/120: 51% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, blood_frenzy
0:58.453 fury_of_the_eagle Fluffy_Pillow 60.8/120: 51% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, blood_frenzy, potion_of_the_old_war
1:01.912 explosive_trap Fluffy_Pillow 103.7/120: 86% focus moknathal_tactics(4), mongoose_fury, blood_frenzy, potion_of_the_old_war
1:02.890 dragonsfire_grenade Fluffy_Pillow 115.8/120: 97% focus moknathal_tactics(4), mongoose_fury, blood_frenzy, potion_of_the_old_war
1:03.868 raptor_strike Fluffy_Pillow 120.0/120: 100% focus moknathal_tactics(4), mongoose_fury, blood_frenzy, potion_of_the_old_war
1:05.081 lacerate Fluffy_Pillow 110.1/120: 92% focus moknathal_tactics(4), mongoose_fury, blood_frenzy, potion_of_the_old_war
1:06.295 flanking_strike Fluffy_Pillow 90.2/120: 75% focus moknathal_tactics(4), mongoose_fury, mark_of_the_claw, blood_frenzy, potion_of_the_old_war
1:07.491 mongoose_bite Fluffy_Pillow 55.0/120: 46% focus moknathal_tactics(4), mongoose_fury, mark_of_the_claw, potion_of_the_old_war
1:08.782 raptor_strike Fluffy_Pillow 70.0/120: 58% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, potion_of_the_old_war
1:10.075 raptor_strike Fluffy_Pillow 60.1/120: 50% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, potion_of_the_old_war
1:11.366 flanking_strike Fluffy_Pillow 50.1/120: 42% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, potion_of_the_old_war
1:12.665 Waiting 1.000 sec 15.2/120: 13% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, potion_of_the_old_war
1:13.665 explosive_trap Fluffy_Pillow 26.9/120: 22% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, potion_of_the_old_war
1:15.022 lacerate Fluffy_Pillow 42.7/120: 36% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, potion_of_the_old_war
1:16.374 Waiting 0.400 sec 23.4/120: 19% focus moknathal_tactics(4), mark_of_the_claw, potion_of_the_old_war
1:16.774 raptor_strike Fluffy_Pillow 28.0/120: 23% focus moknathal_tactics(4), potion_of_the_old_war
1:18.087 Waiting 2.800 sec 18.1/120: 15% focus moknathal_tactics(4), potion_of_the_old_war
1:20.887 flanking_strike Fluffy_Pillow 50.2/120: 42% focus moknathal_tactics(4), potion_of_the_old_war
1:22.198 Waiting 1.300 sec 15.3/120: 13% focus moknathal_tactics(4), potion_of_the_old_war
1:23.498 raptor_strike Fluffy_Pillow 30.2/120: 25% focus moknathal_tactics(4)
1:24.809 Waiting 0.900 sec 20.2/120: 17% focus moknathal_tactics(4)
1:25.709 explosive_trap Fluffy_Pillow 30.5/120: 25% focus moknathal_tactics(4)
1:27.056 lacerate Fluffy_Pillow 46.0/120: 38% focus moknathal_tactics(4)
1:28.367 Waiting 1.900 sec 26.1/120: 22% focus moknathal_tactics(4), mark_of_the_claw
1:30.267 raptor_strike Fluffy_Pillow 48.2/120: 40% focus moknathal_tactics(4), mark_of_the_claw
1:31.562 Waiting 1.100 sec 38.3/120: 32% focus moknathal_tactics(4), mark_of_the_claw
1:32.662 dragonsfire_grenade Fluffy_Pillow 51.2/120: 43% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
1:33.842 flanking_strike Fluffy_Pillow 66.0/120: 55% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
1:35.039 raptor_strike Fluffy_Pillow 30.9/120: 26% focus moknathal_tactics(4), blood_frenzy
1:36.251 Waiting 0.700 sec 20.9/120: 17% focus moknathal_tactics(4), blood_frenzy
1:36.951 mongoose_bite Fluffy_Pillow 29.6/120: 25% focus moknathal_tactics(4), blood_frenzy
1:38.164 explosive_trap Fluffy_Pillow 44.7/120: 37% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
1:39.140 aspect_of_the_eagle Fluffy_Pillow 56.8/120: 47% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
1:39.140 mongoose_bite Fluffy_Pillow 56.8/120: 47% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, blood_frenzy
1:40.353 mongoose_bite Fluffy_Pillow 71.9/120: 60% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(2), blood_frenzy
1:41.568 lacerate Fluffy_Pillow 86.9/120: 72% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, blood_frenzy
1:42.781 raptor_strike Fluffy_Pillow 66.8/120: 56% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing
1:44.092 snake_hunter Fluffy_Pillow 58.1/120: 48% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, blood_frenzy
1:44.092 mongoose_bite Fluffy_Pillow 58.1/120: 48% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, blood_frenzy
1:45.304 mongoose_bite Fluffy_Pillow 73.1/120: 61% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing, blood_frenzy
1:46.518 mongoose_bite Fluffy_Pillow 88.2/120: 73% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(5), cleansed_wisps_blessing, blood_frenzy
1:47.728 fury_of_the_eagle Fluffy_Pillow 103.2/120: 86% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6), cleansed_wisps_blessing, blood_frenzy
1:51.172 explosive_trap Fluffy_Pillow 120.0/120: 100% focus mongoose_fury(6), blood_frenzy
1:52.149 raptor_strike Fluffy_Pillow 120.0/120: 100% focus mongoose_fury(6), blood_frenzy
1:53.361 lacerate Fluffy_Pillow 109.5/120: 91% focus moknathal_tactics, mongoose_fury(6)
1:54.675 mongoose_bite Fluffy_Pillow 89.6/120: 75% focus moknathal_tactics, mongoose_fury(6), mark_of_the_claw
1:55.967 flanking_strike Fluffy_Pillow 104.6/120: 87% focus moknathal_tactics, mark_of_the_claw
1:57.259 raptor_strike Fluffy_Pillow 69.7/120: 58% focus moknathal_tactics, mark_of_the_claw
1:58.553 raptor_strike Fluffy_Pillow 59.7/120: 50% focus moknathal_tactics(2), mark_of_the_claw
1:59.846 Waiting 1.100 sec 49.8/120: 41% focus moknathal_tactics(3), mark_of_the_claw
2:00.946 flanking_strike Fluffy_Pillow 62.6/120: 52% focus moknathal_tactics(3), mark_of_the_claw
2:02.414 Waiting 0.300 sec 29.5/120: 25% focus moknathal_tactics(3)
2:02.714 dragonsfire_grenade Fluffy_Pillow 33.0/120: 27% focus moknathal_tactics(3)
2:04.033 explosive_trap Fluffy_Pillow 48.1/120: 40% focus moknathal_tactics(3)
2:05.177 lacerate Fluffy_Pillow 61.2/120: 51% focus moknathal_tactics(3)
2:06.490 raptor_strike Fluffy_Pillow 41.3/120: 34% focus moknathal_tactics(3)
2:07.801 Waiting 1.700 sec 31.3/120: 26% focus moknathal_tactics(4)
2:09.501 flanking_strike Fluffy_Pillow 50.8/120: 42% focus moknathal_tactics(4)
2:10.812 Waiting 2.400 sec 15.8/120: 13% focus moknathal_tactics(4)
2:13.212 raptor_strike Fluffy_Pillow 43.4/120: 36% focus moknathal_tactics(4)
2:14.523 Waiting 0.100 sec 33.4/120: 28% focus moknathal_tactics(4)
2:14.623 mongoose_bite Fluffy_Pillow 34.5/120: 29% focus moknathal_tactics(4)
2:15.937 explosive_trap Fluffy_Pillow 49.6/120: 41% focus moknathal_tactics(4), mongoose_fury
2:17.177 mongoose_bite Fluffy_Pillow 63.8/120: 53% focus moknathal_tactics(4), mongoose_fury
2:18.487 mongoose_bite Fluffy_Pillow 78.9/120: 66% focus moknathal_tactics(4), mongoose_fury(2)
2:19.799 lacerate Fluffy_Pillow 93.9/120: 78% focus moknathal_tactics(4), mongoose_fury(3)
2:21.111 raptor_strike Fluffy_Pillow 74.0/120: 62% focus moknathal_tactics(4), mongoose_fury(3)
2:22.421 flanking_strike Fluffy_Pillow 64.0/120: 53% focus moknathal_tactics(4), mongoose_fury(3)
2:23.732 Waiting 1.100 sec 29.0/120: 24% focus moknathal_tactics(4), mongoose_fury(3)
2:24.832 mongoose_bite Fluffy_Pillow 42.3/120: 35% focus moknathal_tactics(4), mongoose_fury(3), blood_frenzy
2:26.225 Waiting 0.700 sec 59.6/120: 50% focus moknathal_tactics(4), mongoose_fury(4), blood_frenzy
2:26.925 aspect_of_the_eagle Fluffy_Pillow 68.3/120: 57% focus moknathal_tactics(4), mongoose_fury(4), blood_frenzy
2:27.140 Waiting 0.300 sec 71.0/120: 59% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_sisters_blessing, blood_frenzy
2:27.440 raptor_strike Fluffy_Pillow 75.0/120: 63% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_sisters_blessing, blood_frenzy
2:28.571 explosive_trap Fluffy_Pillow 65.2/120: 54% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
2:29.401 flanking_strike Fluffy_Pillow 76.4/120: 64% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
2:30.520 lacerate Fluffy_Pillow 41.4/120: 35% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
2:31.637 Waiting 1.100 sec 21.5/120: 18% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
2:32.737 dragonsfire_grenade Fluffy_Pillow 36.3/120: 30% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
2:33.721 Waiting 0.200 sec 49.5/120: 41% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
2:33.921 mongoose_bite Fluffy_Pillow 52.2/120: 44% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_sisters_blessing, blood_frenzy
2:35.224 raptor_strike Fluffy_Pillow 69.5/120: 58% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, cleansed_sisters_blessing, blood_frenzy
2:36.355 fury_of_the_eagle Fluffy_Pillow 59.6/120: 50% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, cleansed_sisters_blessing, blood_frenzy
2:39.606 flanking_strike Fluffy_Pillow 100.6/120: 84% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
2:40.818 explosive_trap Fluffy_Pillow 65.6/120: 55% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
2:41.795 lacerate Fluffy_Pillow 77.7/120: 65% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
2:43.007 raptor_strike Fluffy_Pillow 57.8/120: 48% focus moknathal_tactics(4), mongoose_fury, mark_of_the_claw, blood_frenzy
2:44.202 mongoose_bite Fluffy_Pillow 47.9/120: 40% focus moknathal_tactics(4), mongoose_fury, mark_of_the_claw, blood_frenzy
2:45.399 flanking_strike Fluffy_Pillow 62.9/120: 52% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, blood_frenzy
2:46.595 Waiting 3.300 sec 28.0/120: 23% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, blood_frenzy
2:49.895 raptor_strike Fluffy_Pillow 69.3/120: 58% focus moknathal_tactics(4), mongoose_fury(2), blood_frenzy
2:51.110 flanking_strike Fluffy_Pillow 59.4/120: 49% focus moknathal_tactics(4), mongoose_fury(2), blood_frenzy
2:52.322 Waiting 0.300 sec 24.4/120: 20% focus moknathal_tactics(4), mongoose_fury(2), blood_frenzy
2:52.622 explosive_trap Fluffy_Pillow 28.2/120: 23% focus moknathal_tactics(4), mongoose_fury(2), blood_frenzy
2:53.795 lacerate Fluffy_Pillow 42.7/120: 36% focus moknathal_tactics(4), blood_frenzy
2:55.008 Waiting 1.600 sec 22.0/120: 18% focus moknathal_tactics(4)
2:56.608 raptor_strike Fluffy_Pillow 40.4/120: 34% focus moknathal_tactics(4)
2:57.919 Waiting 1.500 sec 31.6/120: 26% focus moknathal_tactics(4), blood_frenzy
2:59.419 flanking_strike Fluffy_Pillow 50.3/120: 42% focus moknathal_tactics(4), blood_frenzy
3:00.631 Waiting 2.100 sec 15.3/120: 13% focus moknathal_tactics(4), cleansed_ancients_blessing, blood_frenzy
3:02.731 dragonsfire_grenade Fluffy_Pillow 41.4/120: 34% focus moknathal_tactics(4), cleansed_ancients_blessing, blood_frenzy
3:03.870 raptor_strike Fluffy_Pillow 55.5/120: 46% focus moknathal_tactics(4), cleansed_ancients_blessing, blood_frenzy
3:05.083 explosive_trap Fluffy_Pillow 45.6/120: 38% focus moknathal_tactics(4), cleansed_ancients_blessing, blood_frenzy
3:06.060 lacerate Fluffy_Pillow 57.7/120: 48% focus moknathal_tactics(4), cleansed_ancients_blessing, blood_frenzy
3:07.273 Waiting 1.200 sec 37.1/120: 31% focus moknathal_tactics(4), cleansed_ancients_blessing
3:08.473 flanking_strike Fluffy_Pillow 50.9/120: 42% focus moknathal_tactics(4), cleansed_ancients_blessing
3:09.786 Waiting 0.800 sec 16.0/120: 13% focus moknathal_tactics(4)
3:10.586 raptor_strike Fluffy_Pillow 25.1/120: 21% focus moknathal_tactics(4)
3:11.897 Waiting 0.600 sec 15.2/120: 13% focus moknathal_tactics(4)
3:12.497 mongoose_bite Fluffy_Pillow 22.1/120: 18% focus moknathal_tactics(4)
3:13.808 mongoose_bite Fluffy_Pillow 37.1/120: 31% focus moknathal_tactics(4), mongoose_fury
3:15.118 aspect_of_the_eagle Fluffy_Pillow 52.1/120: 43% focus moknathal_tactics(4), mongoose_fury(2)
3:15.140 mongoose_bite Fluffy_Pillow 52.4/120: 44% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(2)
3:16.452 lacerate Fluffy_Pillow 67.4/120: 56% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3)
3:17.765 explosive_trap Fluffy_Pillow 47.5/120: 40% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3)
3:18.908 raptor_strike Fluffy_Pillow 60.6/120: 50% focus aspect_of_the_eagle, mongoose_fury(3)
3:20.219 mongoose_bite Fluffy_Pillow 51.7/120: 43% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), cleansed_sisters_blessing
3:21.436 mongoose_bite Fluffy_Pillow 66.8/120: 56% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(4), cleansed_sisters_blessing
3:22.654 snake_hunter Fluffy_Pillow 81.8/120: 68% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(5), cleansed_sisters_blessing
3:22.654 mongoose_bite Fluffy_Pillow 81.8/120: 68% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(5), cleansed_sisters_blessing
3:23.874 fury_of_the_eagle Fluffy_Pillow 96.9/120: 81% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(6), cleansed_sisters_blessing
3:27.353 raptor_strike Fluffy_Pillow 120.0/120: 100% focus mongoose_fury(6), cleansed_sisters_blessing
3:28.572 mongoose_bite Fluffy_Pillow 110.1/120: 92% focus moknathal_tactics, mongoose_fury(6), cleansed_sisters_blessing
3:29.791 explosive_trap Fluffy_Pillow 120.0/120: 100% focus moknathal_tactics, mongoose_fury(6)
3:30.850 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus moknathal_tactics, mongoose_fury(6), blood_frenzy
3:32.062 lacerate Fluffy_Pillow 120.0/120: 100% focus moknathal_tactics, blood_frenzy
3:33.275 dragonsfire_grenade Fluffy_Pillow 100.1/120: 83% focus moknathal_tactics, blood_frenzy
3:34.252 raptor_strike Fluffy_Pillow 112.2/120: 93% focus moknathal_tactics, cleansed_ancients_blessing, blood_frenzy
3:35.465 flanking_strike Fluffy_Pillow 102.2/120: 85% focus moknathal_tactics(2), cleansed_ancients_blessing, blood_frenzy
3:36.676 raptor_strike Fluffy_Pillow 67.3/120: 56% focus moknathal_tactics(2), cleansed_ancients_blessing, blood_frenzy
3:37.889 raptor_strike Fluffy_Pillow 57.3/120: 48% focus moknathal_tactics(3), cleansed_ancients_blessing, blood_frenzy
3:39.103 Waiting 1.000 sec 47.4/120: 40% focus moknathal_tactics(4), cleansed_ancients_blessing, blood_frenzy
3:40.103 flanking_strike Fluffy_Pillow 59.5/120: 50% focus moknathal_tactics(4), cleansed_ancients_blessing
3:41.651 explosive_trap Fluffy_Pillow 27.3/120: 23% focus moknathal_tactics(4), cleansed_ancients_blessing
3:42.934 lacerate Fluffy_Pillow 42.0/120: 35% focus moknathal_tactics(4), cleansed_ancients_blessing
3:44.247 Waiting 0.400 sec 22.1/120: 18% focus moknathal_tactics(4)
3:44.647 raptor_strike Fluffy_Pillow 26.6/120: 22% focus moknathal_tactics(4)
3:45.959 Waiting 2.900 sec 16.7/120: 14% focus moknathal_tactics(4)
3:48.859 flanking_strike Fluffy_Pillow 50.3/120: 42% focus moknathal_tactics(4), mark_of_the_claw
3:50.150 Waiting 1.300 sec 15.3/120: 13% focus moknathal_tactics(4), mark_of_the_claw
3:51.450 raptor_strike Fluffy_Pillow 30.5/120: 25% focus moknathal_tactics(4), mark_of_the_claw
3:52.744 mongoose_bite Fluffy_Pillow 21.7/120: 18% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
3:53.941 explosive_trap Fluffy_Pillow 36.6/120: 31% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
3:54.918 mongoose_bite Fluffy_Pillow 48.7/120: 41% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
3:56.131 mongoose_bite Fluffy_Pillow 63.8/120: 53% focus moknathal_tactics(4), mongoose_fury(2), blood_frenzy
3:57.344 lacerate Fluffy_Pillow 78.9/120: 66% focus moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy
3:58.542 raptor_strike Fluffy_Pillow 59.0/120: 49% focus moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy
3:59.735 Waiting 0.100 sec 49.0/120: 41% focus moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy
3:59.835 flanking_strike Fluffy_Pillow 50.3/120: 42% focus moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy
4:01.031 Waiting 1.000 sec 15.3/120: 13% focus moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, mark_of_the_claw, blood_frenzy
4:02.031 mongoose_bite Fluffy_Pillow 27.3/120: 23% focus moknathal_tactics(4), mongoose_fury(3), cleansed_wisps_blessing, mark_of_the_claw
4:03.562 dragonsfire_grenade Fluffy_Pillow 45.1/120: 38% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing
4:04.704 aspect_of_the_eagle Fluffy_Pillow 58.2/120: 48% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing
4:04.704 Waiting 0.600 sec 58.2/120: 48% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing
4:05.304 raptor_strike Fluffy_Pillow 65.0/120: 54% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing
4:06.615 explosive_trap Fluffy_Pillow 56.3/120: 47% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), blood_frenzy
4:07.591 mongoose_bite Fluffy_Pillow 68.4/120: 57% focus aspect_of_the_eagle, moknathal_tactics(4), blood_frenzy
4:08.802 fury_of_the_eagle Fluffy_Pillow 83.5/120: 70% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, mark_of_the_claw, blood_frenzy
4:12.241 raptor_strike Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, mark_of_the_claw, blood_frenzy
4:13.438 mongoose_bite Fluffy_Pillow 110.1/120: 92% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, mark_of_the_claw, blood_frenzy
4:14.633 lacerate Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(2), blood_frenzy
4:15.846 flanking_strike Fluffy_Pillow 99.5/120: 83% focus moknathal_tactics(4), mongoose_fury(2)
4:17.157 raptor_strike Fluffy_Pillow 64.6/120: 54% focus moknathal_tactics(4), mongoose_fury(2)
4:18.470 explosive_trap Fluffy_Pillow 54.6/120: 46% focus moknathal_tactics(4), mongoose_fury(2)
4:19.759 raptor_strike Fluffy_Pillow 69.4/120: 58% focus moknathal_tactics(4), mongoose_fury(2)
4:21.073 flanking_strike Fluffy_Pillow 60.7/120: 51% focus moknathal_tactics(4), mongoose_fury(2), blood_frenzy
4:22.287 mongoose_bite Fluffy_Pillow 25.8/120: 22% focus moknathal_tactics(4), mongoose_fury(2), blood_frenzy
4:23.500 Waiting 0.600 sec 40.9/120: 34% focus moknathal_tactics(4), mongoose_fury(3), blood_frenzy
4:24.100 mongoose_bite Fluffy_Pillow 48.3/120: 40% focus moknathal_tactics(4), mongoose_fury(3), blood_frenzy
4:25.313 lacerate Fluffy_Pillow 63.4/120: 53% focus moknathal_tactics(4), mongoose_fury(4), blood_frenzy
4:26.525 Waiting 0.100 sec 43.4/120: 36% focus moknathal_tactics(4), mongoose_fury(4), blood_frenzy
4:26.625 raptor_strike Fluffy_Pillow 44.7/120: 37% focus moknathal_tactics(4), blood_frenzy
4:27.836 Waiting 1.300 sec 34.7/120: 29% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
4:29.136 flanking_strike Fluffy_Pillow 51.1/120: 43% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
4:30.331 Waiting 0.100 sec 16.1/120: 13% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
4:30.431 explosive_trap Fluffy_Pillow 17.4/120: 15% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
4:31.567 Waiting 1.800 sec 31.7/120: 26% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
4:33.367 dragonsfire_grenade Fluffy_Pillow 54.3/120: 45% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
4:34.539 raptor_strike Fluffy_Pillow 68.9/120: 57% focus moknathal_tactics(4), blood_frenzy
4:35.751 lacerate Fluffy_Pillow 59.0/120: 49% focus moknathal_tactics(4), blood_frenzy
4:36.963 Waiting 0.900 sec 39.0/120: 33% focus moknathal_tactics(4), blood_frenzy
4:37.863 flanking_strike Fluffy_Pillow 50.2/120: 42% focus moknathal_tactics(4), blood_frenzy
4:39.075 Waiting 2.300 sec 15.3/120: 13% focus moknathal_tactics(4), cleansed_sisters_blessing, blood_frenzy
4:41.375 raptor_strike Fluffy_Pillow 43.7/120: 36% focus moknathal_tactics(4), cleansed_sisters_blessing
4:42.594 explosive_trap Fluffy_Pillow 33.8/120: 28% focus moknathal_tactics(4), cleansed_sisters_blessing
4:43.601 Waiting 0.400 sec 46.2/120: 39% focus moknathal_tactics(4), cleansed_sisters_blessing
4:44.001 flanking_strike Fluffy_Pillow 51.2/120: 43% focus moknathal_tactics(4), cleansed_sisters_blessing
4:45.220 mongoose_bite Fluffy_Pillow 16.2/120: 14% focus moknathal_tactics(4), cleansed_sisters_blessing
4:46.437 mongoose_bite Fluffy_Pillow 31.3/120: 26% focus moknathal_tactics(4), mongoose_fury, cleansed_sisters_blessing
4:47.656 mongoose_bite Fluffy_Pillow 46.3/120: 39% focus moknathal_tactics(4), mongoose_fury(2), cleansed_sisters_blessing
4:48.874 raptor_strike Fluffy_Pillow 61.4/120: 51% focus moknathal_tactics(4), mongoose_fury(3), cleansed_sisters_blessing
4:50.092 lacerate Fluffy_Pillow 50.5/120: 42% focus moknathal_tactics(4), mongoose_fury(3)
4:51.404 Waiting 1.000 sec 30.5/120: 25% focus moknathal_tactics(4), mongoose_fury(3)
4:52.404 snake_hunter Fluffy_Pillow 42.0/120: 35% focus moknathal_tactics(4), mongoose_fury(3)
4:52.654 aspect_of_the_eagle Fluffy_Pillow 44.9/120: 37% focus moknathal_tactics(4), mongoose_fury(3)
4:52.704 mongoose_bite Fluffy_Pillow 45.5/120: 38% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3)
4:54.016 mongoose_bite Fluffy_Pillow 60.5/120: 50% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6231 6231 0
Agility 27896 26531 16240 (11258)
Stamina 41883 41883 25958
Intellect 6005 6005 0
Spirit 2 2 0
Health 2512980 2512980 0
Focus 120 120 0
Crit 44.15% 44.15% 10204
Haste 14.69% 14.69% 4775
Damage / Heal Versatility 4.28% 4.28% 1710
Attack Power 27896 26531 0
Mastery 9.25% 8.18% 2923
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_claw
Local Shoulders Matted Fur Pauldrons
ilevel: 880, stats: { 341 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist Laughing Sister's Pouch-Chain
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 AgiInt, +783 Crit, +312 Haste }
Local Legs Disjointed Linkage Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +886 Haste, +574 Crit }
Local Feet Malignant Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +783 Crit, +312 Haste }
Local Wrists Call of the Wild
ilevel: 880, stats: { 199 Armor, +1448 Sta, +965 Agi, +469 Crit, +352 Haste }
Local Hands Gauntlets of Malevolent Intent
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +665 Haste, +430 Vers }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Agi }
Local Main Hand Talonclaw
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Agi, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Animal Instincts (Survival Hunter) Throwing Axes (Survival Hunter) Way of the Mok'Nathal (Survival Hunter)
30 A Murder of Crows (Survival Hunter) Mortal Wounds (Survival Hunter) Snake Hunter (Survival Hunter)
45 Posthaste Farstrider Trailblazer
60 Caltrops (Survival Hunter) Improved Traps (Survival Hunter) Steel Trap (Survival Hunter)
75 Sticky Bomb (Survival Hunter) Ranger's Net (Survival Hunter) Camouflage (Survival Hunter)
90 Butchery (Survival Hunter) Dragonsfire Grenade (Survival Hunter) Serpent Sting (Survival Hunter)
100 Spitting Cobra (Survival Hunter) Expert Trapper (Survival Hunter) Aspect of the Beast

Profile

hunter="Hunter_SV_T19M"
level=110
race=pandaren
role=attack
position=ranged_back
talents=3302022
artifact=34:0:0:0:0:1068:1:1070:3:1071:3:1072:3:1073:3:1074:3:1075:3:1076:3:1077:3:1078:3:1079:1:1080:1:1081:1:1082:1:1083:1:1084:1:1338:1
spec=survival

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=potion_of_the_old_war
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/harpoon

# Executed every time the actor is available.
actions=auto_attack
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=old_war
actions+=/steel_trap
actions+=/explosive_trap
actions+=/dragonsfire_grenade
actions+=/caltrops
actions+=/carve,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies>=3&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)
actions+=/raptor_strike,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies<=2&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)|talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains<gcd.max|buff.moknathal_tactics.down)
actions+=/aspect_of_the_eagle
actions+=/fury_of_the_eagle,if=buff.mongoose_fury.up&(buff.mongoose_fury.stack=6|action.mongoose_bite.charges=0&cooldown.snake_hunter.remains|buff.mongoose_fury.remains<=gcd.max*2)
actions+=/mongoose_bite,if=buff.aspect_of_the_eagle.up&(charges>=2|charges>=1&cooldown.mongoose_bite.remains<=2)|(buff.mongoose_fury.up|cooldown.fury_of_the_eagle.remains<5|charges=3)
actions+=/a_murder_of_crows
actions+=/lacerate,if=dot.lacerate.ticking&dot.lacerate.remains<=3|target.time_to_die>=5
actions+=/snake_hunter,if=action.mongoose_bite.charges<=1&buff.mongoose_fury.remains>gcd.max*4|action.mongoose_bite.charges=0&buff.aspect_of_the_eagle.up
actions+=/flanking_strike,if=talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains>=3)|!talent.way_of_the_moknathal.enabled
actions+=/butchery,if=spell_targets.butchery>=2
actions+=/carve,if=spell_targets.carve>=4
actions+=/spitting_cobra
actions+=/throwing_axes
actions+=/raptor_strike,if=!talent.throwing_axes.enabled&focus>75-cooldown.flanking_strike.remains*focus.regen

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_claw
shoulders=matted_fur_pauldrons,id=139217,bonus_id=1806
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=call_of_the_wild,id=137101,bonus_id=1806
hands=gauntlets_of_malevolent_intent,id=139213,bonus_id=1806
waist=laughing_sisters_pouchchain,id=139211,bonus_id=1806
legs=disjointed_linkage_leggings,id=139216,bonus_id=1806
feet=malignant_sabatons,id=138211,bonus_id=1806
finger1=grubby_silver_ring,id=139236,bonus_id=1806,enchant=200vers
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=200vers
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=natures_call,id=139334,bonus_id=1806
main_hand=talonclaw,id=128808,gem_id=139262/139257/139255,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=881.73
# gear_agility=16240
# gear_stamina=25958
# gear_crit_rating=10204
# gear_haste_rating=4775
# gear_mastery_rating=2923
# gear_versatility_rating=1710
# gear_armor=2758
summon_pet=cat

Mage_Arcane_T19M : 441335 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
441335.3 441335.3 401.8 / 0.091% 69707.6 / 15.8% 8.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
48074.9 48074.9 Mana 0.02% 44.3 100.0% 100%
Talents
  • 15: Arcane Familiar (Arcane Mage)
  • 45: Rune of Power
  • 60: Supernova (Arcane Mage)
  • 90: Nether Tempest (Arcane Mage)
  • 100: Quickening (Arcane Mage)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mage_Arcane_T19M 441335
Aegwynn's Ascendance 3813 0.9% 3.3 98.52sec 345191 0 Direct 3.3 345191 0 345191 0.0%  

Stats details: aegwynns_ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 3.31 0.00 0.00 0.0000 0.0000 1143010.57 1143010.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.31 100.00% 345191.40 98031 373898 345420.49 253678 369786 1143011 1143011 0.00
 
 

Action details: aegwynns_ascendance

Static Values
  • id:187677
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187677
  • name:Aegwynn's Ascendance
  • school:arcane
  • tooltip:
  • description:An emanation of mana-fueled Arcane damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:332424.27
  • base_dd_max:332424.27
 
Arcane Barrage 10838 2.5% 9.8 27.24sec 333088 332291 Direct 9.7 262326 524731 334734 27.6%  

Stats details: arcane_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.79 9.74 0.00 0.00 1.0025 0.0000 3261763.66 3261763.66 0.00 332290.51 332290.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.06 72.41% 262325.55 250308 488100 262435.61 250308 372333 1850930 1850930 0.00
crit 2.69 27.59% 524730.80 500616 976201 497734.80 0 976201 1410833 1410833 0.00
 
 

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:5500.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:mana.pct<100&cooldown.arcane_power.remains>5
Spelldata
  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=1 + 130.0%} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge$?a231564[ Hits {$36032s3=0} additional $Ltarget:targets; within {$s3=10} yds per Arcane Charge for {$s2=50}% damage.][] |cFFFFFFFFConsumes all Arcane Charges.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Arcane Blast 155122 35.2% 96.5 3.11sec 482293 308975 Direct 97.5 374525 748254 477341 27.5%  

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.46 97.46 0.00 0.00 1.5610 0.0000 46520566.87 46520566.87 0.00 308975.37 308975.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.65 72.49% 374524.53 89411 696106 374753.08 305471 432160 26458237 26458237 0.00
crit 26.81 27.51% 748253.96 178821 1392213 748824.07 466679 1039484 20062330 20062330 0.00
 
 

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 192.4%} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Mana cost increased by {$36032s2=125}% per Arcane Charge. |cFFFFFFFFGenerates 1 Arcane Charge|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.924000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Arcane Explosion 2177 0.5% 2.5 69.72sec 259924 237608 Direct 2.5 204755 411177 259926 26.7%  

Stats details: arcane_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.51 2.51 0.00 0.00 1.0940 0.0000 652946.70 652946.70 0.00 237607.97 237607.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.84 73.28% 204754.65 144410 281600 181639.28 0 281600 376914 376914 0.00
crit 0.67 26.72% 411177.06 288821 563201 208560.13 0 563201 276032 276032 0.00
 
 

Action details: arcane_explosion

Static Values
  • id:1449
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1
Spelldata
  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s1=1 + 75.0%} Arcane damage to all enemies within $A1 yards. Damage increased by {$36032s1=60}% per Arcane Charge. Mana cost increased by {$36032s2=125}% per Arcane Charge. |cFFFFFFFFGenerates 1 Arcane Charge if any targets are hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Arcane Missiles 121166 27.5% 46.0 6.30sec 790669 501925 Periodic 274.7 103855 207662 132366 27.5% 20.3%

Stats details: arcane_missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.98 0.00 275.52 274.68 1.5753 0.2211 36358427.65 36358427.65 0.00 501924.79 501924.79
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.2 72.53% 103854.78 51393 160287 103913.42 91132 117392 20691447 20691447 0.00
crit 75.4 27.47% 207661.93 102787 320575 207774.58 179658 250316 15666980 15666980 0.00
 
 

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.arcane_missiles.react=3
Spelldata
  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing a total of ${5*{$7268s1=1 + 44.3%}} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Each damaging spell cast has a {$79684s1=15}% chance to activate Arcane Missiles. Chance doubled for Arcane Blast. Limit {$79683s1=3} charges. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing a total of ${5*{$7268s1=1 + 44.3%}} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Each damaging spell cast has a {$79684s1=15}% chance to activate Arcane Missiles. Chance doubled for Arcane Blast. Limit {$79683s1=3} charges. |cFFFFFFFFGenerates 1 Arcane Charge.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.443000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 21498 4.8% 39.3 5.94sec 161584 0 Direct 39.3 126699 253487 161586 27.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.32 39.32 0.00 0.00 0.0000 0.0000 6353043.24 6353043.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.50 72.49% 126699.47 84248 164284 126651.48 107416 142786 3610827 3610827 0.00
crit 10.82 27.51% 253486.59 168496 328567 253453.49 168496 328567 2742216 2742216 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of Aluneth 9842 2.2% 5.2 62.24sec 563125 401990 Periodic 31.0 74463 148663 94862 27.5% 10.3%

Stats details: mark_of_aluneth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.22 0.00 31.00 31.00 1.4009 1.0000 2940957.18 2940957.18 0.00 76751.32 401989.77
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.5 72.51% 74463.34 52609 102588 74893.01 59874 90604 1673915 1673915 0.00
crit 8.5 27.49% 148663.40 105218 205175 149542.74 105218 205175 1267042 1267042 0.00
 
 

Action details: mark_of_aluneth

Static Values
  • id:224968
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.arcane_power.remains>20
Spelldata
  • id:224968
  • name:Mark of Aluneth
  • school:arcane
  • tooltip:Deals continuous Arcane damage, and then detonates for massive damage to nearby enemies.
  • description:Creates a rune around the target, inflicting ${{$211088s1=0 + 120.0%}*6} Arcane damage over {$d=6 seconds}, and then detonating for Arcane damage equal to {$s1=15}% of your maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mark of Aluneth (_explosion) 9085 2.0% 5.2 62.18sec 519054 0 Direct 5.2 407858 817251 519073 27.2%  

Stats details: mark_of_aluneth_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.22 5.22 0.00 0.00 0.0000 0.0000 2710789.73 2710789.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.80 72.84% 407857.68 262874 512604 409414.82 0 512604 1551494 1551494 0.00
crit 1.42 27.16% 817250.90 525748 1025208 657414.73 0 1025208 1159295 1159295 0.00
 
 

Action details: mark_of_aluneth_explosion

Static Values
  • id:210726
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210726
  • name:Mark of Aluneth
  • school:physical
  • tooltip:
  • description:Creates a runic prison at the target's location, slowing enemy movement speed by ${{$211056s1=70}/-1}%, inflicting ${{$211088s1=0 + 120.0%}*6} Arcane damage over {$d=6 seconds}, and then detonating for Arcane damage equal to {$s1=15}% of your maximum mana.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:235274.82
  • base_dd_max:235274.82
 
Mark of the Hidden Satyr 10454 2.4% 21.2 14.04sec 147652 0 Direct 21.2 115935 231181 147653 27.5%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.23 21.23 0.00 0.00 0.0000 0.0000 3134717.54 3134717.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.39 72.48% 115934.55 94426 184131 115940.73 94426 156983 1783893 1783893 0.00
crit 5.84 27.52% 231181.40 188852 368262 230624.21 0 368262 1350825 1350825 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Nether Tempest 21290 (42587) 4.8% (9.7%) 25.8 11.61sec 495200 484535 Periodic 421.9 11875 23754 15142 27.5% 94.1%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.81 0.00 421.86 421.86 1.0220 0.6707 6388029.99 6388029.99 0.00 41312.80 484534.88
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 305.8 72.49% 11874.57 12 18781 11879.31 11391 12340 3631370 3631370 0.00
crit 116.1 27.51% 23753.80 24 37563 23765.53 21920 26277 2756660 2756660 0.00
 
 

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:16500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.nether_tempest.remains<=2|!ticking
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals $w1 Arcane damage and an additional $w1 Arcane damage to all enemies within $114954A1 yards every $t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over {$114923d=12 seconds} to the target and ${$114954m1*12/$t1} to all enemies within 10 yards. Limit 1 target. Damage increased by {$36032s1=60}% per Arcane Charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.055000
  • base_td:1.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Nether Tempest (_aoe) 21297 4.8% 421.9 0.70sec 15150 0 Periodic 420.0 11938 23875 15216 27.5% 0.0%

Stats details: nether_tempest_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 421.86 0.00 0.00 420.03 0.0000 0.0000 6391092.82 6391092.82 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 304.7 72.54% 11938.48 9632 18781 11943.39 11444 12612 3637723 3637723 0.00
crit 115.3 27.46% 23875.32 19263 37563 23885.40 21861 26437 2753370 2753370 0.00
 
 

Action details: nether_tempest_aoe

Static Values
  • id:114954
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:1.2500
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114954
  • name:Nether Tempest
  • school:arcane
  • tooltip:
  • description:{$@spelldesc114923=Places a Nether Tempest on the target which deals $114923o1 Arcane damage over {$114923d=12 seconds} to the target and ${$114954m1*12/$t1} to all enemies within 10 yards. Limit 1 target. Damage increased by {$36032s1=60}% per Arcane Charge.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.055000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Plague Swarm 16969 3.8% 17.0 17.43sec 300385 0 Periodic 72.1 55404 110736 70631 27.5% 47.0%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.95 0.00 72.11 72.11 0.0000 1.9593 5092766.93 5092766.93 0.00 36048.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.3 72.48% 55403.75 23 90679 55454.27 45852 67650 2895565 2895565 0.00
crit 19.8 27.52% 110736.44 47 181359 110842.18 86215 147146 2197202 2197202 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Supernova 7620 1.7% 9.4 31.11sec 242951 239789 Direct 9.4 190746 380313 242952 27.5%  

Stats details: supernova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.44 9.44 0.00 0.00 1.0133 0.0000 2293343.60 2293343.60 0.00 239789.17 239789.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.84 72.46% 190745.59 166597 324865 190606.63 166597 263779 1304625 1304625 0.00
crit 2.60 27.54% 380312.65 333195 649730 358956.38 0 649730 988718 988718 0.00
 
 

Action details: supernova

Static Values
  • id:157980
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:mana.pct<100
Spelldata
  • id:157980
  • name:Supernova
  • school:arcane
  • tooltip:
  • description:Pulses arcane energy around the target enemy or ally, dealing {$s2=1 + 190.0%} Arcane damage to all enemies within $A2 yards, and knocking them upward. A primary enemy target will take {$s1=100}% increased damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.900000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 7386 1.7% 12.7 22.92sec 174932 0 Direct 87.1 19978 39985 25453 27.4%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.67 87.11 0.00 0.00 0.0000 0.0000 2217199.05 2217199.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.27 72.63% 19977.80 16335 31853 19977.83 16335 26898 1264030 1264030 0.00
crit 23.84 27.37% 39985.25 32670 63706 39989.00 32670 57989 953170 953170 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Touch of the Magi 12203 2.8% 8.3 33.98sec 441006 0 Direct 8.3 441506 0 441506 0.0%  

Stats details: touch_of_the_magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.29 8.28 0.00 0.00 0.0000 0.0000 3655544.97 3655544.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.28 100.00% 441506.06 1681 2169679 443665.69 155806 998744 3655545 3655545 0.00
 
 

Action details: touch_of_the_magi

Static Values
  • id:210833
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating {$s1=20}% of the damage you deal to the target for {$210824d=6 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:187921.85
  • base_dd_max:187921.85
 
pet - arcane_familiar 10575 / 10575
Arcane Assault 10575 2.4% 148.2 2.04sec 21416 0 Direct 147.6 16869 33733 21503 27.5%  

Stats details: arcane_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.19 147.59 0.00 0.00 0.0000 0.0000 3173525.75 3173525.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.04 72.52% 16869.19 14614 21920 16873.23 16075 17731 1805625 1805625 0.00
crit 40.55 27.48% 33733.43 29227 43841 33740.97 30201 37823 1367901 1367901 0.00
 
 

Action details: arcane_assault

Static Values
  • id:205235
  • school:arcane
  • resource:none
  • range:45.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205235
  • name:Arcane Assault
  • school:arcane
  • tooltip:
  • description:{$@spelldesc225119=Launches bolts of arcane energy at the enemy target, causing {$s1=1 + 35.0%} Arcane damage. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Mage_Arcane_T19M
Arcane Power 3.6 93.16sec

Stats details: arcane_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. Mana costs of your damaging spells reduced by $w2%.
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage and your spells cost {$s2=30}% less mana.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Arcane_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.24sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Evocation 3.3 98.08sec

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 0.00 13.16 0.00 3.7221 0.8732 0.00 0.00 0.00 0.00 0.00
 
 

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana every $t1 sec.
  • description:Returns ${4*$m1}% of your total mana over {$d=6 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Arcane_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Arcane_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.7 35.30sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.72 0.00 0.00 0.00 1.0131 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct>45&buff.arcane_power.down
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 
(summon_) Arcane Familiar 1.0 0.00sec

Stats details: summon_arcane_familiar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_arcane_familiar

Static Values
  • id:205022
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205022
  • name:Arcane Familiar
  • school:arcane
  • tooltip:
  • description:Summon a Familiar that attacks your enemies and increases your maximum mana by {$210126s1=10}%. Lasts {$d=3600 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcane Charge 10.7 135.3 28.3sec 2.1sec 90.72% 89.33% 103.6(103.6) 0.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_charge_1:6.57%
  • arcane_charge_2:6.27%
  • arcane_charge_3:6.13%
  • arcane_charge_4:71.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Missiles! 26.6 21.3 11.3sec 6.3sec 47.39% 47.39% 0.9(0.9) 0.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_arcane_missiles
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_missiles_1:32.17%
  • arcane_missiles_2:12.93%
  • arcane_missiles_3:2.28%

Trigger Attempt Success

  • trigger_pct:33.13%

Spelldata details

  • id:79683
  • name:Arcane Missiles!
  • tooltip:Arcane Missiles activated.
  • description:Your offensive spells have a chance to activate Arcane Missiles. This effect can accumulate up to {$79683s1=3} charges and lasts {$79683d=20 seconds}.
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 93.2sec 93.2sec 15.40% 100.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • duration:13.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_power_1:15.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. Mana costs of your damaging spells reduced by $w2%.
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage and your spells cost {$s2=30}% less mana.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.2sec 187.2sec 6.77% 10.95% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 17.56% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 194.8sec 0.0sec 19.62% 19.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Quickening 11.3 134.7 27.0sec 2.1sec 90.45% 90.45% 0.0(0.0) 0.6

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_quickening
  • max_stacks:50
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • quickening_1:6.99%
  • quickening_2:6.72%
  • quickening_3:6.34%
  • quickening_4:5.97%
  • quickening_5:8.59%
  • quickening_6:7.63%
  • quickening_7:5.74%
  • quickening_8:4.06%
  • quickening_9:3.66%
  • quickening_10:3.13%
  • quickening_11:2.75%
  • quickening_12:2.62%
  • quickening_13:2.47%
  • quickening_14:2.36%
  • quickening_15:2.46%
  • quickening_16:2.30%
  • quickening_17:2.10%
  • quickening_18:2.06%
  • quickening_19:1.97%
  • quickening_20:2.01%
  • quickening_21:1.76%
  • quickening_22:1.62%
  • quickening_23:1.20%
  • quickening_24:0.91%
  • quickening_25:0.69%
  • quickening_26:0.51%
  • quickening_27:0.38%
  • quickening_28:0.30%
  • quickening_29:0.23%
  • quickening_30:0.19%
  • quickening_31:0.15%
  • quickening_32:0.12%
  • quickening_33:0.11%
  • quickening_34:0.10%
  • quickening_35:0.08%
  • quickening_36:0.06%
  • quickening_37:0.05%
  • quickening_38:0.04%
  • quickening_39:0.02%
  • quickening_40:0.01%
  • quickening_41:0.01%
  • quickening_42:0.00%
  • quickening_43:0.00%
  • quickening_44:0.00%
  • quickening_45:0.00%
  • quickening_46:0.00%
  • quickening_47:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198924
  • name:Quickening
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc198923=Arcane Blast, Arcane Missiles, and Arcane Explosion also grant {$198924s1=2}% Haste for {$198924d=6 seconds}, stacking up to {$198924u=50} times. This effect is cleared when you cast Arcane Barrage.}
  • max_stacks:50
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Rune of Power 8.7 0.0 35.3sec 35.3sec 28.67% 28.67% 0.0(0.0) 8.5

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mage Armor

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_mage_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:1250.00

Stack Uptimes

  • mage_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:6117
  • name:Mage Armor
  • tooltip:Mastery increased by $6117w1. Duration of all harmful Magic effects reduced by $w2%.
  • description:Increases your Mastery by {$6117s1=1250}. The duration of all harmful Magic effects used against you is reduced by {$s2=25}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Arcane_T19M
arcane_barrage Mana 9.8 53616.2 5475.2 5475.2 60.8
arcane_blast Mana 97.5 13671800.0 140285.6 141739.9 3.4
arcane_explosion Mana 2.5 316196.4 125877.8 125870.9 2.1
nether_tempest Mana 25.8 407582.1 15794.2 15794.1 31.4
Resource Gains Type Count Total Average Overflow
arcane_blast None 97.46 0.00 (0.00%) 0.00 97.46 100.00%
arcane_explosion None 2.51 0.00 (0.00%) 0.00 2.51 100.00%
evocation Mana 13.16 4571933.71 (34.35%) 347345.08 589412.23 11.42%
mp5_regen Mana 1150.70 6279347.90 (47.18%) 5456.97 148950.90 2.32%
Mystic Kilt of the Rune Master Mana 9.79 2457539.23 (18.47%) 250959.81 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 44282.16 48074.90
Combat End Resource Mean Min Max
Mana 375960.37 14834.91 1378784.00

Benefits & Uptimes

Benefits %
Arcane Barrage Arcane Charge 4 100.0%
Arcane Blast Arcane Charge 0 10.7%
Arcane Blast Arcane Charge 1 10.6%
Arcane Blast Arcane Charge 2 10.5%
Arcane Blast Arcane Charge 3 10.2%
Arcane Blast Arcane Charge 4 58.0%
Arcane Missiles Arcane Charge 2 0.0%
Arcane Missiles Arcane Charge 3 0.7%
Arcane Missiles Arcane Charge 4 99.3%
Nether Tempest Arcane Charge 0 8.3%
Nether Tempest Arcane Charge 1 5.4%
Nether Tempest Arcane Charge 2 4.5%
Nether Tempest Arcane Charge 3 3.7%
Nether Tempest Arcane Charge 4 78.0%
Arcane Missiles! from Arcane Blast 81.6%
Arcane Missiles! from Arcane Explosion 1.1%
Arcane Missiles! from Nether Tempest 9.4%
Arcane Missiles! from Supernova 3.9%
Arcane Missiles! from Arcane Barrage 4.1%
Uptimes %
Mana Cap 1.7%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Mage_Arcane_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Mage_Arcane_T19M Damage Per Second
Count 7499
Mean 441335.32
Minimum 385486.88
Maximum 509525.81
Spread ( max - min ) 124038.93
Range [ ( max - min ) / 2 * 100% ] 14.05%
Standard Deviation 17753.5674
5th Percentile 413964.08
95th Percentile 472143.47
( 95th Percentile - 5th Percentile ) 58179.40
Mean Distribution
Standard Deviation 205.0142
95.00% Confidence Intervall ( 440933.50 - 441737.14 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6216
0.1 Scale Factor Error with Delta=300 2690635
0.05 Scale Factor Error with Delta=300 10762543
0.01 Scale Factor Error with Delta=300 269063591
Priority Target DPS
Sample Data Mage_Arcane_T19M Priority Target Damage Per Second
Count 7499
Mean 441335.32
Minimum 385486.88
Maximum 509525.81
Spread ( max - min ) 124038.93
Range [ ( max - min ) / 2 * 100% ] 14.05%
Standard Deviation 17753.5674
5th Percentile 413964.08
95th Percentile 472143.47
( 95th Percentile - 5th Percentile ) 58179.40
Mean Distribution
Standard Deviation 205.0142
95.00% Confidence Intervall ( 440933.50 - 441737.14 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6216
0.1 Scale Factor Error with Delta=300 2690635
0.05 Scale Factor Error with Delta=300 10762543
0.01 Scale Factor Error with Delta=300 269063591
DPS(e)
Sample Data Mage_Arcane_T19M Damage Per Second (Effective)
Count 7499
Mean 441335.32
Minimum 385486.88
Maximum 509525.81
Spread ( max - min ) 124038.93
Range [ ( max - min ) / 2 * 100% ] 14.05%
Damage
Sample Data Mage_Arcane_T19M Damage
Count 7499
Mean 129114200.51
Minimum 95187629.71
Maximum 167017479.08
Spread ( max - min ) 71829849.37
Range [ ( max - min ) / 2 * 100% ] 27.82%
DTPS
Sample Data Mage_Arcane_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mage_Arcane_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mage_Arcane_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mage_Arcane_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mage_Arcane_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mage_Arcane_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Mage_Arcane_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mage_Arcane_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 summon_arcane_familiar
4 0.00 snapshot_stats
5 0.00 mirror_image
6 0.00 potion,name=deadly_grace
7 0.00 arcane_blast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.arcane_power.down
8 3.27 stop_burn_phase,if=prev_gcd.evocation&burn_phase_duration>gcd.max
9 3.25 mark_of_aluneth,if=cooldown.arcane_power.remains>20
A 0.00 call_action_list,name=build,if=buff.arcane_charge.stack<4
B 0.00 call_action_list,name=init_burn,if=buff.arcane_power.down&buff.arcane_charge.stack=4&(cooldown.mark_of_aluneth.remains=0|cooldown.mark_of_aluneth.remains>20)&(!talent.rune_of_power.enabled|(cooldown.arcane_power.remains<=action.rune_of_power.cast_time|action.rune_of_power.recharge_time<cooldown.arcane_power.remains))|target.time_to_die<45
C 0.00 call_action_list,name=burn,if=burn_phase
D 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&!burn_phase
E 0.00 call_action_list,name=conserve
actions.build
# count action,conditions
0.00 charged_up,if=buff.arcane_charge.stack<=1
F 0.32 arcane_missiles,if=buff.arcane_missiles.react=3
0.00 arcane_orb
0.00 arcane_explosion,if=active_enemies>1
G 41.30 arcane_blast
actions.burn
# count action,conditions
H 0.00 call_action_list,name=cooldowns
I 1.57 arcane_missiles,if=buff.arcane_missiles.react=3
J 1.11 arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
0.00 presence_of_mind,if=buff.arcane_power.remains>2*gcd
K 6.36 nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
L 1.66 arcane_blast,if=active_enemies<=1&mana.pct%10*execute_time>target.time_to_die
0.00 arcane_explosion,if=active_enemies>1&mana.pct%10*execute_time>target.time_to_die
M 10.48 arcane_missiles,if=buff.arcane_missiles.react>1
0.00 arcane_explosion,if=active_enemies>1&buff.arcane_power.remains>cast_time
N 21.01 arcane_blast,if=buff.presence_of_mind.up|buff.arcane_power.remains>cast_time
O 4.62 supernova,if=mana.pct<100
P 10.22 arcane_missiles,if=mana.pct>10&(talent.overpowered.enabled|buff.arcane_power.down)
0.00 arcane_explosion,if=active_enemies>1
Q 17.39 arcane_blast
R 3.31 evocation,interrupt_if=mana.pct>99
actions.conserve
# count action,conditions
S 1.70 arcane_missiles,if=buff.arcane_missiles.react=3
T 0.50 arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
U 1.11 arcane_blast,if=mana.pct>99
V 10.55 nether_tempest,if=(refreshable|!ticking)
0.00 arcane_blast,if=buff.rhonins_assaulting_armwraps.up&equipped.132413
W 17.00 arcane_missiles
X 4.82 supernova,if=mana.pct<100
0.00 frost_nova,if=equipped.132452
0.00 arcane_explosion,if=mana.pct>=82&equipped.132451&active_enemies>1
Y 5.85 arcane_blast,if=mana.pct>=82&equipped.132451
Z 9.41 arcane_barrage,if=mana.pct<100&cooldown.arcane_power.remains>5
0.00 arcane_explosion,if=active_enemies>1
a 1.18 arcane_blast
actions.cooldowns
# count action,conditions
b 0.12 rune_of_power,if=mana.pct>45&buff.arcane_power.down
c 3.60 arcane_power
0.00 blood_fury
d 2.00 berserking
0.00 arcane_torrent
e 1.00 potion,name=deadly_grace,if=buff.arcane_power.up&(buff.berserking.up|buff.blood_fury.up)
actions.init_burn
# count action,conditions
f 2.00 mark_of_aluneth
0.00 frost_nova,if=equipped.132452
g 8.43 nether_tempest,if=dot.nether_tempest.remains<10&(prev_gcd.mark_of_aluneth|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<gcd.max))
h 8.63 rune_of_power
i 4.26 start_burn_phase,if=((cooldown.evocation.remains-(2*burn_phase_duration))%2<burn_phase_duration)|cooldown.arcane_power.remains=0|target.time_to_die<55
actions.rop_phase
# count action,conditions
j 0.19 arcane_missiles,if=buff.arcane_missiles.react=3
k 0.91 arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
l 0.47 nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
m 4.50 arcane_missiles,if=buff.arcane_charge.stack=4
0.00 arcane_explosion,if=active_enemies>1
n 7.51 arcane_blast,if=mana.pct>45
o 0.38 arcane_barrage

Sample Sequence

012367GGGfghicdNNMNNMMNKMNOQghMPQQPQR8mUVYZGGGGZGGGGVWWXYZGGG9GghjmmnnlnXZGGGGVWWghicNNNNNMMNKOPQPQPQKQR89ghknnmnnXVWZGGGGVSWWZGGGGVWWXZGGGGVWWWYfghicdeNNMMNNMNKMhOPQPQPQKPQPQQR8UVSWWXYYZGGGGVWZGG9GGghiOQQPQKMPQPQQQKPQcNghONWWZ

Sample Sequence Table

time name target resources buffs
Pre flask Mage_Arcane_T19M 1425908.0/1425908: 100% mana
Pre food Mage_Arcane_T19M 1425908.0/1425908: 100% mana
Pre augmentation Mage_Arcane_T19M 1425908.0/1425908: 100% mana
Pre summon_arcane_familiar Fluffy_Pillow 1568498.8/1568499: 100% mana
Pre potion Fluffy_Pillow 1568498.8/1568499: 100% mana potion_of_deadly_grace
0:00.000 arcane_blast Fluffy_Pillow 1535498.8/1568499: 98% mana arcane_missiles, quickening, potion_of_deadly_grace
0:00.000 arcane_blast Fluffy_Pillow 1535498.8/1568499: 98% mana arcane_missiles, quickening, potion_of_deadly_grace
0:01.846 arcane_blast Fluffy_Pillow 1494398.5/1568499: 95% mana bloodlust, arcane_missiles, quickening(2), potion_of_deadly_grace
0:03.239 arcane_blast Fluffy_Pillow 1408692.9/1568499: 90% mana bloodlust, arcane_missiles, quickening(3), potion_of_deadly_grace
0:04.603 mark_of_aluneth Fluffy_Pillow 1281116.9/1568499: 82% mana bloodlust, arcane_missiles, quickening(4), potion_of_deadly_grace
0:05.797 nether_tempest Fluffy_Pillow 1306655.0/1568499: 83% mana bloodlust, arcane_missiles, quickening(4), potion_of_deadly_grace
0:06.693 rune_of_power Fluffy_Pillow 1309319.2/1568499: 83% mana bloodlust, arcane_missiles, quickening(4), potion_of_deadly_grace
0:07.589 start_burn_phase Fluffy_Pillow 1328483.4/1568499: 85% mana bloodlust, arcane_missiles, quickening(4), rune_of_power, potion_of_deadly_grace
0:07.589 arcane_power Fluffy_Pillow 1328483.4/1568499: 85% mana bloodlust, arcane_missiles, quickening(4), rune_of_power, potion_of_deadly_grace
0:07.589 berserking Fluffy_Pillow 1328483.4/1568499: 85% mana bloodlust, arcane_missiles, arcane_power, quickening(4), rune_of_power, potion_of_deadly_grace
0:07.589 arcane_blast Fluffy_Pillow 1328483.4/1568499: 85% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(4), rune_of_power, potion_of_deadly_grace
0:08.754 arcane_blast Fluffy_Pillow 1214801.1/1568499: 77% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(5), rune_of_power, potion_of_deadly_grace
0:09.898 arcane_missiles Fluffy_Pillow 1100669.7/1568499: 70% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(6), rune_of_power, potion_of_deadly_grace
0:11.129 arcane_blast Fluffy_Pillow 1126999.1/1568499: 72% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(7), rune_of_power, potion_of_deadly_grace
0:12.235 arcane_blast Fluffy_Pillow 1012054.9/1568499: 65% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(8), rune_of_power, potion_of_deadly_grace
0:13.323 arcane_missiles Fluffy_Pillow 896725.7/1568499: 57% mana bloodlust, berserking, arcane_missiles(3), arcane_power, quickening(9), rune_of_power, potion_of_deadly_grace
0:14.503 arcane_missiles Fluffy_Pillow 921964.3/1568499: 59% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(10), rune_of_power, potion_of_deadly_grace
0:15.673 arcane_blast Fluffy_Pillow 946989.0/1568499: 60% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(11), rune_of_power, potion_of_deadly_grace
0:16.706 nether_tempest Fluffy_Pillow 830483.4/1568499: 53% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(12), rune_of_power, potion_of_deadly_grace
0:17.461 arcane_missiles Fluffy_Pillow 835081.8/1568499: 53% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(12), rune_of_power, potion_of_deadly_grace
0:18.568 arcane_blast Fluffy_Pillow 858759.0/1568499: 55% mana bloodlust, arcane_missiles, arcane_power, quickening(13), potion_of_deadly_grace
0:19.716 supernova Fluffy_Pillow 744713.2/1568499: 47% mana bloodlust, arcane_missiles(2), arcane_power, quickening(14), potion_of_deadly_grace
0:20.472 arcane_blast Fluffy_Pillow 760883.0/1568499: 49% mana bloodlust, arcane_missiles(2), arcane_power, quickening(14), potion_of_deadly_grace
0:21.605 nether_tempest Fluffy_Pillow 587116.3/1568499: 37% mana bloodlust, arcane_missiles(2), quickening(15), potion_of_deadly_grace
0:22.362 rune_of_power Fluffy_Pillow 586807.4/1568499: 37% mana bloodlust, arcane_missiles(2), quickening(15), potion_of_deadly_grace
0:23.116 arcane_missiles Fluffy_Pillow 602934.5/1568499: 38% mana bloodlust, arcane_missiles(2), quickening(15), rune_of_power, potion_of_deadly_grace
0:24.289 arcane_missiles Fluffy_Pillow 628023.3/1568499: 40% mana bloodlust, arcane_missiles, quickening(16), rune_of_power, potion_of_deadly_grace
0:25.477 arcane_blast Fluffy_Pillow 653433.0/1568499: 42% mana bloodlust, quickening(17), rune_of_power, potion_of_deadly_grace
0:26.558 arcane_blast Fluffy_Pillow 478554.1/1568499: 31% mana bloodlust, quickening(18), rune_of_power, potion_of_deadly_grace
0:27.624 arcane_missiles Fluffy_Pillow 303354.4/1568499: 19% mana bloodlust, arcane_missiles, quickening(19), rune_of_power, potion_of_deadly_grace
0:28.657 arcane_blast Fluffy_Pillow 325448.8/1568499: 21% mana bloodlust, quickening(20), rune_of_power
0:29.693 evocation Fluffy_Pillow 149607.4/1568499: 10% mana bloodlust, arcane_missiles, quickening(21), rune_of_power
0:32.645 stop_burn_phase Fluffy_Pillow 1568498.8/1568499: 100% mana bloodlust, arcane_missiles, quickening(21), rune_of_power
0:32.645 arcane_missiles Fluffy_Pillow 1568498.8/1568499: 100% mana bloodlust, arcane_missiles, quickening(21), rune_of_power
0:33.786 arcane_blast Fluffy_Pillow 1568498.8/1568499: 100% mana bloodlust, quickening(22)
0:34.792 nether_tempest Fluffy_Pillow 1370584.4/1568499: 87% mana bloodlust, quickening(23)
0:35.546 arcane_blast Fluffy_Pillow 1370211.4/1568499: 87% mana bloodlust, quickening(23)
0:36.538 arcane_barrage Fluffy_Pillow 1193428.9/1568499: 76% mana bloodlust, quickening(24)
0:37.292 arcane_blast Fluffy_Pillow 1455015.7/1568499: 93% mana bloodlust
0:38.741 arcane_blast Fluffy_Pillow 1453007.8/1568499: 93% mana bloodlust, arcane_charge, quickening
0:40.160 arcane_blast Fluffy_Pillow 1409108.3/1568499: 90% mana arcane_charge(2), quickening(2)
0:41.968 arcane_blast Fluffy_Pillow 1332278.9/1568499: 85% mana arcane_charge(3), quickening(3)
0:43.742 arcane_barrage Fluffy_Pillow 1213472.3/1568499: 77% mana arcane_charge(4), quickening(4)
0:44.905 arcane_blast Fluffy_Pillow 1483807.1/1568499: 95% mana
0:46.785 arcane_blast Fluffy_Pillow 1491017.7/1568499: 95% mana arcane_charge, quickening
0:48.627 arcane_blast Fluffy_Pillow 1456165.5/1568499: 93% mana arcane_charge(2), quickening(2)
0:50.434 arcane_blast Fluffy_Pillow 1379314.8/1568499: 88% mana arcane_charge(3), arcane_missiles, quickening(3)
0:52.209 nether_tempest Fluffy_Pillow 1260529.6/1568499: 80% mana arcane_charge(4), arcane_missiles(2), quickening(4)
0:53.373 arcane_missiles Fluffy_Pillow 1268925.9/1568499: 81% mana arcane_charge(4), arcane_missiles(2), quickening(4)
0:55.146 arcane_missiles Fluffy_Pillow 1306847.9/1568499: 83% mana arcane_charge(4), arcane_missiles, quickening(5)
0:56.902 supernova Fluffy_Pillow 1344406.4/1568499: 86% mana arcane_charge(4), quickening(6)
0:58.025 arcane_blast Fluffy_Pillow 1368425.8/1568499: 87% mana arcane_charge(4), quickening(6)
0:59.705 arcane_barrage Fluffy_Pillow 1206358.7/1568499: 77% mana arcane_charge(4), quickening(7)
1:00.806 arcane_blast Fluffy_Pillow 1475367.3/1568499: 94% mana
1:02.686 arcane_blast Fluffy_Pillow 1482577.9/1568499: 95% mana arcane_charge, arcane_missiles, quickening
1:04.531 arcane_blast Fluffy_Pillow 1447789.9/1568499: 92% mana arcane_charge(2), arcane_missiles, quickening(2)
1:06.340 mark_of_aluneth Fluffy_Pillow 1370982.0/1568499: 87% mana arcane_charge(3), arcane_missiles(2), quickening(3)
1:07.917 arcane_blast Fluffy_Pillow 1404711.8/1568499: 90% mana arcane_charge(3), arcane_missiles(2), quickening(3)
1:09.690 nether_tempest Fluffy_Pillow 1285883.8/1568499: 82% mana arcane_charge(4), arcane_missiles(3), quickening(4)
1:10.853 rune_of_power Fluffy_Pillow 1294258.8/1568499: 83% mana arcane_charge(4), arcane_missiles(3), quickening(4)
1:12.015 arcane_missiles Fluffy_Pillow 1319112.4/1568499: 84% mana arcane_charge(4), arcane_missiles(3), quickening(4), rune_of_power
1:13.943 arcane_missiles Fluffy_Pillow 1360349.6/1568499: 87% mana arcane_charge(4), arcane_missiles(2), quickening(5), rune_of_power
1:15.787 arcane_missiles Fluffy_Pillow 1399790.3/1568499: 89% mana arcane_charge(4), arcane_missiles, quickening(6), rune_of_power
1:17.534 arcane_blast Fluffy_Pillow 1437156.2/1568499: 92% mana arcane_charge(4), quickening(7), rune_of_power
1:19.185 arcane_blast Fluffy_Pillow 1274468.8/1568499: 81% mana arcane_charge(4), quickening(8), rune_of_power
1:20.807 nether_tempest Fluffy_Pillow 1111161.1/1568499: 71% mana arcane_charge(4), quickening(9), rune_of_power
1:21.873 arcane_blast Fluffy_Pillow 1117461.4/1568499: 71% mana arcane_charge(4), quickening(9), rune_of_power
1:23.469 supernova Fluffy_Pillow 953597.6/1568499: 61% mana arcane_charge(4), quickening(10)
1:24.515 arcane_barrage Fluffy_Pillow 975970.1/1568499: 62% mana arcane_charge(4), quickening(10)
1:25.562 arcane_blast Fluffy_Pillow 1243823.8/1568499: 79% mana
1:27.441 arcane_blast Fluffy_Pillow 1251013.0/1568499: 80% mana arcane_charge, quickening
1:29.285 arcane_blast Fluffy_Pillow 1216203.7/1568499: 78% mana arcane_charge(2), quickening(2)
1:31.093 arcane_blast Fluffy_Pillow 1139374.3/1568499: 73% mana arcane_charge(3), arcane_missiles, quickening(3)
1:32.867 nether_tempest Fluffy_Pillow 1020567.7/1568499: 65% mana arcane_charge(4), arcane_missiles(2), quickening(4)
1:34.030 arcane_missiles Fluffy_Pillow 1028942.7/1568499: 66% mana arcane_charge(4), arcane_missiles(2), quickening(4)
1:35.878 arcane_missiles Fluffy_Pillow 1068468.8/1568499: 68% mana arcane_charge(4), arcane_missiles, quickening(5)
1:37.574 nether_tempest Fluffy_Pillow 1104743.9/1568499: 70% mana arcane_charge(4), quickening(6)
1:38.695 rune_of_power Fluffy_Pillow 1112220.6/1568499: 71% mana arcane_charge(4), quickening(6)
1:39.815 start_burn_phase Fluffy_Pillow 1136175.8/1568499: 72% mana arcane_charge(4), quickening(6), rune_of_power
1:39.815 arcane_power Fluffy_Pillow 1136175.8/1568499: 72% mana arcane_charge(4), quickening(6), rune_of_power
1:39.815 arcane_blast Fluffy_Pillow 1136175.8/1568499: 72% mana arcane_charge(4), arcane_power, quickening(6), rune_of_power
1:41.495 arcane_blast Fluffy_Pillow 1033508.7/1568499: 66% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(7), rune_of_power
1:43.146 arcane_blast Fluffy_Pillow 930221.3/1568499: 59% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(8), rune_of_power
1:44.768 arcane_blast Fluffy_Pillow 826313.7/1568499: 53% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(9), rune_of_power
1:46.362 arcane_blast Fluffy_Pillow 721807.1/1568499: 46% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(10), rune_of_power
1:47.929 arcane_missiles Fluffy_Pillow 616723.1/1568499: 39% mana arcane_charge(4), arcane_missiles(3), arcane_power, quickening(11), rune_of_power
1:49.510 arcane_missiles Fluffy_Pillow 650538.5/1568499: 41% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(12), rune_of_power
1:51.012 arcane_blast Fluffy_Pillow 682664.2/1568499: 44% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(13)
1:52.506 nether_tempest Fluffy_Pillow 576018.8/1568499: 37% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(14)
1:53.488 supernova Fluffy_Pillow 585472.4/1568499: 37% mana arcane_charge(4), arcane_missiles, quickening(14)
1:54.470 arcane_missiles Fluffy_Pillow 606476.1/1568499: 39% mana arcane_charge(4), arcane_missiles, quickening(14)
1:56.054 arcane_blast Fluffy_Pillow 640355.6/1568499: 41% mana arcane_charge(4), quickening(15)
1:57.501 arcane_missiles Fluffy_Pillow 473305.0/1568499: 30% mana arcane_charge(4), arcane_missiles, quickening(16)
1:59.022 arcane_blast Fluffy_Pillow 505837.0/1568499: 32% mana arcane_charge(4), quickening(17)
2:00.428 arcane_missiles Fluffy_Pillow 337909.4/1568499: 22% mana arcane_charge(4), arcane_missiles, quickening(18)
2:01.939 arcane_blast Fluffy_Pillow 370227.7/1568499: 24% mana arcane_charge(4), quickening(19)
2:03.302 nether_tempest Fluffy_Pillow 201380.3/1568499: 13% mana arcane_charge(4), quickening(20)
2:04.201 arcane_blast Fluffy_Pillow 204108.7/1568499: 13% mana arcane_charge(4), quickening(20)
2:05.546 evocation Fluffy_Pillow 34876.4/1568499: 2% mana arcane_charge(4), quickening(21)
2:09.316 stop_burn_phase Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), quickening(21)
2:09.316 mark_of_aluneth Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), quickening(21)
2:10.494 nether_tempest Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), quickening(21)
2:11.381 rune_of_power Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), quickening(21)
2:12.266 arcane_explosion Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), rune_of_power
2:13.522 arcane_blast Fluffy_Pillow 1463362.9/1568499: 93% mana arcane_charge(4), quickening, rune_of_power
2:15.365 arcane_blast Fluffy_Pillow 1304782.1/1568499: 83% mana arcane_charge(4), quickening(2), rune_of_power
2:17.173 arcane_missiles Fluffy_Pillow 1145452.8/1568499: 73% mana arcane_charge(4), arcane_missiles, quickening(3), rune_of_power
2:18.973 arcane_blast Fluffy_Pillow 1183952.3/1568499: 75% mana arcane_charge(4), quickening(4), rune_of_power
2:20.715 arcane_blast Fluffy_Pillow 1023211.3/1568499: 65% mana arcane_charge(4), quickening(5), rune_of_power
2:22.426 supernova Fluffy_Pillow 861807.2/1568499: 55% mana arcane_charge(4), quickening(6)
2:23.548 nether_tempest Fluffy_Pillow 885805.2/1568499: 56% mana arcane_charge(4), quickening(6)
2:24.671 arcane_missiles Fluffy_Pillow 893324.6/1568499: 57% mana arcane_charge(4), arcane_missiles, quickening(6)
2:26.479 arcane_barrage Fluffy_Pillow 931995.3/1568499: 59% mana arcane_charge(4), quickening(7)
2:27.580 arcane_blast Fluffy_Pillow 1201003.9/1568499: 77% mana
2:29.460 arcane_blast Fluffy_Pillow 1208214.5/1568499: 77% mana arcane_charge, arcane_missiles, quickening
2:31.305 arcane_blast Fluffy_Pillow 1173426.5/1568499: 75% mana arcane_charge(2), arcane_missiles, quickening(2)
2:33.113 arcane_blast Fluffy_Pillow 1096597.2/1568499: 70% mana arcane_charge(3), arcane_missiles(2), quickening(3)
2:34.887 nether_tempest Fluffy_Pillow 977790.6/1568499: 62% mana arcane_charge(4), arcane_missiles(3), quickening(4)
2:36.050 arcane_missiles Fluffy_Pillow 986165.5/1568499: 63% mana arcane_charge(4), arcane_missiles(3), quickening(4)
2:37.806 arcane_missiles Fluffy_Pillow 1023724.0/1568499: 65% mana arcane_charge(4), arcane_missiles(2), quickening(5)
2:39.504 arcane_missiles Fluffy_Pillow 1060041.8/1568499: 68% mana arcane_charge(4), arcane_missiles, quickening(6)
2:41.302 arcane_barrage Fluffy_Pillow 1098498.6/1568499: 70% mana arcane_charge(4), quickening(7)
2:42.403 arcane_blast Fluffy_Pillow 1367507.3/1568499: 87% mana
2:44.284 arcane_blast Fluffy_Pillow 1374739.3/1568499: 88% mana arcane_charge, quickening
2:46.130 arcane_blast Fluffy_Pillow 1339972.6/1568499: 85% mana arcane_charge(2), arcane_missiles, quickening(2)
2:47.940 arcane_blast Fluffy_Pillow 1263186.0/1568499: 81% mana arcane_charge(3), arcane_missiles, quickening(3)
2:49.713 nether_tempest Fluffy_Pillow 1144358.1/1568499: 73% mana arcane_charge(4), arcane_missiles(2), quickening(4)
2:50.874 arcane_missiles Fluffy_Pillow 1152690.3/1568499: 73% mana arcane_charge(4), arcane_missiles(2), quickening(4)
2:52.651 arcane_missiles Fluffy_Pillow 1190697.8/1568499: 76% mana arcane_charge(4), arcane_missiles, quickening(5)
2:54.381 supernova Fluffy_Pillow 1227700.1/1568499: 78% mana arcane_charge(4), quickening(6)
2:55.504 arcane_barrage Fluffy_Pillow 1251719.6/1568499: 80% mana arcane_charge(4), quickening(6)
2:56.628 arcane_blast Fluffy_Pillow 1521220.2/1568499: 97% mana
2:58.509 arcane_blast Fluffy_Pillow 1528452.2/1568499: 97% mana arcane_charge, arcane_missiles, quickening
3:00.351 arcane_blast Fluffy_Pillow 1493600.0/1568499: 95% mana arcane_charge(2), arcane_missiles, quickening(2)
3:02.159 arcane_blast Fluffy_Pillow 1416770.6/1568499: 90% mana arcane_charge(3), arcane_missiles(2), quickening(3)
3:03.933 nether_tempest Fluffy_Pillow 1297964.1/1568499: 83% mana arcane_charge(4), arcane_missiles(3), quickening(4)
3:05.095 arcane_missiles Fluffy_Pillow 1306317.6/1568499: 83% mana arcane_charge(4), arcane_missiles(3), quickening(4)
3:06.836 arcane_missiles Fluffy_Pillow 1343555.2/1568499: 86% mana arcane_charge(4), arcane_missiles(2), quickening(5)
3:08.594 arcane_missiles Fluffy_Pillow 1381156.4/1568499: 88% mana arcane_charge(4), arcane_missiles, quickening(6)
3:10.337 arcane_blast Fluffy_Pillow 1418436.8/1568499: 90% mana arcane_charge(4), quickening(7)
3:11.987 mark_of_aluneth Fluffy_Pillow 1255728.0/1568499: 80% mana arcane_charge(4), quickening(8)
3:13.429 nether_tempest Fluffy_Pillow 1286570.4/1568499: 82% mana arcane_charge(4), quickening(8)
3:14.511 rune_of_power Fluffy_Pillow 1293212.9/1568499: 82% mana arcane_charge(4), arcane_missiles, quickening(8)
3:15.595 start_burn_phase Fluffy_Pillow 1316398.1/1568499: 84% mana arcane_charge(4), arcane_missiles, quickening(8), rune_of_power
3:15.595 arcane_power Fluffy_Pillow 1316398.1/1568499: 84% mana arcane_charge(4), arcane_missiles, quickening(8), rune_of_power
3:15.595 berserking Fluffy_Pillow 1316398.1/1568499: 84% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(8), rune_of_power
3:15.595 potion Fluffy_Pillow 1316398.1/1568499: 84% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(8), rune_of_power
3:15.595 arcane_blast Fluffy_Pillow 1316398.1/1568499: 84% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(8), rune_of_power, potion_of_deadly_grace
3:17.006 arcane_blast Fluffy_Pillow 1207977.5/1568499: 77% mana berserking, arcane_charge(4), arcane_missiles(2), arcane_power, quickening(9), rune_of_power, potion_of_deadly_grace
3:18.392 arcane_missiles Fluffy_Pillow 1099022.1/1568499: 70% mana berserking, arcane_charge(4), arcane_missiles(3), arcane_power, quickening(10), rune_of_power, potion_of_deadly_grace
3:19.777 arcane_missiles Fluffy_Pillow 1128645.3/1568499: 72% mana berserking, arcane_charge(4), arcane_missiles(2), arcane_power, quickening(11), rune_of_power, potion_of_deadly_grace
3:21.129 arcane_blast Fluffy_Pillow 1157562.8/1568499: 74% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(12), rune_of_power, potion_of_deadly_grace
3:22.450 arcane_blast Fluffy_Pillow 1047217.1/1568499: 67% mana berserking, arcane_charge(4), arcane_missiles(2), arcane_power, quickening(13), rune_of_power, potion_of_deadly_grace
3:23.749 arcane_missiles Fluffy_Pillow 936400.9/1568499: 60% mana berserking, arcane_charge(4), arcane_missiles(2), arcane_power, quickening(14), rune_of_power, potion_of_deadly_grace
3:25.167 arcane_blast Fluffy_Pillow 966730.0/1568499: 62% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(15), rune_of_power, potion_of_deadly_grace
3:26.426 nether_tempest Fluffy_Pillow 855058.3/1568499: 55% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(16), potion_of_deadly_grace
3:27.376 arcane_missiles Fluffy_Pillow 863827.5/1568499: 55% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(16), potion_of_deadly_grace
3:28.762 rune_of_power Fluffy_Pillow 893472.1/1568499: 57% mana arcane_charge(4), arcane_missiles, quickening(17), potion_of_deadly_grace
3:29.700 supernova Fluffy_Pillow 913534.6/1568499: 58% mana arcane_charge(4), arcane_missiles, quickening(17), rune_of_power, potion_of_deadly_grace
3:30.638 arcane_missiles Fluffy_Pillow 933597.2/1568499: 60% mana arcane_charge(4), arcane_missiles, quickening(17), rune_of_power, potion_of_deadly_grace
3:32.094 arcane_blast Fluffy_Pillow 964739.0/1568499: 62% mana arcane_charge(4), quickening(18), rune_of_power, potion_of_deadly_grace
3:33.478 arcane_missiles Fluffy_Pillow 796340.8/1568499: 51% mana arcane_charge(4), arcane_missiles, quickening(19), rune_of_power, potion_of_deadly_grace
3:34.905 arcane_blast Fluffy_Pillow 826862.4/1568499: 53% mana arcane_charge(4), quickening(20), rune_of_power, potion_of_deadly_grace
3:36.249 arcane_missiles Fluffy_Pillow 657608.7/1568499: 42% mana arcane_charge(4), arcane_missiles, quickening(21), rune_of_power, potion_of_deadly_grace
3:37.622 arcane_blast Fluffy_Pillow 686975.3/1568499: 44% mana arcane_charge(4), quickening(22), rune_of_power, potion_of_deadly_grace
3:38.929 nether_tempest Fluffy_Pillow 516930.2/1568499: 33% mana arcane_charge(4), arcane_missiles, quickening(23), rune_of_power, potion_of_deadly_grace
3:39.792 arcane_missiles Fluffy_Pillow 518888.6/1568499: 33% mana arcane_charge(4), arcane_missiles, quickening(23), potion_of_deadly_grace
3:41.300 arcane_blast Fluffy_Pillow 551142.6/1568499: 35% mana arcane_charge(4), quickening(24), potion_of_deadly_grace
3:42.574 arcane_missiles Fluffy_Pillow 380391.7/1568499: 24% mana arcane_charge(4), arcane_missiles, quickening(25), potion_of_deadly_grace
3:43.965 arcane_blast Fluffy_Pillow 410143.3/1568499: 26% mana arcane_charge(4), quickening(26), potion_of_deadly_grace
3:45.203 arcane_blast Fluffy_Pillow 238622.4/1568499: 15% mana arcane_charge(4), quickening(27), potion_of_deadly_grace
3:46.424 evocation Fluffy_Pillow 66737.9/1568499: 4% mana arcane_charge(4), arcane_missiles, quickening(28)
3:49.863 stop_burn_phase Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), arcane_missiles, quickening(28)
3:49.863 arcane_blast Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), arcane_missiles, quickening(28)
3:51.069 nether_tempest Fluffy_Pillow 1370563.0/1568499: 87% mana arcane_charge(4), arcane_missiles(2), quickening(29)
3:51.866 arcane_missiles Fluffy_Pillow 1371109.7/1568499: 87% mana arcane_charge(4), arcane_missiles(3), quickening(29)
3:53.160 arcane_missiles Fluffy_Pillow 1398786.6/1568499: 89% mana arcane_charge(4), arcane_missiles(2), quickening(30)
3:54.456 arcane_missiles Fluffy_Pillow 1426506.2/1568499: 91% mana arcane_charge(4), arcane_missiles, quickening(31)
3:55.730 supernova Fluffy_Pillow 1453755.3/1568499: 93% mana arcane_charge(4), quickening(32)
3:56.498 arcane_blast Fluffy_Pillow 1470181.8/1568499: 94% mana arcane_charge(4), quickening(32)
3:57.647 arcane_blast Fluffy_Pillow 1296757.3/1568499: 83% mana arcane_charge(4), quickening(33)
3:58.782 arcane_barrage Fluffy_Pillow 1123033.4/1568499: 72% mana arcane_charge(4), quickening(34)
3:59.536 arcane_blast Fluffy_Pillow 1384620.2/1568499: 88% mana
4:01.416 arcane_blast Fluffy_Pillow 1391830.8/1568499: 89% mana arcane_charge, quickening
4:03.259 arcane_blast Fluffy_Pillow 1357000.1/1568499: 87% mana arcane_charge(2), quickening(2)
4:05.067 arcane_blast Fluffy_Pillow 1280170.7/1568499: 82% mana arcane_charge(3), arcane_missiles, quickening(3)
4:06.842 nether_tempest Fluffy_Pillow 1161385.5/1568499: 74% mana arcane_charge(4), arcane_missiles, quickening(4)
4:08.004 arcane_missiles Fluffy_Pillow 1169739.1/1568499: 75% mana arcane_charge(4), arcane_missiles, quickening(4)
4:09.749 arcane_barrage Fluffy_Pillow 1207062.2/1568499: 77% mana arcane_charge(4), quickening(5)
4:10.890 arcane_blast Fluffy_Pillow 1476926.4/1568499: 94% mana
4:12.770 arcane_blast Fluffy_Pillow 1484137.0/1568499: 95% mana arcane_charge, quickening
4:14.613 mark_of_aluneth Fluffy_Pillow 1449306.3/1568499: 92% mana arcane_charge(2), quickening(2)
4:16.222 arcane_blast Fluffy_Pillow 1483720.5/1568499: 95% mana arcane_charge(2), quickening(2)
4:18.030 arcane_blast Fluffy_Pillow 1406891.2/1568499: 90% mana arcane_charge(3), quickening(3)
4:19.804 nether_tempest Fluffy_Pillow 1288084.6/1568499: 82% mana arcane_charge(4), quickening(4)
4:20.968 rune_of_power Fluffy_Pillow 1296480.9/1568499: 83% mana arcane_charge(4), quickening(4)
4:22.130 start_burn_phase Fluffy_Pillow 1321334.5/1568499: 84% mana arcane_charge(4), quickening(4), rune_of_power
4:22.130 supernova Fluffy_Pillow 1321334.5/1568499: 84% mana arcane_charge(4), quickening(4), rune_of_power
4:23.293 arcane_blast Fluffy_Pillow 1346209.5/1568499: 86% mana arcane_charge(4), quickening(4), rune_of_power
4:25.034 arcane_blast Fluffy_Pillow 1185447.1/1568499: 76% mana arcane_charge(4), quickening(5), rune_of_power
4:26.743 arcane_missiles Fluffy_Pillow 1024000.2/1568499: 65% mana arcane_charge(4), arcane_missiles, quickening(6), rune_of_power
4:28.554 arcane_blast Fluffy_Pillow 1062735.0/1568499: 68% mana arcane_charge(4), quickening(7), rune_of_power
4:30.206 nether_tempest Fluffy_Pillow 900069.0/1568499: 57% mana arcane_charge(4), arcane_missiles, quickening(8), rune_of_power
4:31.288 arcane_missiles Fluffy_Pillow 906711.5/1568499: 58% mana arcane_charge(4), arcane_missiles(2), quickening(8), rune_of_power
4:33.036 arcane_missiles Fluffy_Pillow 944098.8/1568499: 60% mana arcane_charge(4), arcane_missiles, quickening(9)
4:34.778 arcane_blast Fluffy_Pillow 981357.8/1568499: 63% mana arcane_charge(4), quickening(10)
4:36.345 arcane_missiles Fluffy_Pillow 816873.7/1568499: 52% mana arcane_charge(4), arcane_missiles, quickening(11)
4:37.917 arcane_blast Fluffy_Pillow 850496.7/1568499: 54% mana arcane_charge(4), quickening(12)
4:39.437 arcane_blast Fluffy_Pillow 685007.4/1568499: 44% mana arcane_charge(4), quickening(13)
4:40.931 arcane_blast Fluffy_Pillow 518962.0/1568499: 33% mana arcane_charge(4), quickening(14)
4:42.400 nether_tempest Fluffy_Pillow 352381.8/1568499: 22% mana arcane_charge(4), arcane_missiles, quickening(15)
4:43.366 arcane_missiles Fluffy_Pillow 356543.2/1568499: 23% mana arcane_charge(4), arcane_missiles, quickening(15)
4:44.734 arcane_blast Fluffy_Pillow 385802.9/1568499: 25% mana arcane_charge(4), quickening(16)
4:46.161 arcane_power Fluffy_Pillow 218324.4/1568499: 14% mana arcane_charge(4), quickening(17)
4:46.161 arcane_blast Fluffy_Pillow 218324.4/1568499: 14% mana arcane_charge(4), arcane_power, quickening(17)
4:47.565 nether_tempest Fluffy_Pillow 109754.1/1568499: 7% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(18)
4:48.488 rune_of_power Fluffy_Pillow 117945.8/1568499: 8% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(18)
4:49.410 supernova Fluffy_Pillow 137666.1/1568499: 9% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(18), rune_of_power
4:50.333 arcane_blast Fluffy_Pillow 157407.8/1568499: 10% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(18), rune_of_power
4:51.718 arcane_missiles Fluffy_Pillow 48431.0/1568499: 3% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(19), rune_of_power
4:53.168 arcane_missiles Fluffy_Pillow 79444.5/1568499: 5% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(20), rune_of_power
4:54.749 arcane_barrage Fluffy_Pillow 113259.9/1568499: 7% mana arcane_charge(4), arcane_power, quickening(21), rune_of_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4876 4551 0
Agility 6579 6254 0
Stamina 42382 42382 26343
Intellect 39238 37532 28421 (2596)
Spirit 1 1 0
Health 2542920 2542920 0
Mana 1568499 1378784 0
Spell Power 39238 37532 0
Melee Crit 23.46% 22.39% 6085
Spell Crit 27.46% 26.39% 6085
Haste 19.89% 19.89% 6465
Damage / Heal Versatility 6.41% 6.41% 2564
ManaReg per Second 21389 20682 0
Mastery 29.63% 25.34% 4591
Armor 1824 1824 1824
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Pendant of Liquid Horror
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Ancient Dreamwoven Mantle
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +641 Mastery, +454 Crit }
Local Chest Robes of Celestial Adornment
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +855 Haste, +605 Crit }
Local Waist Cinch of Light
ilevel: 880, stats: { 163 Armor, +1930 Sta, +1287 Int, +783 Mastery, +312 Haste }
Local Legs Mystic Kilt of the Rune Master
ilevel: 895, stats: { 267 Armor, +2959 Sta, +1973 Int, +993 Haste, +552 Mastery }
Local Feet Treads of the Drowned
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +759 Haste, +336 Mastery }
Local Wrists Helhound Hair Bracers
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +499 Mastery, +323 Vers }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Mastery }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Mastery }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Mantle of the Victorious Dead
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Vers, +340 Haste }, enchant: { +200 Int }
Local Main Hand Aluneth
ilevel: 906, weapon: { 5654 - 8482, 3.6 }, stats: { +2186 Int, +3279 Sta, +806 Haste, +806 Mastery, +11923 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Arcane Familiar (Arcane Mage) Presence of Mind (Arcane Mage) Words of Power (Arcane Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Supernova (Arcane Mage) Charged Up (Arcane Mage) Resonance (Arcane Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Nether Tempest (Arcane Mage) Unstable Magic Erosion (Arcane Mage)
100 Overpowered Quickening (Arcane Mage) Arcane Orb (Arcane Mage)

Profile

mage="Mage_Arcane_T19M"
level=110
race=troll
role=spell
position=back
talents=1021012
artifact=4:0:0:0:0:72:3:73:1:74:3:75:3:77:3:78:1:79:3:80:1:81:3:82:3:83:3:84:3:86:1:87:1:290:1:1169:1:1339:1
spec=arcane

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/summon_arcane_familiar
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/arcane_blast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.arcane_power.down
actions+=/stop_burn_phase,if=prev_gcd.evocation&burn_phase_duration>gcd.max
actions+=/mark_of_aluneth,if=cooldown.arcane_power.remains>20
actions+=/call_action_list,name=build,if=buff.arcane_charge.stack<4
actions+=/call_action_list,name=init_burn,if=buff.arcane_power.down&buff.arcane_charge.stack=4&(cooldown.mark_of_aluneth.remains=0|cooldown.mark_of_aluneth.remains>20)&(!talent.rune_of_power.enabled|(cooldown.arcane_power.remains<=action.rune_of_power.cast_time|action.rune_of_power.recharge_time<cooldown.arcane_power.remains))|target.time_to_die<45
actions+=/call_action_list,name=burn,if=burn_phase
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&!burn_phase
actions+=/call_action_list,name=conserve

actions.build=charged_up,if=buff.arcane_charge.stack<=1
actions.build+=/arcane_missiles,if=buff.arcane_missiles.react=3
actions.build+=/arcane_orb
actions.build+=/arcane_explosion,if=active_enemies>1
actions.build+=/arcane_blast

actions.burn=call_action_list,name=cooldowns
actions.burn+=/arcane_missiles,if=buff.arcane_missiles.react=3
actions.burn+=/arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
actions.burn+=/presence_of_mind,if=buff.arcane_power.remains>2*gcd
actions.burn+=/nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
actions.burn+=/arcane_blast,if=active_enemies<=1&mana.pct%10*execute_time>target.time_to_die
actions.burn+=/arcane_explosion,if=active_enemies>1&mana.pct%10*execute_time>target.time_to_die
actions.burn+=/arcane_missiles,if=buff.arcane_missiles.react>1
actions.burn+=/arcane_explosion,if=active_enemies>1&buff.arcane_power.remains>cast_time
actions.burn+=/arcane_blast,if=buff.presence_of_mind.up|buff.arcane_power.remains>cast_time
actions.burn+=/supernova,if=mana.pct<100
actions.burn+=/arcane_missiles,if=mana.pct>10&(talent.overpowered.enabled|buff.arcane_power.down)
actions.burn+=/arcane_explosion,if=active_enemies>1
actions.burn+=/arcane_blast
actions.burn+=/evocation,interrupt_if=mana.pct>99

actions.conserve=arcane_missiles,if=buff.arcane_missiles.react=3
actions.conserve+=/arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
actions.conserve+=/arcane_blast,if=mana.pct>99
actions.conserve+=/nether_tempest,if=(refreshable|!ticking)
actions.conserve+=/arcane_blast,if=buff.rhonins_assaulting_armwraps.up&equipped.132413
actions.conserve+=/arcane_missiles
actions.conserve+=/supernova,if=mana.pct<100
actions.conserve+=/frost_nova,if=equipped.132452
actions.conserve+=/arcane_explosion,if=mana.pct>=82&equipped.132451&active_enemies>1
actions.conserve+=/arcane_blast,if=mana.pct>=82&equipped.132451
actions.conserve+=/arcane_barrage,if=mana.pct<100&cooldown.arcane_power.remains>5
actions.conserve+=/arcane_explosion,if=active_enemies>1
actions.conserve+=/arcane_blast

actions.cooldowns=rune_of_power,if=mana.pct>45&buff.arcane_power.down
actions.cooldowns+=/arcane_power
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=deadly_grace,if=buff.arcane_power.up&(buff.berserking.up|buff.blood_fury.up)

actions.init_burn=mark_of_aluneth
actions.init_burn+=/frost_nova,if=equipped.132452
actions.init_burn+=/nether_tempest,if=dot.nether_tempest.remains<10&(prev_gcd.mark_of_aluneth|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<gcd.max))
actions.init_burn+=/rune_of_power
actions.init_burn+=/start_burn_phase,if=((cooldown.evocation.remains-(2*burn_phase_duration))%2<burn_phase_duration)|cooldown.arcane_power.remains=0|target.time_to_die<55

actions.rop_phase=arcane_missiles,if=buff.arcane_missiles.react=3
actions.rop_phase+=/arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
actions.rop_phase+=/nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
actions.rop_phase+=/arcane_missiles,if=buff.arcane_charge.stack=4
actions.rop_phase+=/arcane_explosion,if=active_enemies>1
actions.rop_phase+=/arcane_blast,if=mana.pct>45
actions.rop_phase+=/arcane_barrage

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=pendant_of_liquid_horror,id=141696,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=ancient_dreamwoven_mantle,id=139191,bonus_id=1806
back=mantle_of_the_victorious_dead,id=142540,bonus_id=1502/3467,enchant=binding_of_intellect
chest=robes_of_celestial_adornment,id=142410,bonus_id=1502/3467
wrists=helhound_hair_bracers,id=142415,bonus_id=1502/3467
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=cinch_of_light,id=142411,bonus_id=1502/3467
legs=mystic_kilt_of_the_rune_master,id=132451
feet=treads_of_the_drowned,id=142414,bonus_id=1502/3467
finger1=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_mastery
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=binding_of_mastery
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=aluneth,id=127857,gem_id=137380/137272/137380,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=882.73
# gear_stamina=26343
# gear_intellect=28421
# gear_crit_rating=6085
# gear_haste_rating=6465
# gear_mastery_rating=4591
# gear_versatility_rating=2564
# gear_armor=1824

Mage_Fire_T19M : 431152 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
431152.3 431152.3 412.6 / 0.096% 71402.4 / 16.6% 24.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
17456.0 17456.0 Mana 0.00% 49.6 100.0% 100%
Talents
  • 15: Pyromaniac (Fire Mage)
  • 45: Rune of Power
  • 60: Flame On (Fire Mage)
  • 90: Unstable Magic
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mage_Fire_T19M 431152
Blast Furnace (blast_furance) 4588 1.1% 36.3 8.33sec 37891 0 Periodic 222.5 3041 7892 6187 64.9% 72.9%

Stats details: blast_furance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.34 0.00 222.53 222.53 0.0000 0.9849 1376862.24 1376862.24 0.00 6282.34 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.2 35.14% 3040.52 3 4198 3040.96 2778 3294 237735 237735 0.00
crit 144.3 64.86% 7892.10 6 10810 7897.38 7334 8613 1139128 1139128 0.00
 
 

Action details: blast_furance

Static Values
  • id:194522
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:194522
  • name:Blast Furnace
  • school:fire
  • tooltip:Deals {$s1=1} Fire damage every $t1 sec.
  • description:Deals {$s1=1} Fire damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Deadly Grace 18593 4.2% 24.5 4.62sec 224593 0 Direct 24.5 94535 262986 224594 77.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.46 24.46 0.00 0.00 0.0000 0.0000 5494163.37 5494163.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.58 22.79% 94535.15 82172 123258 94397.99 0 123258 527070 527070 0.00
crit 18.89 77.21% 262985.97 164343 308144 263211.01 229597 303403 4967093 4967093 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Fire Blast 26407 6.1% 36.3 8.33sec 218007 0 Direct 36.3 0 218007 218007 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.34 36.34 0.00 0.00 0.0000 0.0000 7921860.16 7921860.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.34 100.00% 218007.08 142921 267977 218038.81 201400 237186 7921860 7921860 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum ${{$231567s1=1}+1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 36392 8.5% 75.5 3.68sec 144833 92369 Direct 75.4 79199 175830 145035 68.1%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.53 75.43 0.00 0.00 1.5680 0.0000 10939628.83 10939628.83 0.00 92368.99 92368.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.04 31.87% 79198.93 76234 114352 79184.08 76234 90095 1903714 1903714 0.00
crit 51.39 68.13% 175829.57 157043 294455 175830.58 164181 189433 9035914 9035914 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 88012 20.4% 223.9 1.35sec 118001 0 Periodic 299.3 88292 0 88292 0.0% 99.6%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.93 0.00 299.28 299.28 0.0000 1.0000 26424009.19 26424009.19 0.00 88292.23 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 299.3 100.00% 88291.83 2462 369316 88391.78 73568 105125 26424009 26424009 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Maddening Whispers 20773 4.8% 2.3 160.08sec 2738005 0 Direct 2.3 730373 2738474 2738005 100.0%  

Stats details: maddening_whispers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 2.29 0.00 0.00 0.0000 0.0000 6256628.42 6256628.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.02% 730373.40 730373 730373 389.58 0 730373 390 390 0.00
crit 2.28 99.98% 2738474.01 1825933 2738900 2738555.29 2282417 2738900 6256239 6256239 0.00
 
 

Action details: maddening_whispers

Static Values
  • id:222050
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222050
  • name:Maddening Whispers
  • school:shadow
  • tooltip:Deals {$222046s1=36653} Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70372.42
  • base_dd_max:70372.42
 
Mark of the Hidden Satyr 11180 2.6% 17.0 17.59sec 197748 0 Direct 17.0 97956 251145 197749 65.1%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.97 16.97 0.00 0.00 0.0000 0.0000 3355046.77 3355046.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.91 34.85% 97955.54 90176 135264 97765.12 0 135264 579264 579264 0.00
crit 11.05 65.15% 251144.88 185762 348304 251002.76 185762 348304 2775783 2775783 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Phoenix Reborn 3585 0.8% 25.0 11.67sec 43066 0 Direct 25.0 21645 55055 43067 64.1%  

Stats details: phoenix_reborn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.00 25.00 0.00 0.00 0.0000 0.0000 1076747.95 1076747.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.97 35.89% 21645.08 19982 29974 21622.52 0 29974 194212 194212 0.00
crit 16.03 64.11% 55055.22 41164 77182 55114.21 42605 70390 882536 882536 0.00
 
 

Action details: phoenix_reborn

Static Values
  • id:215773
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215773
  • name:Phoenix Reborn
  • school:fire
  • tooltip:
  • description:Targets affected by your Ignite have a chance to erupt in flame, taking $215775m1 additional Fire damage and reducing the remaining cooldown on Phoenix's Flame by {$s1=10} sec.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 19706 4.6% 13.6 22.93sec 433928 361435 Direct 13.6 0 435441 435441 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.61 13.56 0.00 0.00 1.2006 0.0000 5906204.29 5906204.29 0.00 361434.69 361434.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 13.56 100.00% 435441.10 246986 463098 435645.91 402896 463098 5906204 5906204 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Plague Swarm 19472 4.5% 13.6 21.76sec 431239 0 Periodic 61.4 48409 121032 95333 64.6% 40.2%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.56 0.00 61.35 61.35 0.0000 1.9680 5848786.36 5848786.36 0.00 48440.36 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.7 35.39% 48409.31 23 68034 48405.42 38024 62529 1051006 1051006 0.00
crit 39.6 64.61% 121032.49 50 170086 120975.37 91785 151641 4797780 4797780 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Pyroblast 174256 40.4% 97.2 3.08sec 537879 341082 Direct 98.0 272455 622821 533683 74.6%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.21 97.97 0.00 0.00 1.5770 0.0000 52286553.32 52286553.32 0.00 341082.31 341082.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.93 25.44% 272455.20 159286 955713 272414.44 164595 452968 6790867 6790867 0.00
crit 73.05 74.56% 622821.46 328128 2460962 622473.41 493364 781735 45495686 45495686 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.760000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 184 0.0% 0.7 150.76sec 76641 72428 Direct 0.7 0 76641 76641 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.71 0.71 0.00 0.00 1.0589 0.0000 54248.42 54248.42 0.00 72427.80 72427.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.71 100.00% 76640.71 41166 77187 41726.06 0 77187 54248 54248 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
sorcerous_arcane_blast 1080 0.3% 0.4 318.26sec 746563 0 Direct 0.4 671842 1408881 746541 10.1%  

Stats details: sorcerous_arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.44 0.44 0.00 0.00 0.0000 0.0000 331916.50 331916.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.40 89.86% 671842.43 671842 671842 248525.26 0 671842 268414 268414 0.00
crit 0.05 10.14% 1408881.41 1343685 1679606 62355.29 0 1679606 63502 63502 0.00
 
 

Action details: sorcerous_arcane_blast

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:431550.00
  • base_dd_max:431550.00
 
sorcerous_fireball 1327 0.3% 0.5 318.61sec 872793 0 Direct 0.5 383910 803378 431472 11.3%  
Periodic 3.7 54551 0 54551 0.0% 0.8%

Stats details: sorcerous_fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.46 0.46 3.74 3.74 0.0000 0.6076 403400.72 403400.72 0.00 177631.32 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.41 88.66% 383909.96 383910 383910 145034.93 0 383910 157322 157322 0.00
crit 0.05 11.34% 803378.00 767820 959775 41675.14 0 959775 42103 42103 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.7 100.00% 54551.32 26673 57586 22869.30 0 57586 203976 203976 0.00
 
 

Action details: sorcerous_fireball

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:246600.00
  • base_dd_max:246600.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:36990.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
sorcerous_frostbolt 1055 0.3% 0.5 318.62sec 705202 0 Direct 0.5 633383 1325294 705181 10.4%  

Stats details: sorcerous_frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.46 0.46 0.00 0.00 0.0000 0.0000 324342.23 324342.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.41 89.62% 633383.15 422301 633451 239955.25 0 633451 261073 261073 0.00
crit 0.05 10.38% 1325293.65 1266903 1583629 62555.34 0 1583629 63269 63269 0.00
 
 

Action details: sorcerous_frostbolt

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:406890.00
  • base_dd_max:406890.00
 
Unstable Magic (_explosion) 4541 1.1% 18.8 14.23sec 72477 0 Direct 18.8 72477 0 72477 0.0%  

Stats details: unstable_magic_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.83 18.83 0.00 0.00 0.0000 0.0000 1364634.51 1364634.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.83 100.00% 72476.79 38117 147228 72560.16 49241 98220 1364635 1364635 0.00
 
 

Action details: unstable_magic_explosion

Static Values
  • id:157976
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157976
  • name:Unstable Magic
  • school:none
  • tooltip:
  • description:{$?s137021=false}[Arcane Blast]?s137019[Fireball][Frostbolt] has a {$?s137020=false}[{$s2=20}%]?s137021[{$s1=15}%][{$s3=25}%] chance to explode on impact, dealing {$s4=50}% additional damage to the target and all other enemies within $157977A1 yds.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:78521.41
  • base_dd_max:78521.41
 
Simple Action Stats Execute Interval
Mage_Fire_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Fire_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 238.41sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Combustion 4.3 79.56sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
 
Flame On 4.6 76.37sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Fire_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Fire_T19M
  • harmful:false
  • if_expr:
 
Phoenix's Flames (_splash) 13.6 22.95sec

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.7 37.73sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.72 0.00 0.00 0.00 1.2866 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 238.4sec 238.4sec 6.51% 22.52% 0.0(0.0) 1.9

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 34.20% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.3 0.0 79.6sec 79.6sec 14.19% 90.70% 85.0(85.0) 4.2

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 18.9 5.1 14.4sec 11.3sec 28.44% 30.13% 0.0(0.0) 0.9

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:24.08%
  • enhanced_pyrotechnics_2:3.91%
  • enhanced_pyrotechnics_3:0.44%
  • enhanced_pyrotechnics_4:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 86.6 0.0 3.5sec 3.5sec 40.21% 47.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:40.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 77.8 0.0 3.9sec 3.9sec 23.32% 85.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:23.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Kael'thas's Ultimate Ability (kaelthas_ultimate_ability) 13.1 3.8 22.8sec 17.5sec 32.11% 32.11% 3.8(3.8) 0.1

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_kaelthas_ultimate_ability
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • kaelthas_ultimate_ability_1:32.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209455
  • name:Kael'thas's Ultimate Ability
  • tooltip:Increases the damage of your next non-instant Pyroblast by {$s1=300}%.
  • description:{$@spelldesc209450=After consuming Hot Streak, there is a {$s1=20}% chance that your next non-instant Pyroblast cast within {$209455d=15 seconds} deals {$209455s1=300}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maddening Whispers 2.4 0.0 158.4sec 158.4sec 4.95% 4.95% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.78%
  • maddening_whispers_2:0.59%
  • maddening_whispers_3:0.47%
  • maddening_whispers_4:0.46%
  • maddening_whispers_5:0.47%
  • maddening_whispers_6:0.45%
  • maddening_whispers_7:0.47%
  • maddening_whispers_8:0.45%
  • maddening_whispers_9:0.50%
  • maddening_whispers_10:0.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222046
  • name:Maddening Whispers
  • tooltip:Your damaging spells transfer a Maddening Whisper to the target. When all Whispers have been applied, each deals $s~1 Shadow damage.
  • description:Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.
  • max_stacks:10
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 77.4sec 0.0sec 19.62% 19.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 36.9 138.2 8.1sec 1.7sec 73.32% 100.00% 63.1(63.1) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:19.31%
  • pyretic_incantation_2:10.84%
  • pyretic_incantation_3:4.63%
  • pyretic_incantation_4:8.06%
  • pyretic_incantation_5:30.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.7 0.0 37.7sec 37.7sec 28.29% 28.29% 0.0(0.0) 7.9

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=10}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Fire_T19M
combustion Mana 4.3 476397.8 110000.0 109997.8 0.0
fire_blast Mana 36.3 399717.5 11000.0 11000.1 19.8
fireball Mana 75.5 1661714.2 22000.0 22000.0 6.6
pyroblast Mana 98.2 2700737.6 27500.0 27782.9 19.4
scorch Mana 0.7 7784.0 11000.0 10997.1 7.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 357.32 4947132.75 (100.00%) 13845.13 268.88 0.01%
Resource RPS-Gain RPS-Loss
Mana 16460.39 17456.01
Combat End Resource Mean Min Max
Mana 800732.67 469067.50 1082433.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.0%

Procs

Count Interval
Heating Up generated 86.6 3.5sec
Heating Up removed 8.3 30.3sec
IB conversions of HU 33.9 8.9sec
Total Hot Streak procs 77.8 3.9sec
Hot Streak spells used 224.0 1.3sec
Hot Streak spell crits 175.0 1.7sec
Wasted Hot Streak spell crits 10.6 25.2sec
Direct Ignite applications 1.0 0.0sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Mage_Fire_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Mage_Fire_T19M Damage Per Second
Count 7499
Mean 431152.26
Minimum 369247.46
Maximum 515517.69
Spread ( max - min ) 146270.23
Range [ ( max - min ) / 2 * 100% ] 16.96%
Standard Deviation 18227.8325
5th Percentile 402380.18
95th Percentile 461577.29
( 95th Percentile - 5th Percentile ) 59197.11
Mean Distribution
Standard Deviation 210.4909
95.00% Confidence Intervall ( 430739.70 - 431564.81 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 68
0.1% Error 6866
0.1 Scale Factor Error with Delta=300 2836310
0.05 Scale Factor Error with Delta=300 11345240
0.01 Scale Factor Error with Delta=300 283631021
Priority Target DPS
Sample Data Mage_Fire_T19M Priority Target Damage Per Second
Count 7499
Mean 431152.26
Minimum 369247.46
Maximum 515517.69
Spread ( max - min ) 146270.23
Range [ ( max - min ) / 2 * 100% ] 16.96%
Standard Deviation 18227.8325
5th Percentile 402380.18
95th Percentile 461577.29
( 95th Percentile - 5th Percentile ) 59197.11
Mean Distribution
Standard Deviation 210.4909
95.00% Confidence Intervall ( 430739.70 - 431564.81 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 68
0.1% Error 6866
0.1 Scale Factor Error with Delta=300 2836310
0.05 Scale Factor Error with Delta=300 11345240
0.01 Scale Factor Error with Delta=300 283631021
DPS(e)
Sample Data Mage_Fire_T19M Damage Per Second (Effective)
Count 7499
Mean 431152.26
Minimum 369247.46
Maximum 515517.69
Spread ( max - min ) 146270.23
Range [ ( max - min ) / 2 * 100% ] 16.96%
Damage
Sample Data Mage_Fire_T19M Damage
Count 7499
Mean 129365033.30
Minimum 91449322.35
Maximum 169363482.41
Spread ( max - min ) 77914160.06
Range [ ( max - min ) / 2 * 100% ] 30.11%
DTPS
Sample Data Mage_Fire_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mage_Fire_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mage_Fire_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mage_Fire_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mage_Fire_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mage_Fire_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Mage_Fire_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mage_Fire_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.combustion.down
7 4.60 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
8 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
9 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
A 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
B 4.59 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
0.00 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
C 4.17 rune_of_power,if=buff.combustion.down
D 0.00 call_action_list,name=active_talents
E 4.33 combustion
F 1.00 potion,name=deadly_grace
0.00 blood_fury
G 1.97 berserking
0.00 arcane_torrent
H 1.37 use_item,slot=neck
I 2.37 use_item,slot=trinket2
J 28.92 pyroblast,if=buff.hot_streak.up
K 17.54 fire_blast,if=buff.heating_up.up
L 8.67 phoenixs_flames
M 0.74 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase
# count action,conditions
0.00 rune_of_power
N 13.80 pyroblast,if=buff.hot_streak.up
O 0.00 call_action_list,name=active_talents
P 3.24 pyroblast,if=buff.kaelthas_ultimate_ability.react
Q 6.96 fire_blast,if=!prev_off_gcd.fire_blast
R 4.94 phoenixs_flames,if=!prev_gcd.phoenixs_flames
0.00 scorch,if=target.health.pct<=25&equipped.132454
S 7.48 fireball
actions.single_target
# count action,conditions
T 0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
0.00 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
U 38.02 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
V 13.41 pyroblast,if=buff.kaelthas_ultimate_ability.react
W 0.00 call_action_list,name=active_talents
X 0.00 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
Y 11.83 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
Z 0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
a 68.29 fireball

Sample Sequence

01256CEGHILKJKBJKJKJLJJLJMJ7PQNNNPQNaUaaaUYaUaaUaaUVVYaUaUaUVYaUaaaaaUaUaCEFJKJKBJKJKJLJJaaUaaaYUVVaaaYUaaa7QRNRSRNQNNaaUaaaYUVVaaaaaaUVaCEIJKJKBJKJKJLJJaaUaaaYUaUaaaaaYU7RQNRSSSSUaUaaUaUaUYaUaUaaYUaUaUaCEGJKBJKJJKJLJJVaUaUYaUaUVYaUaa7NQRNRNSQSS7BQSQNNSS

Sample Sequence Table

time name target resources buffs
Pre flask Mage_Fire_T19M 1100000.0/1100000: 100% mana
Pre food Mage_Fire_T19M 1100000.0/1100000: 100% mana
Pre augmentation Mage_Fire_T19M 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:01.321 combustion Fluffy_Pillow 1094296.5/1100000: 99% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:01.321 berserking Fluffy_Pillow 984296.5/1100000: 89% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:01.321 use_item_sorcerous_shadowruby_pendant Fluffy_Pillow 984296.5/1100000: 89% mana bloodlust, berserking, combustion, rune_of_power, potion_of_deadly_grace
0:01.321 use_item_wriggling_sinew Fluffy_Pillow 984296.5/1100000: 89% mana bloodlust, berserking, combustion, rune_of_power, potion_of_deadly_grace
0:01.321 phoenixs_flames Fluffy_Pillow 984296.5/1100000: 89% mana bloodlust, berserking, combustion, rune_of_power, maddening_whispers(10), potion_of_deadly_grace
0:02.207 fire_blast Fluffy_Pillow 998915.5/1100000: 91% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation, rune_of_power, maddening_whispers(9), potion_of_deadly_grace
0:02.207 pyroblast Fluffy_Pillow 987915.5/1100000: 90% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(2), rune_of_power, maddening_whispers(8), potion_of_deadly_grace
0:03.093 fire_blast Fluffy_Pillow 975034.5/1100000: 89% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(3), rune_of_power, maddening_whispers(7), potion_of_deadly_grace
0:03.093 flame_on Fluffy_Pillow 964034.5/1100000: 88% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(6), potion_of_deadly_grace
0:03.093 pyroblast Fluffy_Pillow 964034.5/1100000: 88% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(6), potion_of_deadly_grace
0:03.978 fire_blast Fluffy_Pillow 951137.0/1100000: 86% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(5), potion_of_deadly_grace
0:03.978 pyroblast Fluffy_Pillow 940137.0/1100000: 85% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(4), potion_of_deadly_grace
0:04.863 fire_blast Fluffy_Pillow 927239.5/1100000: 84% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(3), potion_of_deadly_grace
0:04.863 pyroblast Fluffy_Pillow 916239.5/1100000: 83% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(2), potion_of_deadly_grace
0:05.749 phoenixs_flames Fluffy_Pillow 903358.5/1100000: 82% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers, potion_of_deadly_grace
0:06.636 pyroblast Fluffy_Pillow 917994.0/1100000: 83% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:07.524 pyroblast Fluffy_Pillow 905146.0/1100000: 82% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:08.409 phoenixs_flames Fluffy_Pillow 892248.5/1100000: 81% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:09.295 pyroblast Fluffy_Pillow 906867.5/1100000: 82% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:10.180 scorch Fluffy_Pillow 893970.0/1100000: 81% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:11.066 pyroblast Fluffy_Pillow 897589.0/1100000: 82% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:12.048 rune_of_power Fluffy_Pillow 886292.0/1100000: 81% mana bloodlust, heating_up, pyretic_incantation(5), kaelthas_ultimate_ability, potion_of_deadly_grace
0:13.062 pyroblast Fluffy_Pillow 903023.0/1100000: 82% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:16.108 fire_blast Fluffy_Pillow 925782.0/1100000: 84% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:16.108 pyroblast Fluffy_Pillow 914782.0/1100000: 83% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:17.125 pyroblast Fluffy_Pillow 904062.5/1100000: 82% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:18.144 pyroblast Fluffy_Pillow 893376.0/1100000: 81% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:19.161 pyroblast Fluffy_Pillow 882656.5/1100000: 80% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:22.206 fire_blast Fluffy_Pillow 905399.0/1100000: 82% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:22.206 pyroblast Fluffy_Pillow 894399.0/1100000: 81% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:23.224 fireball Fluffy_Pillow 883696.0/1100000: 80% mana bloodlust, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:24.474 pyroblast Fluffy_Pillow 882321.0/1100000: 80% mana bloodlust, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:25.492 fireball Fluffy_Pillow 871618.0/1100000: 79% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:26.742 fireball Fluffy_Pillow 870243.0/1100000: 79% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:27.994 fireball Fluffy_Pillow 868901.0/1100000: 79% mana bloodlust, heating_up, pyretic_incantation, potion_of_deadly_grace
0:29.246 pyroblast Fluffy_Pillow 867559.0/1100000: 79% mana bloodlust, hot_streak, pyretic_incantation(2)
0:30.266 fire_blast Fluffy_Pillow 856889.0/1100000: 78% mana bloodlust, heating_up
0:30.266 fireball Fluffy_Pillow 845889.0/1100000: 77% mana bloodlust, hot_streak, pyretic_incantation
0:31.516 pyroblast Fluffy_Pillow 844514.0/1100000: 77% mana bloodlust, hot_streak, pyretic_incantation
0:32.533 fireball Fluffy_Pillow 833794.5/1100000: 76% mana bloodlust, heating_up
0:33.785 fireball Fluffy_Pillow 832452.5/1100000: 76% mana bloodlust, heating_up
0:35.037 pyroblast Fluffy_Pillow 831110.5/1100000: 76% mana bloodlust, hot_streak, pyretic_incantation
0:36.054 fireball Fluffy_Pillow 820391.0/1100000: 75% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:37.305 fireball Fluffy_Pillow 819032.5/1100000: 74% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:38.554 pyroblast Fluffy_Pillow 817641.0/1100000: 74% mana bloodlust, hot_streak, pyretic_incantation(2)
0:39.571 pyroblast Fluffy_Pillow 806921.5/1100000: 73% mana bloodlust, hot_streak, pyretic_incantation(4), kaelthas_ultimate_ability
0:40.765 pyroblast Fluffy_Pillow 799122.5/1100000: 73% mana heating_up, pyretic_incantation(5), kaelthas_ultimate_ability
0:44.723 fire_blast Fluffy_Pillow 836929.5/1100000: 76% mana heating_up, pyretic_incantation(5)
0:44.723 fireball Fluffy_Pillow 825929.5/1100000: 75% mana hot_streak, pyretic_incantation(5)
0:46.348 pyroblast Fluffy_Pillow 830742.0/1100000: 76% mana hot_streak, pyretic_incantation(5)
0:47.668 fireball Fluffy_Pillow 825022.0/1100000: 75% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
0:49.292 pyroblast Fluffy_Pillow 829818.0/1100000: 75% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
0:50.612 fireball Fluffy_Pillow 824098.0/1100000: 75% mana hot_streak, pyretic_incantation(3), kaelthas_ultimate_ability
0:52.236 pyroblast Fluffy_Pillow 828894.0/1100000: 75% mana hot_streak, pyretic_incantation(3), kaelthas_ultimate_ability
0:53.559 pyroblast Fluffy_Pillow 823223.5/1100000: 75% mana heating_up, kaelthas_ultimate_ability
0:57.516 fire_blast Fluffy_Pillow 861014.0/1100000: 78% mana heating_up
0:57.516 fireball Fluffy_Pillow 850014.0/1100000: 77% mana hot_streak, pyretic_incantation
0:59.142 pyroblast Fluffy_Pillow 854843.0/1100000: 78% mana hot_streak, pyretic_incantation(2)
1:00.464 fireball Fluffy_Pillow 849156.0/1100000: 77% mana heating_up
1:02.088 fireball Fluffy_Pillow 853952.0/1100000: 78% mana heating_up
1:03.712 fireball Fluffy_Pillow 858748.0/1100000: 78% mana enhanced_pyrotechnics
1:05.337 fireball Fluffy_Pillow 863560.5/1100000: 79% mana enhanced_pyrotechnics(2)
1:06.963 fireball Fluffy_Pillow 868389.5/1100000: 79% mana heating_up, pyretic_incantation
1:08.586 pyroblast Fluffy_Pillow 873169.0/1100000: 79% mana hot_streak, pyretic_incantation(2)
1:09.907 fireball Fluffy_Pillow 867465.5/1100000: 79% mana hot_streak, pyretic_incantation(4)
1:11.533 pyroblast Fluffy_Pillow 872294.5/1100000: 79% mana hot_streak, pyretic_incantation(4)
1:12.855 fireball Fluffy_Pillow 866607.5/1100000: 79% mana hot_streak, pyretic_incantation(5)
1:14.479 rune_of_power Fluffy_Pillow 871403.5/1100000: 79% mana hot_streak, pyretic_incantation(5)
1:15.799 combustion Fluffy_Pillow 893183.5/1100000: 81% mana hot_streak, pyretic_incantation(5), rune_of_power
1:15.799 potion Fluffy_Pillow 783183.5/1100000: 71% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
1:15.799 pyroblast Fluffy_Pillow 783183.5/1100000: 71% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:17.120 fire_blast Fluffy_Pillow 777480.0/1100000: 71% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:17.120 pyroblast Fluffy_Pillow 766480.0/1100000: 70% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:18.442 fire_blast Fluffy_Pillow 760793.0/1100000: 69% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:18.442 flame_on Fluffy_Pillow 749793.0/1100000: 68% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:18.442 pyroblast Fluffy_Pillow 749793.0/1100000: 68% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:19.764 fire_blast Fluffy_Pillow 744106.0/1100000: 68% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:19.764 pyroblast Fluffy_Pillow 733106.0/1100000: 67% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:21.085 fire_blast Fluffy_Pillow 727402.5/1100000: 66% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:21.085 pyroblast Fluffy_Pillow 716402.5/1100000: 65% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:22.406 phoenixs_flames Fluffy_Pillow 710699.0/1100000: 65% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:23.728 pyroblast Fluffy_Pillow 732512.0/1100000: 67% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:25.048 pyroblast Fluffy_Pillow 726792.0/1100000: 66% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:26.369 fireball Fluffy_Pillow 721088.5/1100000: 66% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:27.995 fireball Fluffy_Pillow 725917.5/1100000: 66% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:29.620 pyroblast Fluffy_Pillow 730730.0/1100000: 66% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:30.941 fireball Fluffy_Pillow 725026.5/1100000: 66% mana heating_up, potion_of_deadly_grace
1:32.565 fireball Fluffy_Pillow 729822.5/1100000: 66% mana heating_up, potion_of_deadly_grace
1:34.191 fireball Fluffy_Pillow 734651.5/1100000: 67% mana enhanced_pyrotechnics, potion_of_deadly_grace
1:35.815 fire_blast Fluffy_Pillow 739447.5/1100000: 67% mana heating_up, pyretic_incantation, potion_of_deadly_grace
1:35.815 pyroblast Fluffy_Pillow 728447.5/1100000: 66% mana hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:37.137 pyroblast Fluffy_Pillow 722760.5/1100000: 66% mana hot_streak, pyretic_incantation(4), kaelthas_ultimate_ability, potion_of_deadly_grace
1:38.459 pyroblast Fluffy_Pillow 717073.5/1100000: 65% mana heating_up, pyretic_incantation(5), kaelthas_ultimate_ability, potion_of_deadly_grace
1:42.416 fireball Fluffy_Pillow 754864.0/1100000: 69% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:44.042 fireball Fluffy_Pillow 759693.0/1100000: 69% mana potion_of_deadly_grace
1:45.666 fireball Fluffy_Pillow 764489.0/1100000: 69% mana enhanced_pyrotechnics, potion_of_deadly_grace
1:47.289 fire_blast Fluffy_Pillow 769268.5/1100000: 70% mana heating_up, pyretic_incantation
1:47.289 pyroblast Fluffy_Pillow 758268.5/1100000: 69% mana hot_streak, pyretic_incantation(2)
1:48.610 fireball Fluffy_Pillow 752565.0/1100000: 68% mana enhanced_pyrotechnics
1:50.234 fireball Fluffy_Pillow 757361.0/1100000: 69% mana enhanced_pyrotechnics
1:51.860 fireball Fluffy_Pillow 762190.0/1100000: 69% mana enhanced_pyrotechnics(2)
1:53.484 rune_of_power Fluffy_Pillow 766986.0/1100000: 70% mana heating_up, pyretic_incantation
1:54.805 fire_blast Fluffy_Pillow 788782.5/1100000: 72% mana enhanced_pyrotechnics, rune_of_power
1:54.805 phoenixs_flames Fluffy_Pillow 777782.5/1100000: 71% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
1:56.126 pyroblast Fluffy_Pillow 799579.0/1100000: 73% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
1:57.448 phoenixs_flames Fluffy_Pillow 793892.0/1100000: 72% mana enhanced_pyrotechnics, rune_of_power
1:58.769 fireball Fluffy_Pillow 815688.5/1100000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
2:00.395 phoenixs_flames Fluffy_Pillow 820517.5/1100000: 75% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
2:01.716 pyroblast Fluffy_Pillow 842314.0/1100000: 77% mana hot_streak, pyretic_incantation(3), rune_of_power
2:03.037 fire_blast Fluffy_Pillow 836610.5/1100000: 76% mana heating_up, pyretic_incantation(4), rune_of_power
2:03.037 pyroblast Fluffy_Pillow 825610.5/1100000: 75% mana hot_streak, pyretic_incantation(5), rune_of_power
2:04.358 pyroblast Fluffy_Pillow 819907.0/1100000: 75% mana hot_streak, rune_of_power
2:05.680 fireball Fluffy_Pillow 814220.0/1100000: 74% mana heating_up, pyretic_incantation
2:07.306 fireball Fluffy_Pillow 819049.0/1100000: 74% mana heating_up, pyretic_incantation
2:08.931 pyroblast Fluffy_Pillow 823861.5/1100000: 75% mana hot_streak, pyretic_incantation(2)
2:10.253 fireball Fluffy_Pillow 818174.5/1100000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:11.877 fireball Fluffy_Pillow 822970.5/1100000: 75% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:13.502 fireball Fluffy_Pillow 827783.0/1100000: 75% mana enhanced_pyrotechnics(2)
2:15.126 fire_blast Fluffy_Pillow 832579.0/1100000: 76% mana heating_up, pyretic_incantation
2:15.126 pyroblast Fluffy_Pillow 821579.0/1100000: 75% mana hot_streak, pyretic_incantation(2)
2:16.447 pyroblast Fluffy_Pillow 815875.5/1100000: 74% mana hot_streak, pyretic_incantation(4), kaelthas_ultimate_ability
2:17.769 pyroblast Fluffy_Pillow 810188.5/1100000: 74% mana heating_up, pyretic_incantation(5), kaelthas_ultimate_ability
2:21.726 fireball Fluffy_Pillow 847979.0/1100000: 77% mana heating_up, pyretic_incantation(5)
2:23.349 fireball Fluffy_Pillow 852758.5/1100000: 78% mana
2:24.973 fireball Fluffy_Pillow 857554.5/1100000: 78% mana enhanced_pyrotechnics
2:26.598 fireball Fluffy_Pillow 862367.0/1100000: 78% mana heating_up, pyretic_incantation
2:28.222 fireball Fluffy_Pillow 867163.0/1100000: 79% mana enhanced_pyrotechnics
2:29.846 fireball Fluffy_Pillow 871959.0/1100000: 79% mana heating_up, pyretic_incantation
2:31.472 pyroblast Fluffy_Pillow 876788.0/1100000: 80% mana hot_streak, pyretic_incantation(2)
2:32.794 pyroblast Fluffy_Pillow 871101.0/1100000: 79% mana heating_up, kaelthas_ultimate_ability
2:36.751 fireball Fluffy_Pillow 908891.5/1100000: 83% mana heating_up
2:38.375 rune_of_power Fluffy_Pillow 913687.5/1100000: 83% mana hot_streak, pyretic_incantation
2:39.696 combustion Fluffy_Pillow 935484.0/1100000: 85% mana enhanced_pyrotechnics, hot_streak, rune_of_power
2:39.696 use_item_wriggling_sinew Fluffy_Pillow 825484.0/1100000: 75% mana combustion, enhanced_pyrotechnics, hot_streak, rune_of_power
2:39.696 pyroblast Fluffy_Pillow 825484.0/1100000: 75% mana combustion, enhanced_pyrotechnics, hot_streak, rune_of_power, maddening_whispers(10)
2:41.018 fire_blast Fluffy_Pillow 819797.0/1100000: 75% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power, maddening_whispers(9)
2:41.018 pyroblast Fluffy_Pillow 808797.0/1100000: 74% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power, maddening_whispers(8)
2:42.339 fire_blast Fluffy_Pillow 803093.5/1100000: 73% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power, maddening_whispers(7)
2:42.339 flame_on Fluffy_Pillow 792093.5/1100000: 72% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(6)
2:42.339 pyroblast Fluffy_Pillow 792093.5/1100000: 72% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(6)
2:43.660 fire_blast Fluffy_Pillow 786390.0/1100000: 71% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(5)
2:43.660 pyroblast Fluffy_Pillow 775390.0/1100000: 70% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(4)
2:44.982 fire_blast Fluffy_Pillow 769703.0/1100000: 70% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers(3)
2:44.982 pyroblast Fluffy_Pillow 758703.0/1100000: 69% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power, maddening_whispers(2)
2:46.303 phoenixs_flames Fluffy_Pillow 752999.5/1100000: 68% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, maddening_whispers
2:47.624 pyroblast Fluffy_Pillow 774796.0/1100000: 70% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power
2:48.945 pyroblast Fluffy_Pillow 769092.5/1100000: 70% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power
2:50.266 fireball Fluffy_Pillow 763389.0/1100000: 69% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
2:51.890 fireball Fluffy_Pillow 768185.0/1100000: 70% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
2:53.515 pyroblast Fluffy_Pillow 772997.5/1100000: 70% mana hot_streak, pyretic_incantation(5)
2:54.836 fireball Fluffy_Pillow 767294.0/1100000: 70% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:56.460 fireball Fluffy_Pillow 772090.0/1100000: 70% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:58.084 fireball Fluffy_Pillow 776886.0/1100000: 71% mana enhanced_pyrotechnics(2)
2:59.710 fire_blast Fluffy_Pillow 781715.0/1100000: 71% mana heating_up, pyretic_incantation
2:59.710 pyroblast Fluffy_Pillow 770715.0/1100000: 70% mana hot_streak, pyretic_incantation(2)
3:01.033 fireball Fluffy_Pillow 765044.5/1100000: 70% mana hot_streak, pyretic_incantation(4)
3:02.657 pyroblast Fluffy_Pillow 769840.5/1100000: 70% mana hot_streak, pyretic_incantation(4)
3:03.977 fireball Fluffy_Pillow 764120.5/1100000: 69% mana heating_up
3:05.602 fireball Fluffy_Pillow 768933.0/1100000: 70% mana heating_up
3:07.224 fireball Fluffy_Pillow 773696.0/1100000: 70% mana enhanced_pyrotechnics
3:08.849 fireball Fluffy_Pillow 778508.5/1100000: 71% mana enhanced_pyrotechnics(2)
3:10.475 fireball Fluffy_Pillow 783337.5/1100000: 71% mana enhanced_pyrotechnics(3)
3:12.097 fire_blast Fluffy_Pillow 788100.5/1100000: 72% mana heating_up, pyretic_incantation
3:12.097 pyroblast Fluffy_Pillow 777100.5/1100000: 71% mana hot_streak, pyretic_incantation(2)
3:13.418 rune_of_power Fluffy_Pillow 771397.0/1100000: 70% mana enhanced_pyrotechnics
3:14.740 phoenixs_flames Fluffy_Pillow 793210.0/1100000: 72% mana enhanced_pyrotechnics, rune_of_power
3:16.063 fire_blast Fluffy_Pillow 815039.5/1100000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
3:16.063 pyroblast Fluffy_Pillow 804039.5/1100000: 73% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
3:17.384 phoenixs_flames Fluffy_Pillow 798336.0/1100000: 73% mana enhanced_pyrotechnics, rune_of_power
3:18.704 fireball Fluffy_Pillow 820116.0/1100000: 75% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
3:20.328 fireball Fluffy_Pillow 824912.0/1100000: 75% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
3:21.953 fireball Fluffy_Pillow 829724.5/1100000: 75% mana enhanced_pyrotechnics(2), rune_of_power
3:23.578 fireball Fluffy_Pillow 834537.0/1100000: 76% mana heating_up, pyretic_incantation, rune_of_power
3:25.203 pyroblast Fluffy_Pillow 839349.5/1100000: 76% mana hot_streak, pyretic_incantation(2)
3:26.525 fireball Fluffy_Pillow 833662.5/1100000: 76% mana hot_streak, pyretic_incantation(4)
3:28.149 pyroblast Fluffy_Pillow 838458.5/1100000: 76% mana hot_streak, pyretic_incantation(4)
3:29.472 fireball Fluffy_Pillow 832788.0/1100000: 76% mana heating_up
3:31.097 fireball Fluffy_Pillow 837600.5/1100000: 76% mana heating_up
3:32.722 pyroblast Fluffy_Pillow 842413.0/1100000: 77% mana hot_streak, pyretic_incantation
3:34.043 fireball Fluffy_Pillow 836709.5/1100000: 76% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
3:35.668 pyroblast Fluffy_Pillow 841522.0/1100000: 77% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation
3:36.990 fireball Fluffy_Pillow 835835.0/1100000: 76% mana hot_streak, pyretic_incantation(3)
3:38.616 pyroblast Fluffy_Pillow 840664.0/1100000: 76% mana hot_streak, pyretic_incantation(3)
3:39.937 fire_blast Fluffy_Pillow 834960.5/1100000: 76% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:39.937 fireball Fluffy_Pillow 823960.5/1100000: 75% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:41.562 pyroblast Fluffy_Pillow 828773.0/1100000: 75% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:42.885 fireball Fluffy_Pillow 823102.5/1100000: 75% mana hot_streak, pyretic_incantation(4)
3:44.510 pyroblast Fluffy_Pillow 827915.0/1100000: 75% mana hot_streak, pyretic_incantation(4)
3:45.828 fireball Fluffy_Pillow 822162.0/1100000: 75% mana enhanced_pyrotechnics
3:47.452 fireball Fluffy_Pillow 826958.0/1100000: 75% mana enhanced_pyrotechnics
3:49.078 fire_blast Fluffy_Pillow 831787.0/1100000: 76% mana heating_up, pyretic_incantation
3:49.078 pyroblast Fluffy_Pillow 820787.0/1100000: 75% mana hot_streak, pyretic_incantation(2)
3:50.400 fireball Fluffy_Pillow 815100.0/1100000: 74% mana hot_streak, pyretic_incantation(4)
3:52.025 pyroblast Fluffy_Pillow 819912.5/1100000: 75% mana hot_streak, pyretic_incantation(4)
3:53.347 fireball Fluffy_Pillow 814225.5/1100000: 74% mana hot_streak, pyretic_incantation(5)
3:54.973 pyroblast Fluffy_Pillow 819054.5/1100000: 74% mana hot_streak, pyretic_incantation(5)
3:56.294 fireball Fluffy_Pillow 813351.0/1100000: 74% mana hot_streak, pyretic_incantation(5)
3:57.917 rune_of_power Fluffy_Pillow 818130.5/1100000: 74% mana hot_streak, pyretic_incantation(5)
3:59.237 combustion Fluffy_Pillow 839910.5/1100000: 76% mana hot_streak, pyretic_incantation(5), rune_of_power
3:59.237 berserking Fluffy_Pillow 729910.5/1100000: 66% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
3:59.237 pyroblast Fluffy_Pillow 729910.5/1100000: 66% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:00.388 fire_blast Fluffy_Pillow 721402.0/1100000: 66% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power
4:00.388 flame_on Fluffy_Pillow 710402.0/1100000: 65% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:00.388 pyroblast Fluffy_Pillow 710402.0/1100000: 65% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:01.539 fire_blast Fluffy_Pillow 701893.5/1100000: 64% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power
4:01.539 pyroblast Fluffy_Pillow 690893.5/1100000: 63% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:02.688 pyroblast Fluffy_Pillow 682352.0/1100000: 62% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:03.838 fire_blast Fluffy_Pillow 673827.0/1100000: 61% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power
4:03.838 pyroblast Fluffy_Pillow 662827.0/1100000: 60% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:04.991 phoenixs_flames Fluffy_Pillow 654351.5/1100000: 59% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power
4:06.142 pyroblast Fluffy_Pillow 673343.0/1100000: 61% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:07.293 pyroblast Fluffy_Pillow 664834.5/1100000: 60% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:08.443 pyroblast Fluffy_Pillow 656309.5/1100000: 60% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:11.883 fireball Fluffy_Pillow 685569.5/1100000: 62% mana heating_up, pyretic_incantation(5)
4:13.507 pyroblast Fluffy_Pillow 690365.5/1100000: 63% mana hot_streak, pyretic_incantation(5)
4:14.828 fireball Fluffy_Pillow 684662.0/1100000: 62% mana hot_streak, pyretic_incantation(5)
4:16.452 pyroblast Fluffy_Pillow 689458.0/1100000: 63% mana hot_streak, pyretic_incantation(5)
4:17.773 fire_blast Fluffy_Pillow 683754.5/1100000: 62% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:17.773 fireball Fluffy_Pillow 672754.5/1100000: 61% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
4:19.398 pyroblast Fluffy_Pillow 677567.0/1100000: 62% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
4:20.721 fireball Fluffy_Pillow 671896.5/1100000: 61% mana hot_streak, pyretic_incantation(4)
4:22.346 pyroblast Fluffy_Pillow 676709.0/1100000: 62% mana hot_streak, pyretic_incantation(4)
4:23.670 pyroblast Fluffy_Pillow 671055.0/1100000: 61% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, kaelthas_ultimate_ability
4:27.628 fire_blast Fluffy_Pillow 708862.0/1100000: 64% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:27.628 fireball Fluffy_Pillow 697862.0/1100000: 63% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
4:29.252 pyroblast Fluffy_Pillow 702658.0/1100000: 64% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(3)
4:30.572 fireball Fluffy_Pillow 696938.0/1100000: 63% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
4:32.196 fireball Fluffy_Pillow 701734.0/1100000: 64% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation
4:33.819 rune_of_power Fluffy_Pillow 706513.5/1100000: 64% mana hot_streak, pyretic_incantation(2)
4:35.140 pyroblast Fluffy_Pillow 728310.0/1100000: 66% mana hot_streak, pyretic_incantation(3), rune_of_power
4:36.461 fire_blast Fluffy_Pillow 722606.5/1100000: 66% mana rune_of_power
4:36.461 phoenixs_flames Fluffy_Pillow 711606.5/1100000: 65% mana heating_up, pyretic_incantation, rune_of_power
4:37.784 pyroblast Fluffy_Pillow 733436.0/1100000: 67% mana hot_streak, pyretic_incantation(2), rune_of_power
4:39.104 phoenixs_flames Fluffy_Pillow 727716.0/1100000: 66% mana heating_up, pyretic_incantation(3), rune_of_power
4:40.426 pyroblast Fluffy_Pillow 749529.0/1100000: 68% mana hot_streak, pyretic_incantation(4), rune_of_power
4:41.748 fireball Fluffy_Pillow 743842.0/1100000: 68% mana rune_of_power
4:43.373 fire_blast Fluffy_Pillow 748654.5/1100000: 68% mana rune_of_power
4:43.373 fireball Fluffy_Pillow 737654.5/1100000: 67% mana heating_up, pyretic_incantation, rune_of_power
4:44.997 fireball Fluffy_Pillow 742450.5/1100000: 67% mana enhanced_pyrotechnics, rune_of_power
4:46.620 rune_of_power Fluffy_Pillow 747230.0/1100000: 68% mana enhanced_pyrotechnics(2)
4:47.941 flame_on Fluffy_Pillow 769026.5/1100000: 70% mana enhanced_pyrotechnics(3), rune_of_power
4:47.941 fire_blast Fluffy_Pillow 769026.5/1100000: 70% mana enhanced_pyrotechnics(3), rune_of_power
4:47.941 fireball Fluffy_Pillow 758026.5/1100000: 69% mana enhanced_pyrotechnics(3), heating_up, pyretic_incantation, rune_of_power
4:49.564 fire_blast Fluffy_Pillow 762806.0/1100000: 69% mana enhanced_pyrotechnics(3), heating_up, pyretic_incantation, rune_of_power
4:49.564 pyroblast Fluffy_Pillow 751806.0/1100000: 68% mana enhanced_pyrotechnics(3), hot_streak, pyretic_incantation(2), rune_of_power
4:50.886 pyroblast Fluffy_Pillow 746119.0/1100000: 68% mana hot_streak, pyretic_incantation(4), rune_of_power
4:52.208 fireball Fluffy_Pillow 740432.0/1100000: 67% mana heating_up, pyretic_incantation(5), rune_of_power
4:53.831 fireball Fluffy_Pillow 745211.5/1100000: 68% mana heating_up, pyretic_incantation(5), rune_of_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4876 4551 0
Agility 6579 6254 0
Stamina 41665 41665 25791
Intellect 37385 35678 26656 (965)
Spirit 1 1 0
Health 2499900 2499900 0
Mana 1100000 1100000 0
Spell Power 37385 35678 0
Crit 38.15% 37.07% 11226
Haste 13.81% 13.81% 4488
Damage / Heal Versatility 3.79% 3.79% 1515
ManaReg per Second 16500 16500 0
Mastery 12.42% 12.42% 2995
Armor 1817 1817 1817
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Sorcerous Shadowruby Pendant of the Fireflash
ilevel: 850, stats: { +1094 Sta, +1101 Crit, +734 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Maddening Robe of Secrets
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +981 Mastery, +479 Crit }
Local Waist Pliable Spider Silk Cinch
ilevel: 880, stats: { 163 Armor, +1930 Sta, +1287 Int, +689 Mastery, +406 Crit }
Local Legs Leggings of the Lower Planes
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +1012 Crit, +448 Haste }
Local Feet Crimson Wool-Lined Slippers
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +689 Crit, +406 Mastery }
Local Wrists Marquee Bindings of the Sun King
ilevel: 895, stats: { 134 Armor, +1665 Sta, +1110 Int, +559 Crit, +310 Haste }
Local Hands Oiled Rigger's Handwraps
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Crit, +383 Vers }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Wriggling Sinew
ilevel: 880, stats: { +1043 Crit }
Local Back Windwhipped Sailcloth
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +569 Crit, +252 Vers }, enchant: { +200 Int }
Local Main Hand Felo'melorn
ilevel: 906, weapon: { 2776 - 5157, 2.6 }, stats: { +937 Int, +1405 Sta, +345 Haste, +345 Mastery, +11921 Int }
Local Off Hand Heart of the Phoenix
ilevel: 906, stats: { +1230 Int, +1844 Sta, +627 Haste, +278 Crit }

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Mage_Fire_T19M"
level=110
race=troll
role=spell
position=back
talents=1022021
artifact=54:133022:140813:133022:0:748:1:749:6:750:3:751:3:752:3:753:3:754:3:755:3:756:3:757:3:758:1:759:1:760:1:761:1:762:1:763:1:1340:1
spec=fire

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/use_item,slot=neck
actions.combustion_phase+=/use_item,slot=trinket2
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=sorcerous_shadowruby_pendant,id=130233,bonus_id=1758/689/601/669,gem_id=130219,enchant_id=5439
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=windwhipped_sailcloth,id=142412,bonus_id=1502,enchant=binding_of_intellect
chest=maddening_robe_of_secrets,id=139193,bonus_id=1806
wrists=marquee_bindings_of_the_sun_king,id=132406
hands=oiled_riggers_handwraps,id=142429,bonus_id=1502
waist=pliable_spider_silk_cinch,id=138217,bonus_id=1806
legs=leggings_of_the_lower_planes,id=142413,bonus_id=1502
feet=crimson_woollined_slippers,id=139195,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=binding_of_crit
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_crit
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=wriggling_sinew,id=139326,bonus_id=1806
main_hand=felomelorn,id=128820,ilevel=906
off_hand=heart_of_the_phoenix,id=133959,ilevel=906

# Gear Summary
# gear_ilvl=882.31
# gear_stamina=25791
# gear_intellect=26656
# gear_crit_rating=11226
# gear_haste_rating=4488
# gear_mastery_rating=2995
# gear_versatility_rating=1515
# gear_armor=1817

Mage_Frost_T19M : 436509 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
436508.7 436508.7 272.8 / 0.062% 47106.7 / 10.8% 35.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
10957.9 10957.9 Mana 0.00% 49.4 100.0% 100%
Talents
  • 15: Ray of Frost (Frost Mage)
  • 30: Shimmer
  • 45: Rune of Power
  • 60: Ice Nova (Frost Mage)
  • 75: Ice Floes
  • 90: Frost Bomb (Frost Mage)
  • 100: Comet Storm (Frost Mage)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mage_Frost_T19M 436509
Blizzard 8354 1.9% 8.4 11.66sec 294155 273309 Periodic 66.3 25378 50474 37223 47.2% 12.0%

Stats details: blizzard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.39 0.00 66.32 66.32 1.0763 0.5446 2468799.05 2468799.05 0.00 54676.30 273308.87
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.0 52.80% 25377.71 2164 34323 25399.92 21734 29899 888741 888741 0.00
crit 31.3 47.20% 50474.42 4329 68645 50520.93 42313 58765 1580058 1580058 0.00
 
 

Action details: blizzard

Static Values
  • id:190356
  • school:frost
  • resource:mana
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.potion_of_deadly_grace.up&!prev_off_gcd.water_jet
Spelldata
  • id:190356
  • name:Blizzard
  • school:frost
  • tooltip:
  • description:Ice shards pelt the target area, dealing ${$190357m1*8} Frost damage over $10d and reducing movement speed by {$205708s1=50}% for {$205708d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: blizzard_shard

Static Values
  • id:190357
  • school:frost
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190357
  • name:Blizzard
  • school:frost
  • tooltip:
  • description:{$@spelldesc190356=Ice shards pelt the target area, dealing ${$190357m1*8} Frost damage over $10d and reducing movement speed by {$205708s1=50}% for {$205708d=15 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.495000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Comet Storm 0 (13479) 0.0% (3.1%) 9.1 32.96sec 445319 438870

Stats details: comet_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.09 0.00 54.39 0.00 1.0148 0.2000 0.00 0.00 0.00 201320.53 438869.58
 
 

Action details: comet_storm

Static Values
  • id:153595
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:153595
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:Calls down a series of 7 icy comets on and around the target, each of which deals {$153596s1=1} Frost damage to all enemies within 4 yards of its impact.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.20
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Comet Storm (_projectile) 13479 3.1% 63.5 4.29sec 63741 0 Direct 63.3 48598 97137 63937 31.6%  

Stats details: comet_storm_projectile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.47 63.28 0.00 0.00 0.0000 0.0000 4045938.66 4045938.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.28 68.40% 48597.67 40449 72808 48676.74 41947 59815 2103314 2103314 0.00
crit 20.00 31.60% 97137.34 80897 145615 97303.55 80897 128896 1942625 1942625 0.00
 
 

Action details: comet_storm_projectile

Static Values
  • id:153596
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:153596
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:{$@spelldesc153595=Calls down a series of 7 icy comets on and around the target, each of which deals {$153596s1=1} Frost damage to all enemies within 4 yards of its impact.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.050000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 21023 4.7% 40.6 2.18sec 153170 0 Direct 40.6 116568 233053 153168 31.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.56 40.56 0.00 0.00 0.0000 0.0000 6212671.85 6212671.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.82 68.58% 116567.74 81867 147360 116562.64 98240 132103 3242471 3242471 0.00
crit 12.74 31.42% 233053.44 163734 294721 233056.17 163734 294721 2970200 2970200 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Ebonbolt 10422 2.4% 5.9 52.04sec 531164 265470 Direct 5.9 404397 812178 532635 31.5%  

Stats details: ebonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.89 5.88 0.00 0.00 2.0010 0.0000 3130958.92 3130958.92 0.00 265470.49 265470.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.03 68.55% 404396.55 346694 624049 403713.00 0 624049 1629481 1629481 0.00
crit 1.85 31.45% 812178.32 693388 1248099 725250.88 0 1248099 1501478 1501478 0.00
 
 

Action details: ebonbolt

Static Values
  • id:214634
  • school:shadowfrost
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
Spelldata
  • id:214634
  • name:Ebonbolt
  • school:shadowfrost
  • tooltip:
  • description:Deals {$228599s1=0} Shadowfrost damage and grants two charges of Fingers of Frost.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flurry (_bolt) 20992 4.8% 33.8 7.49sec 187752 0 Direct 33.8 110248 220766 187751 70.1%  

Stats details: flurry_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.77 33.77 0.00 0.00 0.0000 0.0000 6339472.64 6339472.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.09 29.87% 110248.47 101205 182168 110169.75 101205 151807 1112083 1112083 0.00
crit 23.68 70.13% 220766.12 202409 364337 220618.02 202409 288433 5227390 5227390 0.00
 
 

Action details: flurry_bolt

Static Values
  • id:228354
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228354
  • name:Flurry
  • school:frost
  • tooltip:Movement slowed by {$s2=70}%.
  • description:{$@spelldesc44614=Unleash a flurry of ice shards, striking the target {$s1=3} times for a total of ${{$228354s1=0 to 2}*$m1} Frost damage. Each shard reduces the target's movement speed by {$228354s2=70}% for {$228354d=1 second}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.523000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
Frost Bomb (_explosion) 21281 4.9% 66.0 4.30sec 96994 0 Direct 66.0 71431 140727 96994 36.9%  

Stats details: frost_bomb_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.98 65.98 0.00 0.00 0.0000 0.0000 6399795.44 6399795.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.64 63.11% 71430.78 60671 109209 71477.65 63429 79851 2974434 2974434 0.00
crit 24.34 36.89% 140727.04 121343 218417 140793.46 121343 171747 3425361 3425361 0.00
 
 

Action details: frost_bomb_explosion

Static Values
  • id:113092
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113092
  • name:Frost Bomb
  • school:frost
  • tooltip:Slowed by $113092s3%.
  • description:{$@spelldesc112948=Places a Frost Bomb on the target for {$d=12 seconds}. Limit 1 target. Your Ice Lances that benefit from Shatter will trigger the release of a wave of freezing ice, dealing {$113092s1=0} Frost damage to the target and {$113092s2=0} Frost damage to all other enemies within $113092A2 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.575000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Frostbolt 38144 (55771) 8.8% (12.8%) 75.1 3.67sec 223846 165597 Direct 75.8 98634 196128 151696 54.4%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.14 75.83 0.00 0.00 1.3518 0.0000 11502431.37 11502431.37 0.00 165597.20 165597.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.56 45.57% 98633.91 88985 160173 98619.01 88985 111691 3408527 3408527 0.00
crit 41.27 54.43% 196128.34 177970 320345 196025.97 177970 216859 8093905 8093905 0.00
 
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=1} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.100000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Icicle 17627 4.1% 89.6 3.21sec 59337 0 Direct 89.1 59694 0 59694 0.0%  

Stats details: icicle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.60 89.07 0.00 0.00 0.0000 0.0000 5316613.39 5316613.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.07 100.00% 59694.01 29292 210900 59679.75 47826 74980 5316613 5316613 0.00
 
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt, ${$m1}.1% of the damage done is stored as an Icicle for {$148012d=60 seconds}. Also increases the damage done by your Water Elemental by ${$m3}.1%. Casting Ice Lance causes any Icicles stored to begin launching at the target. Up to {$s2=5} Icicles can be stored. Excess Icicles will automatically be launched. }
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:42491.59
  • base_dd_max:42491.59
 
Frozen Orb 0 (5379) 0.0% (1.2%) 5.1 61.61sec 315803 322209

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.11 0.00 100.21 0.00 0.9801 0.5000 0.00 0.00 0.00 29303.95 322208.99
 
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches an orb of swirling ice up to {$s1=40} yards forward which deals up to ${20*$84721s2} Frost damage to all enemies it passes through. Grants 1 charge of Fingers of Frost when it first damages an enemy. Enemies damaged by the Frost Orb are slowed by {$205708s1=50}% for {$205708d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Frozen Orb (_bolt) 5379 1.2% 0.0 0.00sec 0 0 Periodic 100.2 12263 24516 16118 31.5% 0.0%

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 100.21 0.0000 0.0000 1615233.65 1615233.65 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.7 68.54% 12263.15 10132 18238 12286.97 10610 15619 842340 842340 0.00
crit 31.5 31.46% 24515.85 20264 36476 24559.01 20827 31955 772894 772894 0.00
 
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=1}%.
  • description:{$@spelldesc84714=Launches an orb of swirling ice up to {$s1=40} yards forward which deals up to ${20*$84721s2} Frost damage to all enemies it passes through. Grants 1 charge of Fingers of Frost when it first damages an enemy. Enemies damaged by the Frost Orb are slowed by {$205708s1=50}% for {$205708d=15 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.263000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Ice Lance 68703 15.8% 70.0 4.07sec 295227 293639 Direct 69.8 101018 337053 296023 82.6%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.02 69.83 0.00 0.00 1.0054 0.0000 20671633.20 20671633.20 0.00 293639.50 293639.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.14 17.38% 101018.09 34400 297214 100596.82 43000 170795 1226293 1226293 0.00
crit 57.69 82.62% 337053.42 82559 713313 337213.78 293761 397317 19445340 19445340 0.00
 
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=0&prev_gcd.flurry
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Quickly fling a shard of ice at the target, dealing {$228598s1=0} Frost damage{$?s56377=false}[, and ${{$228598s1=0}*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is tripled against frozen targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.893000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Ice Nova 20304 4.7% 10.4 28.92sec 588566 597443 Direct 10.4 431541 823794 588559 40.0%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.36 10.36 0.00 0.00 0.9852 0.0000 6099296.02 6099296.02 0.00 597443.04 597443.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.21 59.97% 431540.65 346696 624053 433249.21 0 624053 2681849 2681849 0.00
crit 4.15 40.03% 823794.50 693392 1248106 815462.39 0 1248106 3417447 3417447 0.00
 
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.winters_chill.up
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=1} Frost damage to all enemies within $A2 yards, and freezing them in place for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Maddening Whispers 12087 2.7% 2.9 115.86sec 1254570 0 Direct 2.9 952363 1903457 1254538 31.8%  

Stats details: maddening_whispers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 2.87 0.00 0.00 0.0000 0.0000 3601262.77 3601262.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.96 68.22% 952362.74 727664 1309795 915318.89 0 1309795 1865174 1865174 0.00
crit 0.91 31.78% 1903456.89 1455328 2619591 1265557.16 0 2619591 1736089 1736089 0.00
 
 

Action details: maddening_whispers

Static Values
  • id:222050
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222050
  • name:Maddening Whispers
  • school:shadow
  • tooltip:Deals {$222046s1=36653} Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70372.42
  • base_dd_max:70372.42
 
Mark of the Hidden Satyr 10521 2.4% 21.4 14.18sec 148007 0 Direct 21.4 112402 225225 148003 31.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.37 21.37 0.00 0.00 0.0000 0.0000 3163103.96 3163103.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.63 68.44% 112401.77 89706 161470 112380.78 89706 149937 1644189 1644189 0.00
crit 6.74 31.56% 225224.95 179412 322941 225053.06 0 322941 1518915 1518915 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Plague Swarm 17741 4.1% 17.2 17.50sec 310147 0 Periodic 75.7 53565 107206 70458 31.5% 49.5%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.20 0.00 75.70 75.70 0.0000 1.9661 5334004.26 5334004.26 0.00 35837.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.9 68.51% 53565.04 23 81338 53593.17 44382 63656 2778028 2778028 0.00
crit 23.8 31.49% 107206.27 90 162677 107273.81 83821 137690 2555976 2555976 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ray of Frost 99589 22.8% 4.5 72.61sec 6640913 654079 Periodic 86.6 262754 525290 345628 31.6% 14.8%

Stats details: ray_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.51 0.00 86.57 86.57 10.1532 0.5154 29920858.67 29920858.67 0.00 654079.32 654079.32
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.2 68.43% 262754.28 66479 404176 261923.85 219932 302737 15566028 15566028 0.00
crit 27.3 31.57% 525289.92 132957 808352 523674.18 301102 654865 14354831 14354831 0.00
 
 

Action details: ray_of_frost

Static Values
  • id:205021
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icy_veins.up|(cooldown.icy_veins.remains>action.ray_of_frost.cooldown&buff.rune_of_power.down)
Spelldata
  • id:205021
  • name:Ray of Frost
  • school:frost
  • tooltip:Movement slowed by $m1% and taking {$s2=0} Frost damage every $t2 sec.
  • description:For the next {$d=10 seconds}, you can channel a beam of icy power at an enemy, slowing movement by $m1% and dealing {$s2=0} Frost damage every $t2 sec. Each time Ray of Frost deals damage, its damage increases by {$208141s1=20}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.943000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
sorcerous_arcane_blast 1267 0.3% 0.5 303.37sec 794618 0 Direct 0.5 721951 1469410 794618 9.7%  

Stats details: sorcerous_arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.48 0.48 0.00 0.00 0.0000 0.0000 384752.17 384752.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.44 90.28% 721950.79 446233 803220 288561.15 0 803220 315583 315583 0.00
crit 0.05 9.72% 1469410.22 892467 1606441 68443.49 0 1606441 69169 69169 0.00
 
 

Action details: sorcerous_arcane_blast

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:431550.00
  • base_dd_max:431550.00
 
sorcerous_fireball 2044 0.5% 0.5 303.08sec 1237403 0 Direct 0.5 416259 827155 458002 10.1%  
Periodic 6.2 63325 0 63325 0.0% 0.8%

Stats details: sorcerous_fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.50 0.50 6.19 6.19 0.0000 0.4020 621754.39 621754.39 0.00 250102.33 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.45 89.86% 416258.73 254991 458983 171174.19 0 458983 187946 187946 0.00
crit 0.05 10.14% 827154.77 509981 917966 41626.81 0 917966 42123 42123 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.2 100.00% 63324.81 1572 68847 28267.82 0 68847 391685 391685 0.00
 
 

Action details: sorcerous_fireball

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:246600.00
  • base_dd_max:246600.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:36990.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
sorcerous_frostbolt 1206 0.3% 0.5 302.74sec 759270 0 Direct 0.5 684042 1368072 759270 11.0%  

Stats details: sorcerous_frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.48 0.48 0.00 0.00 0.0000 0.0000 367333.31 367333.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.43 89.00% 684042.00 420734 757322 269698.68 0 757322 294542 294542 0.00
crit 0.05 11.00% 1368072.31 841469 1514644 71904.69 0 1514644 72791 72791 0.00
 
 

Action details: sorcerous_frostbolt

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:406890.00
  • base_dd_max:406890.00
 
pet - water_elemental 46346 / 46346
Water Jet 4791 1.1% 9.1 31.77sec 158443 47310 Periodic 36.2 30347 60683 39873 31.4% 8.1%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.10 0.00 36.17 36.17 3.3491 0.6736 1442233.65 1442233.65 0.00 47309.62 47309.62
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.8 68.60% 30346.86 27111 40667 30385.83 27111 36149 753002 753002 0.00
crit 11.4 31.40% 60683.10 54223 81334 60724.77 0 81334 689231 689231 0.00
 
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking $w1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, {$?s198146=false}[slowing the target by $m2% and ][]dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.706000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Waterbolt 41555 9.5% 165.2 1.81sec 75624 47719 Direct 164.2 57861 115681 76083 31.5%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 165.18 164.18 0.00 0.00 1.5848 0.0000 12491418.48 12491418.48 0.00 47719.24 47719.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.44 68.49% 57861.45 49922 74883 57863.51 55271 60474 6506042 6506042 0.00
crit 51.74 31.51% 115680.64 99844 149766 115681.76 105391 128208 5985377 5985377 0.00
 
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals ${{$s1=0}*0.75} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Mage_Frost_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Frost_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.59sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.05 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Frost_T19M
  • harmful:false
  • if_expr:
 
Flurry 11.3 23.85sec

Stats details: flurry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.31 0.00 33.77 0.00 1.0176 0.2000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flurry

Static Values
  • id:44614
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react&buff.fingers_of_frost.react=0&prev_gcd.frostbolt
Spelldata
  • id:44614
  • name:Flurry
  • school:frost
  • tooltip:
  • description:Unleash a flurry of ice shards, striking the target {$s1=3} times for a total of ${{$228354s1=0 to 2}*$m1} Frost damage. Each shard reduces the target's movement speed by {$228354s2=70}% for {$228354d=1 second}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:0.60
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Frost_T19M
  • harmful:false
  • if_expr:
 
Frost Bomb 16.6 17.73sec

Stats details: frost_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.56 0.00 55.54 0.00 1.0066 3.4810 0.00 0.00 0.00 0.00 0.00
 
 

Action details: frost_bomb

Static Values
  • id:112948
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:13750.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.frost_bomb.remains<action.ice_lance.travel_time&buff.fingers_of_frost.react>0
Spelldata
  • id:112948
  • name:Frost Bomb
  • school:frost
  • tooltip:The Mage's Ice Lances that hit the target while frozen will cause the Frost Bomb to release a wave of freezing ice that deals {$113092s1=0} Frost damage to the target, {$113092s2=0} Frost damage to all other enemies within $113092A2 yards.
  • description:Places a Frost Bomb on the target for {$d=12 seconds}. Limit 1 target. Your Ice Lances that benefit from Shatter will trigger the release of a wave of freezing ice, dealing {$113092s1=0} Frost damage to the target and {$113092s2=0} Frost damage to all other enemies within $113092A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:6.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Icy Veins 2.5 149.81sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.icy_veins.down
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:Haste increased by $w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=20 seconds}, granting $m1% haste and preventing damage from delaying your spellcasts.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.9 36.84sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.89 0.00 0.00 0.00 0.9713 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.icy_veins.remains<cast_time|charges_fractional>1.9&cooldown.icy_veins.remains>10|buff.icy_veins.up|target.time_to_die.remains+5<charges_fractional*10
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 
Time Warp 2.5 262.03sec

Stats details: time_warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: time_warp

Static Values
  • id:80353
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:44000.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
Spelldata
  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by {$s1=30}%.
  • description:Warp the flow of time, increasing haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.
 
Summon Water Elemental (water_elemental) 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to follow and fight for you.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.1 0.0 180.6sec 180.6sec 6.83% 14.55% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 2.5 1.0 112.1sec 262.1sec 30.89% 40.61% 1.0(1.0) 2.2

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:30.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Brain Freeze 13.4 4.1 21.0sec 15.6sec 24.90% 24.90% 4.1(4.1) 1.8

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_brain_freeze
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • brain_freeze_1:24.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190446
  • name:Brain Freeze
  • tooltip:Your next Flurry is instant cast$?a231584[,][ and] deals {$s2=50}% increased damage$?a231584[, and will cause Winter's Chill on the target][].
  • description:{$@spelldesc190447=Frostbolt has a $m1% chance to empower your next Flurry to be instant cast$?a231584[,][ and] deal {$190446s2=50}% increased damage$?a231584[, and apply Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen][].}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Chain Reaction 15.6 25.7 18.8sec 6.9sec 54.49% 55.99% 10.4(10.4) 14.9

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_chain_reaction
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • chain_reaction_1:20.58%
  • chain_reaction_2:12.90%
  • chain_reaction_3:21.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:195418
  • name:Chain Reaction
  • tooltip:Increases the damage of your Ice Lance by $m1%.
  • description:Increases the damage of your Ice Lance by $m1%.
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Chilled to the Core 2.5 0.0 149.8sec 149.8sec 16.02% 16.02% 0.0(0.0) 2.3

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_chilled_to_the_core
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chilled_to_the_core_1:16.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:195446
  • name:Chilled to the Core
  • tooltip:Increases Frost damage by {$s1=20}%.
  • description:Increases Frost damage by {$s1=20}%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Fingers of Frost 30.7 31.2 9.6sec 4.7sec 45.07% 88.41% 4.2(4.3) 0.5

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_fingers_of_frost
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • fingers_of_frost_1:23.37%
  • fingers_of_frost_2:14.69%
  • fingers_of_frost_3:7.01%

Trigger Attempt Success

  • trigger_pct:22.05%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance deals damage as if the target were frozen.
  • description:{$@spelldesc112965=Frostbolt and Frozen Orb damage have a {$s1=12}% chance, and Blizzard damage has a {$s2=5}% chance, to grant a charge of Fingers of Frost. Fingers of Frost causes your next Ice Lance to deal damage as if the target were frozen. Maximum {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Icicle (s) 34.2 57.1 8.9sec 3.1sec 47.28% 47.28% 7.4(7.4) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_icicles
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • icicles_1:20.34%
  • icicles_2:10.46%
  • icicles_3:6.20%
  • icicles_4:3.90%
  • icicles_5:6.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:148012
  • name:Icicle
  • tooltip:Icicle storing $w1 damage.
  • description:$@spelldesc148011
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Veins 2.5 0.0 149.8sec 149.8sec 16.02% 16.02% 0.0(0.0) 2.3

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • icy_veins_1:16.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:Haste increased by $w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=20 seconds}, granting $m1% haste and preventing damage from delaying your spellcasts.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Maddening Whispers 3.0 0.0 120.6sec 120.6sec 13.06% 13.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.77%
  • maddening_whispers_2:0.75%
  • maddening_whispers_3:0.83%
  • maddening_whispers_4:0.90%
  • maddening_whispers_5:0.95%
  • maddening_whispers_6:0.92%
  • maddening_whispers_7:0.79%
  • maddening_whispers_8:0.92%
  • maddening_whispers_9:5.35%
  • maddening_whispers_10:0.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222046
  • name:Maddening Whispers
  • tooltip:Your damaging spells transfer a Maddening Whisper to the target. When all Whispers have been applied, each deals $s~1 Shadow damage.
  • description:Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.
  • max_stacks:10
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 58.3sec 0.0sec 19.62% 19.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Ray of Frost 4.5 0.0 72.6sec 72.6sec 14.91% 14.91% 41.8(41.8) 4.4

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_ray_of_frost
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • ray_of_frost_1:0.84%
  • ray_of_frost_2:0.84%
  • ray_of_frost_3:0.84%
  • ray_of_frost_4:0.84%
  • ray_of_frost_5:0.84%
  • ray_of_frost_6:0.84%
  • ray_of_frost_7:0.83%
  • ray_of_frost_8:0.83%
  • ray_of_frost_9:0.83%
  • ray_of_frost_10:6.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208141
  • name:Ray of Frost
  • tooltip:Ray of Frost damage increased by {$s1=20}%.
  • description:{$@spelldesc205021=For the next {$d=10 seconds}, you can channel a beam of icy power at an enemy, slowing movement by $m1% and dealing {$s2=0} Frost damage every $t2 sec. Each time Ray of Frost deals damage, its damage increases by {$208141s1=20}%.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 36.8sec 36.8sec 28.55% 28.55% 0.0(0.0) 8.2

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frost Armor

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Haste increased by $7302w1%. Movement speed of attackers is slowed.
  • description:Increases Haste by {$s1=8}% and causes enemies who strike you to have movement speed slowed by $205708s2% for {$205708d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Frost_T19M
blizzard Mana 8.4 230807.9 27500.0 27500.5 10.7
comet_storm Mana 9.1 99941.5 11000.0 11000.1 40.5
flurry Mana 11.3 124450.6 11000.0 10999.7 0.0
frost_bomb Mana 16.6 227719.1 13750.0 13750.0 0.0
frostbolt Mana 76.1 1675003.3 22000.0 22292.7 10.0
frozen_orb Mana 5.1 56261.2 11000.0 10999.9 28.7
ice_lance Mana 70.0 770218.5 11000.0 11000.1 26.8
time_warp Mana 2.5 108964.7 44000.0 43997.7 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 769.80 3274544.14 (100.00%) 4253.77 1673924.85 33.83%
Resource RPS-Gain RPS-Loss
Mana 10895.27 10957.90
Combat End Resource Mean Min Max
Mana 1081531.92 986386.50 1100000.00

Benefits & Uptimes

Benefits %
Ray of Frost Ray of Frost 0 5.2%
Ray of Frost Ray of Frost 1 5.2%
Ray of Frost Ray of Frost 2 5.2%
Ray of Frost Ray of Frost 3 5.2%
Ray of Frost Ray of Frost 4 5.2%
Ray of Frost Ray of Frost 5 5.2%
Ray of Frost Ray of Frost 6 5.2%
Ray of Frost Ray of Frost 7 5.2%
Ray of Frost Ray of Frost 8 5.2%
Ray of Frost Ray of Frost 9 5.2%
Ray of Frost Ray of Frost 10 48.2%
Fingers of Frost from Frostbolt 13.4%
Fingers of Frost from Water Jet 26.9%
Fingers of Frost from Blizzard 5.0%
Fingers of Frost from Frozen Orb Initial Impact 7.6%
Fingers of Frost from Frozen Orb Tick 17.7%
Fingers of Frost from Ebonbolt 17.5%
Fingers of Frost from Waterbolt 12.0%
Uptimes %
Mana Cap 23.9%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Mage_Frost_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Mage_Frost_T19M Damage Per Second
Count 7499
Mean 436508.72
Minimum 396315.98
Maximum 475443.88
Spread ( max - min ) 79127.90
Range [ ( max - min ) / 2 * 100% ] 9.06%
Standard Deviation 12053.1642
5th Percentile 416619.46
95th Percentile 456132.73
( 95th Percentile - 5th Percentile ) 39513.27
Mean Distribution
Standard Deviation 139.1872
95.00% Confidence Intervall ( 436235.92 - 436781.52 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2928
0.1 Scale Factor Error with Delta=300 1240183
0.05 Scale Factor Error with Delta=300 4960732
0.01 Scale Factor Error with Delta=300 124018311
Priority Target DPS
Sample Data Mage_Frost_T19M Priority Target Damage Per Second
Count 7499
Mean 436508.72
Minimum 396315.98
Maximum 475443.88
Spread ( max - min ) 79127.90
Range [ ( max - min ) / 2 * 100% ] 9.06%
Standard Deviation 12053.1642
5th Percentile 416619.46
95th Percentile 456132.73
( 95th Percentile - 5th Percentile ) 39513.27
Mean Distribution
Standard Deviation 139.1872
95.00% Confidence Intervall ( 436235.92 - 436781.52 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2928
0.1 Scale Factor Error with Delta=300 1240183
0.05 Scale Factor Error with Delta=300 4960732
0.01 Scale Factor Error with Delta=300 124018311
DPS(e)
Sample Data Mage_Frost_T19M Damage Per Second (Effective)
Count 7499
Mean 436508.72
Minimum 396315.98
Maximum 475443.88
Spread ( max - min ) 79127.90
Range [ ( max - min ) / 2 * 100% ] 9.06%
Damage
Sample Data Mage_Frost_T19M Damage
Count 7499
Mean 117195913.71
Minimum 88952984.20
Maximum 151330223.90
Spread ( max - min ) 62377239.71
Range [ ( max - min ) / 2 * 100% ] 26.61%
DTPS
Sample Data Mage_Frost_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mage_Frost_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mage_Frost_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mage_Frost_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mage_Frost_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mage_Frost_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Mage_Frost_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mage_Frost_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 mirror_image
6 0.00 potion,name=deadly_grace
7 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
8 8.57 ice_lance,if=buff.fingers_of_frost.react=0&prev_gcd.flurry
9 2.48 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
A 0.00 call_action_list,name=cooldowns
B 8.39 blizzard,if=buff.potion_of_deadly_grace.up&!prev_off_gcd.water_jet
C 1.54 ice_nova,if=debuff.winters_chill.up
D 9.12 frostbolt,if=prev_off_gcd.water_jet
E 9.12 water_jet,if=prev_gcd.frostbolt&buff.fingers_of_frost.stack<(2+artifact.icy_hand.enabled)&buff.brain_freeze.react=0
F 4.51 ray_of_frost,if=buff.icy_veins.up|(cooldown.icy_veins.remains>action.ray_of_frost.cooldown&buff.rune_of_power.down)
G 11.31 flurry,if=buff.brain_freeze.react&buff.fingers_of_frost.react=0&prev_gcd.frostbolt
0.00 glacial_spike
0.00 frozen_touch,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
H 16.62 frost_bomb,if=debuff.frost_bomb.remains<action.ice_lance.travel_time&buff.fingers_of_frost.react>0
I 61.45 ice_lance,if=buff.fingers_of_frost.react>0&cooldown.icy_veins.remains>10|buff.fingers_of_frost.react>2
J 5.11 frozen_orb
K 8.82 ice_nova
L 9.09 comet_storm
0.00 blizzard,if=talent.artic_gale.enabled
M 5.93 ebonbolt,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
N 66.39 frostbolt
actions.cooldowns
# count action,conditions
O 8.95 rune_of_power,if=cooldown.icy_veins.remains<cast_time|charges_fractional>1.9&cooldown.icy_veins.remains>10|buff.icy_veins.up|target.time_to_die.remains+5<charges_fractional*10
P 2.49 icy_veins,if=buff.icy_veins.down
0.00 mirror_image
Q 1.47 use_item,slot=neck
R 3.00 use_item,slot=trinket2
0.00 blood_fury
S 2.05 berserking
0.00 arcane_torrent
T 1.00 potion,name=deadly_grace

Sample Sequence

0123679OPQRSBFOBJKLHIBIMNNBIIINEDGHIINNG8NNG8C9NNNG8LNNNNNEDNHIIITBNGIFBHIJKOIBLMIIIBHIIIINEDNIING8CHINNLNNNNOHIRINEDGIIMKHIINJIIIIIILHNNNNOPFOKNEDGHIINNNLMNISHINNNNNNIKNG8JNEDHIIILNINNG8FKMNEDHIIILNONNRNNNNG8CNNNEDGHIIJNIILNINHIMKOIINEDGHIINONNN

Sample Sequence Table

time name target resources buffs
Pre flask Mage_Frost_T19M 1100000.0/1100000: 100% mana
Pre food Mage_Frost_T19M 1100000.0/1100000: 100% mana
Pre augmentation Mage_Frost_T19M 1100000.0/1100000: 100% mana
Pre water_elemental Fluffy_Pillow 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 frostbolt Fluffy_Pillow 1078000.0/1100000: 98% mana icicles, potion_of_deadly_grace
0:00.000 time_warp Fluffy_Pillow 1078000.0/1100000: 98% mana icicles, potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1034000.0/1100000: 94% mana bloodlust, icicles, potion_of_deadly_grace
0:00.859 icy_veins Fluffy_Pillow 1048173.5/1100000: 95% mana bloodlust, icicles, rune_of_power, potion_of_deadly_grace
0:00.859 use_item_sorcerous_shadowruby_pendant Fluffy_Pillow 1048173.5/1100000: 95% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:00.859 use_item_wriggling_sinew Fluffy_Pillow 1048173.5/1100000: 95% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:00.859 berserking Fluffy_Pillow 1048173.5/1100000: 95% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(10), potion_of_deadly_grace
0:00.859 blizzard Fluffy_Pillow 1048173.5/1100000: 95% mana bloodlust, berserking, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(10), potion_of_deadly_grace
0:01.623 ray_of_frost Fluffy_Pillow 1033279.5/1100000: 94% mana bloodlust, berserking, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:11.957 rune_of_power Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, icicles, icy_veins, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:12.712 blizzard Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:13.593 frozen_orb Fluffy_Pillow 1072582.5/1100000: 98% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:14.346 ice_nova Fluffy_Pillow 1074007.0/1100000: 98% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:15.101 comet_storm Fluffy_Pillow 1086464.5/1100000: 99% mana bloodlust, fingers_of_frost(2), icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(8), potion_of_deadly_grace
0:15.856 frost_bomb Fluffy_Pillow 1087922.0/1100000: 99% mana bloodlust, fingers_of_frost(2), icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(8), potion_of_deadly_grace
0:16.611 ice_lance Fluffy_Pillow 1086629.5/1100000: 99% mana bloodlust, fingers_of_frost(2), icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(5), potion_of_deadly_grace
0:17.363 blizzard Fluffy_Pillow 1088037.5/1100000: 99% mana bloodlust, fingers_of_frost, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers, potion_of_deadly_grace
0:18.245 ice_lance Fluffy_Pillow 1072599.0/1100000: 98% mana bloodlust, fingers_of_frost, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:19.001 ebonbolt Fluffy_Pillow 1074073.0/1100000: 98% mana bloodlust, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:20.318 frostbolt Fluffy_Pillow 1095803.5/1100000: 100% mana bloodlust, fingers_of_frost(2), icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:21.198 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana bloodlust, fingers_of_frost(3), icicles, rune_of_power, potion_of_deadly_grace
0:22.341 blizzard Fluffy_Pillow 1074925.5/1100000: 98% mana bloodlust, fingers_of_frost(3), icicles(2), rune_of_power, chain_reaction, potion_of_deadly_grace
0:23.485 ice_lance Fluffy_Pillow 1066301.5/1100000: 97% mana bloodlust, fingers_of_frost(3), icicles(2), chain_reaction, potion_of_deadly_grace
0:24.343 ice_lance Fluffy_Pillow 1069458.5/1100000: 97% mana bloodlust, fingers_of_frost(2), chain_reaction, potion_of_deadly_grace
0:25.201 ice_lance Fluffy_Pillow 1072615.5/1100000: 98% mana bloodlust, fingers_of_frost, chain_reaction, potion_of_deadly_grace
0:26.061 frostbolt Fluffy_Pillow 1075805.5/1100000: 98% mana bloodlust, chain_reaction, potion_of_deadly_grace
0:27.204 water_jet Fluffy_Pillow 1072665.0/1100000: 98% mana bloodlust, brain_freeze, icicles, chain_reaction, potion_of_deadly_grace
0:27.204 frostbolt Fluffy_Pillow 1072665.0/1100000: 98% mana bloodlust, brain_freeze, icicles, chain_reaction, potion_of_deadly_grace
0:28.348 flurry Fluffy_Pillow 1069541.0/1100000: 97% mana bloodlust, brain_freeze, fingers_of_frost, icicles(2)
0:29.206 frost_bomb Fluffy_Pillow 1072698.0/1100000: 98% mana bloodlust, fingers_of_frost, icicles(2)
0:30.066 ice_lance Fluffy_Pillow 1073138.0/1100000: 98% mana bloodlust, fingers_of_frost(2), icicles(3), chain_reaction
0:30.923 ice_lance Fluffy_Pillow 1076278.5/1100000: 98% mana bloodlust, fingers_of_frost, chain_reaction
0:31.783 frostbolt Fluffy_Pillow 1079468.5/1100000: 98% mana bloodlust, chain_reaction
0:32.927 frostbolt Fluffy_Pillow 1076344.5/1100000: 98% mana bloodlust, brain_freeze, icicles, chain_reaction
0:34.071 flurry Fluffy_Pillow 1073220.5/1100000: 98% mana bloodlust, brain_freeze, icicles(2), chain_reaction
0:34.928 ice_lance Fluffy_Pillow 1076361.0/1100000: 98% mana bloodlust, fingers_of_frost, icicles(2), chain_reaction
0:35.785 frostbolt Fluffy_Pillow 1079501.5/1100000: 98% mana bloodlust, icicles
0:36.929 frostbolt Fluffy_Pillow 1076377.5/1100000: 98% mana bloodlust, brain_freeze, icicles(2)
0:38.072 flurry Fluffy_Pillow 1073237.0/1100000: 98% mana bloodlust, brain_freeze, icicles(3), chain_reaction
0:38.930 ice_lance Fluffy_Pillow 1076394.0/1100000: 98% mana bloodlust, icicles(3), chain_reaction
0:39.787 ice_nova Fluffy_Pillow 1079534.5/1100000: 98% mana bloodlust, chain_reaction(2)
0:40.839 time_warp Fluffy_Pillow 1096892.5/1100000: 100% mana chain_reaction(2)
0:40.839 frostbolt Fluffy_Pillow 1052892.5/1100000: 96% mana bloodlust, chain_reaction(2)
0:41.982 frostbolt Fluffy_Pillow 1049752.0/1100000: 95% mana bloodlust, icicles, chain_reaction(2)
0:43.124 frostbolt Fluffy_Pillow 1046595.0/1100000: 95% mana bloodlust, brain_freeze, icicles(2), chain_reaction(3)
0:44.270 flurry Fluffy_Pillow 1043504.0/1100000: 95% mana bloodlust, brain_freeze, icicles(3), chain_reaction(3)
0:45.129 ice_lance Fluffy_Pillow 1046677.5/1100000: 95% mana bloodlust, icicles(3), chain_reaction(3)
0:45.986 comet_storm Fluffy_Pillow 1049818.0/1100000: 95% mana bloodlust, chain_reaction(3)
0:46.843 frostbolt Fluffy_Pillow 1052958.5/1100000: 96% mana bloodlust, chain_reaction(3)
0:47.986 frostbolt Fluffy_Pillow 1049818.0/1100000: 95% mana bloodlust, icicles, chain_reaction(3)
0:49.128 frostbolt Fluffy_Pillow 1046661.0/1100000: 95% mana bloodlust, icicles(3), chain_reaction(3)
0:50.272 frostbolt Fluffy_Pillow 1043537.0/1100000: 95% mana bloodlust, icicles(4), chain_reaction(3)
0:51.416 frostbolt Fluffy_Pillow 1040413.0/1100000: 95% mana bloodlust, icicles(5), chain_reaction(3)
0:52.560 water_jet Fluffy_Pillow 1037289.0/1100000: 94% mana bloodlust, icicles(5), chain_reaction(3)
0:52.560 frostbolt Fluffy_Pillow 1037289.0/1100000: 94% mana bloodlust, icicles(5), chain_reaction(3)
0:53.705 frostbolt Fluffy_Pillow 1034181.5/1100000: 94% mana bloodlust, brain_freeze, fingers_of_frost, icicles(5), chain_reaction(3)
0:54.849 frost_bomb Fluffy_Pillow 1031057.5/1100000: 94% mana bloodlust, brain_freeze, fingers_of_frost(3), icicles(5), chain_reaction(3)
0:55.707 ice_lance Fluffy_Pillow 1031464.5/1100000: 94% mana bloodlust, brain_freeze, fingers_of_frost(3), icicles(5), chain_reaction(3)
0:56.568 ice_lance Fluffy_Pillow 1034671.0/1100000: 94% mana bloodlust, brain_freeze, fingers_of_frost(2), chain_reaction(3)
0:57.428 ice_lance Fluffy_Pillow 1037861.0/1100000: 94% mana bloodlust, brain_freeze, fingers_of_frost, chain_reaction(3)
0:58.288 potion Fluffy_Pillow 1041051.0/1100000: 95% mana bloodlust, brain_freeze, chain_reaction(3)
0:58.288 blizzard Fluffy_Pillow 1041051.0/1100000: 95% mana bloodlust, brain_freeze, chain_reaction(3), potion_of_deadly_grace
0:59.431 frostbolt Fluffy_Pillow 1032410.5/1100000: 94% mana bloodlust, brain_freeze, chain_reaction(3), potion_of_deadly_grace
1:00.575 flurry Fluffy_Pillow 1029286.5/1100000: 94% mana bloodlust, brain_freeze, fingers_of_frost, icicles, chain_reaction(3), potion_of_deadly_grace
1:01.435 ice_lance Fluffy_Pillow 1032476.5/1100000: 94% mana bloodlust, fingers_of_frost, icicles, chain_reaction(3), potion_of_deadly_grace
1:02.292 ray_of_frost Fluffy_Pillow 1035617.0/1100000: 94% mana bloodlust, icicles, chain_reaction(3), potion_of_deadly_grace
1:12.620 blizzard Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, fingers_of_frost, icicles, potion_of_deadly_grace
1:13.764 frost_bomb Fluffy_Pillow 1072582.5/1100000: 98% mana bloodlust, fingers_of_frost, icicles, potion_of_deadly_grace
1:14.623 ice_lance Fluffy_Pillow 1073006.0/1100000: 98% mana bloodlust, fingers_of_frost, icicles, potion_of_deadly_grace
1:15.481 frozen_orb Fluffy_Pillow 1076163.0/1100000: 98% mana bloodlust, potion_of_deadly_grace
1:16.339 ice_nova Fluffy_Pillow 1079320.0/1100000: 98% mana bloodlust, potion_of_deadly_grace
1:17.197 rune_of_power Fluffy_Pillow 1093477.0/1100000: 99% mana bloodlust, fingers_of_frost, potion_of_deadly_grace
1:18.057 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, fingers_of_frost, rune_of_power, potion_of_deadly_grace
1:18.915 blizzard Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, rune_of_power, potion_of_deadly_grace
1:20.060 comet_storm Fluffy_Pillow 1072599.0/1100000: 98% mana bloodlust, rune_of_power, potion_of_deadly_grace
1:20.943 ebonbolt Fluffy_Pillow 1076168.5/1100000: 98% mana fingers_of_frost, rune_of_power, potion_of_deadly_grace
1:23.170 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(3), rune_of_power, potion_of_deadly_grace
1:24.283 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(3), rune_of_power, potion_of_deadly_grace
1:25.398 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), rune_of_power, potion_of_deadly_grace
1:26.514 blizzard Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(3), rune_of_power, potion_of_deadly_grace
1:28.000 frost_bomb Fluffy_Pillow 1072582.5/1100000: 98% mana fingers_of_frost(3), rune_of_power, potion_of_deadly_grace
1:29.113 ice_lance Fluffy_Pillow 1077197.0/1100000: 98% mana fingers_of_frost(3)
1:30.229 ice_lance Fluffy_Pillow 1084611.0/1100000: 99% mana fingers_of_frost(3)
1:31.347 ice_lance Fluffy_Pillow 1092058.0/1100000: 99% mana fingers_of_frost(2)
1:32.461 ice_lance Fluffy_Pillow 1099439.0/1100000: 100% mana fingers_of_frost
1:33.576 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
1:35.061 water_jet Fluffy_Pillow 1078066.0/1100000: 98% mana icicles
1:35.061 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana icicles
1:36.545 frostbolt Fluffy_Pillow 1078049.5/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(2), chain_reaction
1:38.032 ice_lance Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles(4), chain_reaction
1:39.147 ice_lance Fluffy_Pillow 1085496.5/1100000: 99% mana brain_freeze, fingers_of_frost, chain_reaction
1:40.263 frostbolt Fluffy_Pillow 1092910.5/1100000: 99% mana brain_freeze, chain_reaction
1:41.748 flurry Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, icicles, chain_reaction
1:42.864 ice_lance Fluffy_Pillow 1085480.0/1100000: 99% mana icicles(2)
1:43.979 ice_nova Fluffy_Pillow 1092877.5/1100000: 99% mana
1:45.094 frost_bomb Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost
1:46.208 ice_lance Fluffy_Pillow 1086299.5/1100000: 99% mana fingers_of_frost
1:47.325 frostbolt Fluffy_Pillow 1093730.0/1100000: 99% mana
1:48.810 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana icicles
1:50.297 comet_storm Fluffy_Pillow 1078099.0/1100000: 98% mana icicles(3), chain_reaction
1:51.412 frostbolt Fluffy_Pillow 1085496.5/1100000: 99% mana icicles(3), chain_reaction
1:52.897 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana icicles(4), chain_reaction
1:54.384 frostbolt Fluffy_Pillow 1078099.0/1100000: 98% mana icicles(5), chain_reaction(2)
1:55.868 frostbolt Fluffy_Pillow 1078049.5/1100000: 98% mana fingers_of_frost, icicles(5), chain_reaction(2)
1:57.354 rune_of_power Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost(2), icicles(5), chain_reaction(3)
1:58.468 frost_bomb Fluffy_Pillow 1096463.5/1100000: 100% mana fingers_of_frost(2), icicles(5), rune_of_power, chain_reaction(3)
1:59.583 ice_lance Fluffy_Pillow 1086316.0/1100000: 99% mana fingers_of_frost(2), icicles(5), rune_of_power, chain_reaction(3)
2:00.697 use_item_wriggling_sinew Fluffy_Pillow 1093697.0/1100000: 99% mana fingers_of_frost, rune_of_power, chain_reaction(3)
2:00.859 ice_lance Fluffy_Pillow 1096370.0/1100000: 100% mana fingers_of_frost, rune_of_power, chain_reaction(3), maddening_whispers(10)
2:01.975 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana rune_of_power, chain_reaction(3), maddening_whispers(9)
2:03.460 water_jet Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, icicles, rune_of_power, maddening_whispers(9)
2:03.460 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, icicles, rune_of_power, maddening_whispers(9)
2:04.946 flurry Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(2), rune_of_power, chain_reaction, maddening_whispers(8)
2:06.061 ice_lance Fluffy_Pillow 1085480.0/1100000: 99% mana fingers_of_frost(2), icicles(2), rune_of_power, chain_reaction(2), maddening_whispers(6)
2:07.177 ice_lance Fluffy_Pillow 1092894.0/1100000: 99% mana fingers_of_frost, rune_of_power, chain_reaction(2), maddening_whispers(3)
2:08.292 ebonbolt Fluffy_Pillow 1100000.0/1100000: 100% mana rune_of_power, chain_reaction(2), maddening_whispers(2)
2:10.519 ice_nova Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), chain_reaction(2), maddening_whispers(2)
2:11.634 frost_bomb Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), chain_reaction(2)
2:12.748 ice_lance Fluffy_Pillow 1086299.5/1100000: 99% mana fingers_of_frost(2)
2:13.863 ice_lance Fluffy_Pillow 1093697.0/1100000: 99% mana fingers_of_frost
2:14.978 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
2:16.464 frozen_orb Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost(2), icicles
2:17.578 ice_lance Fluffy_Pillow 1085463.5/1100000: 99% mana fingers_of_frost(2), icicles(2)
2:18.692 ice_lance Fluffy_Pillow 1092844.5/1100000: 99% mana fingers_of_frost(3)
2:19.806 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
2:20.920 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
2:22.034 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
2:23.150 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost
2:24.265 comet_storm Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost
2:25.381 frost_bomb Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
2:26.497 frostbolt Fluffy_Pillow 1086332.5/1100000: 99% mana fingers_of_frost(2)
2:27.982 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles
2:29.467 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles(2), chain_reaction
2:30.953 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles(4), chain_reaction(2)
2:32.439 rune_of_power Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles(5), chain_reaction(2)
2:33.555 icy_veins Fluffy_Pillow 1096496.5/1100000: 100% mana brain_freeze, fingers_of_frost(2), icicles(5), rune_of_power, chain_reaction(3)
2:33.555 ray_of_frost Fluffy_Pillow 1096496.5/1100000: 100% mana brain_freeze, fingers_of_frost(2), icicles(5), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
2:43.842 rune_of_power Fluffy_Pillow 1100000.0/1100000: 100% mana brain_freeze, icicles(5), icy_veins, chilled_to_the_core
2:44.700 ice_nova Fluffy_Pillow 1100000.0/1100000: 100% mana icicles(5), icy_veins, rune_of_power, chilled_to_the_core
2:45.558 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana icicles(5), icy_veins, rune_of_power, chilled_to_the_core
2:46.702 water_jet Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles(5), icy_veins, rune_of_power, chilled_to_the_core
2:46.702 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles(5), icy_veins, rune_of_power, chilled_to_the_core
2:47.847 flurry Fluffy_Pillow 1074975.0/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(5), icy_veins, rune_of_power, chilled_to_the_core
2:48.706 frost_bomb Fluffy_Pillow 1078148.5/1100000: 98% mana fingers_of_frost, icicles(5), icy_veins, rune_of_power, chilled_to_the_core
2:49.566 ice_lance Fluffy_Pillow 1078588.5/1100000: 98% mana fingers_of_frost(2), icicles(5), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core
2:50.424 ice_lance Fluffy_Pillow 1081745.5/1100000: 98% mana fingers_of_frost, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core
2:51.284 frostbolt Fluffy_Pillow 1084935.5/1100000: 99% mana icy_veins, rune_of_power, chain_reaction, chilled_to_the_core
2:52.427 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana icicles, icy_veins, rune_of_power, chain_reaction, chilled_to_the_core
2:53.570 frostbolt Fluffy_Pillow 1074925.5/1100000: 98% mana icicles(2), rune_of_power, chain_reaction(2)
2:55.055 comet_storm Fluffy_Pillow 1077428.0/1100000: 98% mana icicles(3), chain_reaction(2)
2:56.169 ebonbolt Fluffy_Pillow 1084809.0/1100000: 99% mana icicles(3), chain_reaction(3)
2:58.397 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), icicles(3), chain_reaction(3)
2:59.883 ice_lance Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost(2), icicles(4), chain_reaction(3)
3:00.998 berserking Fluffy_Pillow 1085480.0/1100000: 99% mana fingers_of_frost, chain_reaction(3)
3:00.998 frost_bomb Fluffy_Pillow 1085480.0/1100000: 99% mana berserking, fingers_of_frost, chain_reaction(3)
3:01.967 ice_lance Fluffy_Pillow 1086299.5/1100000: 99% mana berserking, fingers_of_frost, chain_reaction(3)
3:02.938 frostbolt Fluffy_Pillow 1091321.0/1100000: 99% mana berserking, chain_reaction(3)
3:04.231 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana berserking, icicles, chain_reaction(3)
3:05.523 frostbolt Fluffy_Pillow 1077400.5/1100000: 98% mana berserking, icicles(2), chain_reaction(3)
3:06.815 frostbolt Fluffy_Pillow 1076718.5/1100000: 98% mana berserking, icicles(3), chain_reaction(3)
3:08.107 frostbolt Fluffy_Pillow 1076036.5/1100000: 98% mana berserking, icicles(4), chain_reaction(3)
3:09.400 frostbolt Fluffy_Pillow 1075371.0/1100000: 98% mana berserking, fingers_of_frost, icicles(5), chain_reaction(3)
3:10.695 ice_lance Fluffy_Pillow 1074738.5/1100000: 98% mana berserking, brain_freeze, fingers_of_frost, icicles(5), chain_reaction(3)
3:11.765 ice_nova Fluffy_Pillow 1081393.5/1100000: 98% mana brain_freeze, chain_reaction(3)
3:12.880 frostbolt Fluffy_Pillow 1099791.0/1100000: 100% mana brain_freeze
3:14.366 flurry Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles
3:15.484 ice_lance Fluffy_Pillow 1085529.5/1100000: 99% mana icicles(2)
3:16.601 frozen_orb Fluffy_Pillow 1092960.0/1100000: 99% mana
3:17.716 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
3:19.204 water_jet Fluffy_Pillow 1078115.5/1100000: 98% mana fingers_of_frost, icicles
3:19.204 frostbolt Fluffy_Pillow 1078115.5/1100000: 98% mana fingers_of_frost, icicles
3:20.689 frost_bomb Fluffy_Pillow 1078066.0/1100000: 98% mana fingers_of_frost(2), icicles(2), chain_reaction
3:21.803 ice_lance Fluffy_Pillow 1082697.0/1100000: 98% mana fingers_of_frost(3), icicles(2), chain_reaction(2)
3:22.917 ice_lance Fluffy_Pillow 1090078.0/1100000: 99% mana fingers_of_frost(2), chain_reaction(2)
3:24.032 ice_lance Fluffy_Pillow 1097475.5/1100000: 100% mana fingers_of_frost, chain_reaction(2)
3:25.146 comet_storm Fluffy_Pillow 1100000.0/1100000: 100% mana chain_reaction(2)
3:26.261 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost, chain_reaction(2)
3:27.745 ice_lance Fluffy_Pillow 1078049.5/1100000: 98% mana fingers_of_frost, icicles, chain_reaction(2)
3:28.859 frostbolt Fluffy_Pillow 1085430.5/1100000: 99% mana chain_reaction
3:30.345 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles, chain_reaction
3:31.831 flurry Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles(2), chain_reaction
3:32.945 ice_lance Fluffy_Pillow 1085463.5/1100000: 99% mana icicles(3), chain_reaction
3:34.060 ray_of_frost Fluffy_Pillow 1092861.0/1100000: 99% mana chain_reaction
3:44.364 ice_nova Fluffy_Pillow 1100000.0/1100000: 100% mana
3:45.481 ebonbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
3:47.708 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
3:49.193 water_jet Fluffy_Pillow 1078066.0/1100000: 98% mana fingers_of_frost(2), icicles
3:49.193 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana fingers_of_frost(2), icicles
3:50.676 frost_bomb Fluffy_Pillow 1078033.0/1100000: 98% mana fingers_of_frost(3), icicles(2), chain_reaction
3:51.791 ice_lance Fluffy_Pillow 1082680.5/1100000: 98% mana fingers_of_frost(3), icicles(2), chain_reaction
3:52.909 ice_lance Fluffy_Pillow 1090127.5/1100000: 99% mana fingers_of_frost(2), chain_reaction
3:54.025 ice_lance Fluffy_Pillow 1097541.5/1100000: 100% mana fingers_of_frost, chain_reaction
3:55.140 comet_storm Fluffy_Pillow 1100000.0/1100000: 100% mana chain_reaction
3:56.260 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
3:57.748 rune_of_power Fluffy_Pillow 1078115.5/1100000: 98% mana icicles
3:58.864 frostbolt Fluffy_Pillow 1096529.5/1100000: 100% mana icicles, rune_of_power, chain_reaction
4:00.349 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana icicles(2), rune_of_power, chain_reaction
4:01.833 use_item_wriggling_sinew Fluffy_Pillow 1078049.5/1100000: 98% mana icicles(3), rune_of_power, chain_reaction(2)
4:01.833 frostbolt Fluffy_Pillow 1078049.5/1100000: 98% mana icicles(3), rune_of_power, chain_reaction(2), maddening_whispers(10)
4:03.318 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana icicles(4), rune_of_power, chain_reaction(2), maddening_whispers(9)
4:04.805 frostbolt Fluffy_Pillow 1078099.0/1100000: 98% mana icicles(5), rune_of_power, chain_reaction(3), maddening_whispers(8)
4:06.290 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, icicles(5), rune_of_power, chain_reaction(3), maddening_whispers(7)
4:07.777 flurry Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, icicles(5), rune_of_power, chain_reaction(3), maddening_whispers(6)
4:08.893 ice_lance Fluffy_Pillow 1085513.0/1100000: 99% mana icicles(5), chain_reaction(3), maddening_whispers(4)
4:10.008 ice_nova Fluffy_Pillow 1092910.5/1100000: 99% mana chain_reaction(3), maddening_whispers
4:11.123 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
4:12.609 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana icicles
4:14.093 frostbolt Fluffy_Pillow 1078049.5/1100000: 98% mana icicles(3), chain_reaction
4:15.580 water_jet Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, icicles(4), chain_reaction(2)
4:15.580 frostbolt Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, icicles(4), chain_reaction(2)
4:17.065 flurry Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(5), chain_reaction(2)
4:18.180 frost_bomb Fluffy_Pillow 1085463.5/1100000: 99% mana fingers_of_frost(2), icicles(5), chain_reaction(3)
4:19.297 ice_lance Fluffy_Pillow 1086349.0/1100000: 99% mana fingers_of_frost(2), icicles(5), chain_reaction(3)
4:20.412 ice_lance Fluffy_Pillow 1093746.5/1100000: 99% mana fingers_of_frost, chain_reaction(3)
4:21.529 frozen_orb Fluffy_Pillow 1100000.0/1100000: 100% mana chain_reaction(3)
4:22.646 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana chain_reaction(3)
4:24.132 ice_lance Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost(2), icicles
4:25.248 ice_lance Fluffy_Pillow 1085496.5/1100000: 99% mana fingers_of_frost
4:26.364 comet_storm Fluffy_Pillow 1092910.5/1100000: 99% mana
4:27.480 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
4:28.965 ice_lance Fluffy_Pillow 1078066.0/1100000: 98% mana fingers_of_frost, icicles
4:30.081 frostbolt Fluffy_Pillow 1085480.0/1100000: 99% mana chain_reaction
4:31.567 frost_bomb Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost, icicles, chain_reaction
4:32.683 ice_lance Fluffy_Pillow 1082746.5/1100000: 98% mana fingers_of_frost, icicles(2), chain_reaction
4:33.800 ebonbolt Fluffy_Pillow 1090177.0/1100000: 99% mana chain_reaction
4:36.027 ice_nova Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), chain_reaction
4:37.143 rune_of_power Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
4:38.259 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), rune_of_power
4:39.376 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost, rune_of_power
4:40.495 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana rune_of_power
4:41.981 water_jet Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles, rune_of_power
4:41.981 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles, rune_of_power
4:43.467 flurry Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(2), rune_of_power
4:44.583 frost_bomb Fluffy_Pillow 1085496.5/1100000: 99% mana fingers_of_frost(2), icicles(3), rune_of_power, chain_reaction
4:45.701 ice_lance Fluffy_Pillow 1086365.5/1100000: 99% mana fingers_of_frost(2), icicles(3), rune_of_power, chain_reaction
4:46.817 ice_lance Fluffy_Pillow 1093779.5/1100000: 99% mana fingers_of_frost, rune_of_power, chain_reaction
4:47.932 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana rune_of_power, chain_reaction
4:49.418 rune_of_power Fluffy_Pillow 1078082.5/1100000: 98% mana icicles, chain_reaction
4:50.533 frostbolt Fluffy_Pillow 1096480.0/1100000: 100% mana icicles, rune_of_power
4:52.020 frostbolt Fluffy_Pillow 1078099.0/1100000: 98% mana icicles(2), rune_of_power
4:53.506 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(4), rune_of_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4876 4551 0
Agility 6579 6254 0
Stamina 40980 40980 25820
Intellect 37254 35548 26532 (965)
Spirit 1 1 0
Health 2458800 2458800 0
Mana 1100000 1100000 0
Spell Power 37254 35548 0
Crit 31.50% 31.50% 9276
Haste 25.01% 23.86% 7754
Damage / Heal Versatility 3.40% 3.40% 1361
ManaReg per Second 16500 16500 0
Mastery 32.92% 32.92% 2321
Armor 1810 1810 1810
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 881.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Sorcerous Shadowruby Pendant of the Fireflash
ilevel: 850, stats: { +1094 Sta, +1101 Crit, +734 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Robes of Celestial Adornment
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +855 Haste, +605 Crit }
Local Waist Pliable Spider Silk Cinch
ilevel: 880, stats: { 163 Armor, +1930 Sta, +1287 Int, +689 Mastery, +406 Crit }
Local Legs Leggings of the Lower Planes
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +1012 Crit, +448 Haste }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +735 Haste, +360 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +569 Haste, +252 Mastery }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Shard of the Exodar
ilevel: 895, stats: { +1665 Sta, +1397 Crit, +776 Haste }, enchant: { +200 Haste }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Haste }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Wriggling Sinew
ilevel: 880, stats: { +1043 Crit }
Local Back Mantle of the Victorious Dead
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Vers, +340 Haste }, enchant: { +200 Int }
Local Main Hand Ebonchill
ilevel: 906, weapon: { 5654 - 8482, 3.6 }, stats: { +2186 Int, +3279 Sta, +806 Haste, +806 Mastery, +11923 Int }

Talents

Level
15 Ray of Frost (Frost Mage) Lonely Winter (Frost Mage) Bone Chilling (Frost Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Ice Nova (Frost Mage) Frozen Touch (Frost Mage) Splitting Ice (Frost Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Frost Bomb (Frost Mage) Unstable Magic Arctic Gale (Frost Mage)
100 Thermal Void (Frost Mage) Glacial Spike (Frost Mage) Comet Storm (Frost Mage)

Profile

mage="Mage_Frost_T19M"
level=110
race=troll
role=spell
position=back
talents=1121113
artifact=53:139259:139269:139259:0:783:1:784:3:785:3:786:5:788:3:789:4:790:3:791:3:792:3:793:1:794:1:795:1:796:1:797:1:798:1:1296:1
spec=frost

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/frostbolt

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/ice_lance,if=buff.fingers_of_frost.react=0&prev_gcd.flurry
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/call_action_list,name=cooldowns
actions+=/blizzard,if=buff.potion_of_deadly_grace.up&!prev_off_gcd.water_jet
actions+=/ice_nova,if=debuff.winters_chill.up
actions+=/frostbolt,if=prev_off_gcd.water_jet
actions+=/water_jet,if=prev_gcd.frostbolt&buff.fingers_of_frost.stack<(2+artifact.icy_hand.enabled)&buff.brain_freeze.react=0
actions+=/ray_of_frost,if=buff.icy_veins.up|(cooldown.icy_veins.remains>action.ray_of_frost.cooldown&buff.rune_of_power.down)
actions+=/flurry,if=buff.brain_freeze.react&buff.fingers_of_frost.react=0&prev_gcd.frostbolt
actions+=/glacial_spike
actions+=/frozen_touch,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
actions+=/frost_bomb,if=debuff.frost_bomb.remains<action.ice_lance.travel_time&buff.fingers_of_frost.react>0
actions+=/ice_lance,if=buff.fingers_of_frost.react>0&cooldown.icy_veins.remains>10|buff.fingers_of_frost.react>2
actions+=/frozen_orb
actions+=/ice_nova
actions+=/comet_storm
actions+=/blizzard,if=talent.artic_gale.enabled
actions+=/ebonbolt,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
actions+=/frostbolt

actions.cooldowns=rune_of_power,if=cooldown.icy_veins.remains<cast_time|charges_fractional>1.9&cooldown.icy_veins.remains>10|buff.icy_veins.up|target.time_to_die.remains+5<charges_fractional*10
actions.cooldowns+=/icy_veins,if=buff.icy_veins.down
actions.cooldowns+=/mirror_image
actions.cooldowns+=/use_item,slot=neck
actions.cooldowns+=/use_item,slot=trinket2
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=deadly_grace

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=sorcerous_shadowruby_pendant,id=130233,bonus_id=1758/689/601/669,gem_id=130219,enchant=mark_of_the_hidden_satyr,enchant_id=5439
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=mantle_of_the_victorious_dead,id=142540,bonus_id=1502,enchant=binding_of_intellect
chest=robes_of_celestial_adornment,id=142410,bonus_id=1502
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1806
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=pliable_spider_silk_cinch,id=138217,bonus_id=1806
legs=leggings_of_the_lower_planes,id=142413,bonus_id=1502
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1806
finger1=shard_of_the_exodar,id=132410,enchant=binding_of_haste
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_haste
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=wriggling_sinew,id=139326,bonus_id=1806
main_hand=ebonchill,id=128862,ilevel=906

# Gear Summary
# gear_ilvl=880.73
# gear_stamina=25820
# gear_intellect=26532
# gear_crit_rating=9276
# gear_haste_rating=7754
# gear_mastery_rating=2321
# gear_versatility_rating=1361
# gear_armor=1810

Paladin_Retribution_T19M : 419768 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
419767.8 419767.8 348.1 / 0.083% 59030.7 / 14.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 1.94% 60.0 100.0% 100%
Talents
  • 15: Final Verdict (Retribution Paladin)
  • 30: The Fires of Justice (Retribution Paladin)
  • 45: Fist of Justice
  • 60: Blade of Wrath (Retribution Paladin)
  • 75: Justicar's Vengeance (Retribution Paladin)
  • 90: Divine Intervention (Retribution Paladin)
  • 100: Crusade (Retribution Paladin)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Paladin_Retribution_T19M 419768
Blade of Justice 38071 9.1% 48.9 6.11sec 233634 230644 Direct 48.9 188407 376424 233633 24.1%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.93 48.93 0.00 0.00 1.0130 0.0000 11431657.25 16805618.99 31.98 230644.36 230644.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.16 75.94% 188406.75 161318 246010 188470.93 172759 204301 7001073 10292241 31.98
crit 11.77 24.06% 376424.30 322636 492019 376493.30 322636 486373 4430584 6513378 31.98
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Strikes an enemy with the Blade of Justice, dealing ${$sw2*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Greater Blessing of Might (blessing_of_might_proc) 33097 7.9% 189.1 1.99sec 52544 0 Direct 162.5 61121 0 61121 0.0%  

Stats details: blessing_of_might_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.06 162.53 0.00 0.00 0.0000 0.0000 9934030.01 9934030.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 162.53 100.00% 61120.59 9186 1073619 61146.01 43023 82453 9934030 9934030 0.00
 
 

Action details: blessing_of_might_proc

Static Values
  • id:205729
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205729
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:
  • description:{$@spelldesc203528=Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47336.36
  • base_dd_max:47336.36
 
Brutal Haymaker 2535 (10914) 0.6% (2.6%) 4.7 54.37sec 693274 0 Direct 4.7 129348 258129 160963 24.6%  

Stats details: brutal_haymaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.73 4.73 0.00 0.00 0.0000 0.0000 761408.84 1119343.12 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.57 75.45% 129347.54 115242 175744 128402.53 0 175744 461591 678582 31.67
crit 1.16 24.55% 258129.46 230484 351488 181064.77 0 351488 299818 440761 22.37
 
 

Action details: brutal_haymaker

Static Values
  • id:214169
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214169
  • name:Brutal Haymaker
  • school:physical
  • tooltip:Damage taken from the caster increased by {$s2=15}%.
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal {$214169s1=84038} Physical damage and increase all damage the target takes from you by {$214169s2=15}% for {$214169d=15 seconds}, up to {$214169s3=315142} extra damage dealt.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:161348.62
  • base_dd_max:161348.62
 
    Brutal Haymaker (_vulnerability) 8379 2.0% 53.6 4.04sec 46997 0 Direct 51.5 48937 0 48937 0.0%  

Stats details: brutal_haymaker_vulnerability

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.58 51.45 0.00 0.00 0.0000 0.0000 2517935.04 2517935.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.45 100.00% 48937.26 5 605059 49676.46 30097 110011 2517935 2517935 0.00
 
 

Action details: brutal_haymaker_vulnerability

Static Values
  • id:228784
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228784
  • name:Brutal Haymaker
  • school:physical
  • tooltip:
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal {$214169s1=84038} Physical damage and increase all damage the target takes from you by {$214169s2=15}% for {$214169d=15 seconds}, up to {$214169s3=315142} extra damage dealt.}
 
Crusader Strike 50430 12.0% 106.2 2.81sec 142532 141139 Direct 106.2 92508 185059 142531 54.0%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.18 106.18 0.00 0.00 1.0099 0.0000 15133390.72 22247517.83 31.98 141139.41 141139.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.79 45.95% 92508.15 78894 120313 92544.29 84417 100984 4513246 6634900 31.98
crit 57.39 54.05% 185058.78 157788 240626 185138.24 168948 201498 10620144 15612618 31.98
 
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:3.500
  • base_execute_time:0.00
  • base_crit:0.30
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:Strike the target for ${$sw2*$<mult>} Physical damage.$?a231667[ Maximum 2 charges.][]{$?s85256=true}[ |cFFFFFFFFGenerates {$s3=1} Holy Power.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Templar's Verdict (echoed_verdict) 17427 4.2% 88.7 3.38sec 58996 0 Direct 88.7 47593 95193 58997 24.0%  

Stats details: echoed_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.68 88.68 0.00 0.00 0.0000 0.0000 5231512.00 5231512.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.43 76.04% 47592.58 40356 67078 47611.16 44770 50576 3209259 3209259 0.00
crit 21.24 23.96% 95192.72 80712 134157 95227.00 81377 111034 2022253 2022253 0.00
 
 

Action details: echoed_verdict

Static Values
  • id:224266
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:224266
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals $sw1 Holy damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.40
 
Judgment 29563 7.1% 34.4 8.82sec 257639 250820 Direct 34.4 207745 415024 257696 24.1%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.44 34.44 0.00 0.00 1.0272 0.0000 8874254.35 8874254.35 0.00 250819.77 250819.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.14 75.90% 207745.30 178992 311605 207799.30 186840 227954 5429932 5429932 0.00
crit 8.30 24.10% 415024.22 357983 623210 415163.14 357983 545924 3444322 3444322 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 18858 4.5% 126.9 2.36sec 44592 18963 Direct 126.9 35935 71837 44592 24.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.88 126.88 0.00 0.00 2.3515 0.0000 5657931.84 8317695.74 31.98 18963.12 18963.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.29 75.89% 35934.74 30620 46696 35950.52 34030 37861 3460020 5086558 31.98
crit 30.60 24.11% 71836.59 61241 93392 71873.66 62976 83875 2197912 3231138 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 26676 6.3% 36.7 4.04sec 214624 0 Direct 36.7 172951 345950 214622 24.1%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.73 36.73 0.00 0.00 0.0000 0.0000 7884008.26 11590238.94 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.89 75.91% 172951.38 121349 185058 172939.66 162937 181872 4822855 7090054 31.98
crit 8.85 24.09% 345950.19 251193 370115 345823.16 0 370115 3061153 4500185 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
shield_of_vengeance_proc 12445 3.0% 3.8 89.46sec 981190 0 Direct 3.6 833082 1653410 1031247 24.2%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.80 3.61 0.00 0.00 0.0000 0.0000 3724961.23 3724961.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.74 75.84% 833081.77 586677 1789365 829050.93 0 1789365 2282306 2282306 0.00
crit 0.87 24.16% 1653410.12 1173354 3578730 1046220.77 0 3578730 1442655 1442655 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:558740.00
  • base_dd_max:558740.00
 
Templar's Verdict 165190 39.4% 88.7 3.38sec 559032 548692 Direct 88.7 450559 901293 559034 24.1%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.70 88.70 0.00 0.00 1.0188 0.0000 49587485.52 49587485.52 0.00 548691.94 548691.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.35 75.93% 450558.82 322850 670783 450683.53 413297 488515 30347437 30347437 0.00
crit 21.35 24.07% 901293.19 645700 1341566 901665.91 720893 1100719 19240048 19240048 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 17095 4.1% 9.8 32.48sec 525370 508125 Direct 9.8 211012 422128 261362 23.9%  
Periodic 58.0 35843 71672 44500 24.2% 19.3%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.77 9.77 57.98 57.98 1.0340 1.0000 5134603.26 5134603.26 0.00 75413.50 508125.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.44 76.15% 211011.55 190671 290773 210987.08 190671 290773 1570365 1570365 0.00
crit 2.33 23.85% 422128.14 381342 581547 389815.74 0 581547 984095 984095 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.0 75.84% 35842.85 32267 49208 35835.46 32867 38112 1576101 1576101 0.00
crit 14.0 24.16% 71671.51 64534 98415 71639.15 64534 89945 1004043 1004043 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=0&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Paladin_Retribution_T19M
Arcane Torrent 3.7 90.58sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:155145
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<5
Spelldata
  • id:155145
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$?s137027=false}[{$s2=1} Holy Power][{$s3=3}% of your mana]. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
 
Cleansed Drake's Breath 3.1 64.17sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
Crusade 3.0 120.41sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:231895
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:holy_power>=5
Spelldata
  • id:231895
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
 
Greater Blessing of Might 1.0 0.00sec

Stats details: greater_blessing_of_might

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: greater_blessing_of_might

Static Values
  • id:203528
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
Spelldata
  • id:203528
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
 
Judgment (_aoe) 34.4 8.82sec

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield of Vengeance 3.8 90.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 3.80 3.80 0.00 0.00 0.0000 0.0000 0.00 2625459.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.89 76.23% 0.00 0 0 0.00 0 0 0 1616911 99.52
crit 0.90 23.77% 0.00 0 0 0.00 0 0 0 1008548 64.01
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade of Wrath! 25.6 8.9 11.8sec 8.7sec 32.45% 32.45% 8.9(8.9) 25.3

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_blade_of_wrath
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • blade_of_wrath_1:32.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231843
  • name:Blade of Wrath!
  • tooltip:
  • description:{$@spelldesc231832=Your auto attacks have a chance to reset the cooldown of Blade of Justice.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 25.18% 0.0(0.0) 1.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cleansed Ancient's Blessing 2.8 0.0 72.2sec 72.2sec 9.18% 9.18% 0.0(0.0) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:9.18%

Trigger Attempt Success

  • trigger_pct:95.59%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 2.8 0.0 72.8sec 72.8sec 9.10% 9.10% 0.0(0.0) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:9.10%

Trigger Attempt Success

  • trigger_pct:95.63%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 2.8 0.0 73.2sec 73.2sec 9.08% 9.08% 0.0(0.0) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.08%

Trigger Attempt Success

  • trigger_pct:95.44%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crusade 3.0 33.9 120.4sec 7.4sec 28.48% 100.00% 22.1(60.6) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.49%
  • crusade_4:2.43%
  • crusade_7:2.62%
  • crusade_10:2.83%
  • crusade_13:2.42%
  • crusade_15:17.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231895
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
Mark of the Claw 11.3 3.0 26.2sec 20.3sec 25.49% 25.49% 3.0(3.0) 11.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 121.4sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shield of Vengeance 3.8 0.0 90.0sec 90.0sec 18.46% 18.46% 0.0(0.0) 3.6

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:18.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
The Fires of Justice 15.5 0.4 18.6sec 18.1sec 9.83% 10.46% 0.4(0.4) 0.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_the_fires_of_justice
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • the_fires_of_justice_1:9.83%

Trigger Attempt Success

  • trigger_pct:14.95%

Spelldata details

  • id:209785
  • name:The Fires of Justice
  • tooltip:Your next damaging or healing Holy Power spender costs {$s2=1} less Holy Power.
  • description:{$@spelldesc203316=Reduces the cooldown of Crusader Strike by ${$m2/-1000}.1 sec and gives it a {$h=15}% chance to reduce the cost of your next damaging or healing Holy Power ability by {$209785s1=1}.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Whisper of the Nathrezim 88.7 0.0 3.4sec 3.4sec 89.78% 77.31% 0.0(0.0) 19.2

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_whisper_of_the_nathrezim
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • whisper_of_the_nathrezim_1:89.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207635
  • name:Whisper of the Nathrezim
  • tooltip:Increases damage done by your next Templar's Verdict or Divine Storm by {$s1=25}%.
  • description:{$@spelldesc207633=Templar's Verdict and Divine Storm increase the damage of your next Templar's Verdict or Divine Storm within {$207635d=4 seconds} by {$207635s1=25}%.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Blessing of Might (blessing_of_might)

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_blessing_of_might
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_might_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203528
  • name:Greater Blessing of Might
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Paladin_Retribution_T19M
templars_verdict Holy Power 88.7 250.7 2.8 2.8 197772.3
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 9.77 45.86 (18.08%) 4.69 3.01 6.16%
arcane_torrent Holy Power 3.73 3.73 (1.47%) 1.00 0.00 0.00%
crusader_strike Holy Power 106.18 106.18 (41.86%) 1.00 0.00 0.00%
blade_of_justice Holy Power 48.93 97.86 (38.59%) 2.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.84 0.83
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.92 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
the_fires_of_justice 15.9 18.1sec
blade_of_wrath 34.5 8.7sec

Statistics & Data Analysis

Fight Length
Sample Data Paladin_Retribution_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Paladin_Retribution_T19M Damage Per Second
Count 7499
Mean 419767.77
Minimum 367949.08
Maximum 475377.03
Spread ( max - min ) 107427.95
Range [ ( max - min ) / 2 * 100% ] 12.80%
Standard Deviation 15380.8606
5th Percentile 394871.48
95th Percentile 445125.60
( 95th Percentile - 5th Percentile ) 50254.12
Mean Distribution
Standard Deviation 177.6147
95.00% Confidence Intervall ( 419419.65 - 420115.89 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5157
0.1 Scale Factor Error with Delta=300 2019505
0.05 Scale Factor Error with Delta=300 8078020
0.01 Scale Factor Error with Delta=300 201950505
Priority Target DPS
Sample Data Paladin_Retribution_T19M Priority Target Damage Per Second
Count 7499
Mean 419767.77
Minimum 367949.08
Maximum 475377.03
Spread ( max - min ) 107427.95
Range [ ( max - min ) / 2 * 100% ] 12.80%
Standard Deviation 15380.8606
5th Percentile 394871.48
95th Percentile 445125.60
( 95th Percentile - 5th Percentile ) 50254.12
Mean Distribution
Standard Deviation 177.6147
95.00% Confidence Intervall ( 419419.65 - 420115.89 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5157
0.1 Scale Factor Error with Delta=300 2019505
0.05 Scale Factor Error with Delta=300 8078020
0.01 Scale Factor Error with Delta=300 201950505
DPS(e)
Sample Data Paladin_Retribution_T19M Damage Per Second (Effective)
Count 7499
Mean 419767.77
Minimum 367949.08
Maximum 475377.03
Spread ( max - min ) 107427.95
Range [ ( max - min ) / 2 * 100% ] 12.80%
Damage
Sample Data Paladin_Retribution_T19M Damage
Count 7499
Mean 125873178.31
Minimum 92796550.26
Maximum 158638789.75
Spread ( max - min ) 65842239.49
Range [ ( max - min ) / 2 * 100% ] 26.15%
DTPS
Sample Data Paladin_Retribution_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Paladin_Retribution_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Paladin_Retribution_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Paladin_Retribution_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Paladin_Retribution_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Paladin_Retribution_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Paladin_Retribution_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Paladin_Retribution_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 greater_blessing_of_might
4 0.00 snapshot_stats
5 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_attack
0.00 rebuke
7 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
0.00 holy_wrath
0.00 avenging_wrath
8 3.80 shield_of_vengeance
9 3.01 crusade,if=holy_power>=5
A 1.00 wake_of_ashes,if=holy_power>=0&time<2
0.00 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 blood_fury
0.00 berserking
B 3.73 arcane_torrent,if=holy_power<5
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
C 37.71 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
D 26.92 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
E 8.77 wake_of_ashes,if=holy_power=0|holy_power=1&(cooldown.blade_of_justice.remains>gcd|cooldown.divine_hammer.remains>gcd)|holy_power=2&(cooldown.zeal.charges_fractional<=0.65|cooldown.crusader_strike.charges_fractional<=0.65)
0.00 zeal,if=charges=2&holy_power<=4
F 55.73 crusader_strike,if=charges=2&holy_power<=4
G 48.93 blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
0.00 divine_hammer,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
H 34.45 judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
I 6.18 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
J 16.53 templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 zeal,if=holy_power<=4
K 50.45 crusader_strike,if=holy_power<=4
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
L 1.36 templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

Sample Sequence

0123568A9HCBFJGFJGFHJFKGCFHFCFIFGCFHFCFJFGFCFHFDFGDECFGCFHIFGJFKDKGGHCFGCFIKHKDGFDEHCFGCFKKHCGJFKDKKGH8JKBDKGDEHCFKDGKKHCKJGKDGHFK97CKGCKHDECFGCFKHJKGJFKKDKGHDKKLKGKDHKKDGKDFGHDECFKDGHDFKKIGKH8IGFCBKJKKGHCKDECFGHCFGCFKKHCGJFKDKKGHDKDECFGHCFIKKK9HCGJFGJFKHDGFKDKKDEHCFGCFKJHGFJKKL8KGHDFBKDGKKHCGCFDEHCFGC

Sample Sequence Table

time name target resources buffs
Pre flask Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre food Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre augmentation Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre greater_blessing_of_might Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, potion_of_the_old_war
0:00.000 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:00.902 crusade Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:00.902 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, potion_of_the_old_war
0:01.771 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:02.630 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:02.630 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:03.410 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:04.189 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(7), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:04.942 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(7), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:05.698 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(7), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:06.454 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(10), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_wisps_blessing, mark_of_the_claw, potion_of_the_old_war
0:07.209 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(10), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_wisps_blessing, potion_of_the_old_war
0:07.962 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_wisps_blessing, potion_of_the_old_war
0:08.716 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_wisps_blessing, potion_of_the_old_war
0:09.471 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_wisps_blessing, potion_of_the_old_war
0:10.225 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_wisps_blessing, potion_of_the_old_war
0:10.980 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(13), the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, potion_of_the_old_war
0:11.799 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(13), the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, potion_of_the_old_war
0:12.554 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, potion_of_the_old_war
0:13.308 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, potion_of_the_old_war
0:14.062 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, potion_of_the_old_war
0:14.816 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, potion_of_the_old_war
0:15.571 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_ancients_blessing, potion_of_the_old_war
0:16.328 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
0:17.082 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
0:17.837 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:18.591 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:19.346 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:20.101 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:20.854 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:21.609 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:22.362 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:23.115 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim
0:23.870 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim
0:24.624 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim
0:25.380 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim
0:26.133 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim
0:26.885 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim
0:27.640 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim
0:28.395 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim
0:29.151 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim
0:29.904 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_sisters_blessing
0:30.658 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_sisters_blessing
0:31.412 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:32.257 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:33.102 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:33.944 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:34.789 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:35.634 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw
0:36.466 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw
0:37.299 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, the_fires_of_justice, whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw
0:38.132 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, the_fires_of_justice, whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw
0:38.966 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw
0:39.799 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:40.687 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:41.841 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:42.997 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
0:44.150 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
0:45.320 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
0:46.491 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:47.661 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
0:48.832 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, mark_of_the_claw
0:49.984 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, mark_of_the_claw
0:51.141 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:52.295 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
0:53.449 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, mark_of_the_claw
0:54.604 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:55.774 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim
0:56.944 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:58.116 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:59.285 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:00.459 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
1:01.628 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
1:02.800 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:03.969 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:05.140 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
1:06.311 Waiting 0.900 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
1:07.211 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
1:08.615 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:09.788 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:10.959 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:12.128 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:13.299 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:14.469 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:15.640 Waiting 0.200 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:15.840 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:17.190 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:18.361 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:19.533 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:20.703 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:21.874 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:23.044 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:24.215 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:25.387 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
1:26.560 Waiting 0.600 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:27.160 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:28.485 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power
1:29.654 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power mark_of_the_claw
1:30.000 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 4.0/5: 80% holy_power shield_of_vengeance, mark_of_the_claw
1:30.811 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power shield_of_vengeance, mark_of_the_claw
1:31.964 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
1:33.120 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
1:33.120 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
1:34.275 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
1:35.430 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:36.599 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:37.771 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
1:38.940 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:40.109 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:41.280 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:42.451 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:43.622 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:44.792 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:45.963 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:47.117 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:48.272 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, mark_of_the_claw
1:49.426 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, mark_of_the_claw
1:50.580 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:51.733 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:52.903 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:54.125 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:55.281 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
1:56.435 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
1:57.590 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:58.745 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
1:59.899 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
2:01.070 crusade Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
2:01.070 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade
2:01.070 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, potion_of_the_old_war
2:02.200 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), whisper_of_the_nathrezim, potion_of_the_old_war
2:03.225 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:04.251 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:05.278 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:06.220 Waiting 0.400 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:06.620 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:07.738 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), the_fires_of_justice, whisper_of_the_nathrezim, potion_of_the_old_war
2:08.678 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), whisper_of_the_nathrezim, potion_of_the_old_war
2:09.546 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(10), whisper_of_the_nathrezim, potion_of_the_old_war
2:10.413 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), whisper_of_the_nathrezim, potion_of_the_old_war
2:11.219 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(13), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:12.012 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:12.807 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:13.566 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:14.323 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:15.081 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:15.840 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:16.598 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:17.525 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:18.292 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:19.060 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:19.830 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:20.845 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:21.613 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:22.628 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:23.396 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:24.164 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:24.932 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:25.702 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:26.470 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
2:27.239 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim
2:28.008 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim
2:28.776 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
2:29.767 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim
2:30.534 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim
2:31.302 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
2:32.473 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
2:33.734 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim
2:34.905 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
2:36.075 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
2:37.230 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, mark_of_the_claw
2:38.384 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
2:39.538 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
2:40.693 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, cleansed_ancients_blessing, mark_of_the_claw
2:41.849 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power cleansed_ancients_blessing
2:43.023 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, cleansed_ancients_blessing
2:44.193 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, cleansed_ancients_blessing
2:45.364 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, cleansed_ancients_blessing, cleansed_sisters_blessing
2:46.458 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_ancients_blessing, cleansed_sisters_blessing
2:47.551 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, cleansed_ancients_blessing, cleansed_sisters_blessing
2:48.643 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, cleansed_ancients_blessing, cleansed_sisters_blessing
2:49.737 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
2:50.993 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
2:52.088 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
2:53.183 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, cleansed_sisters_blessing
2:54.278 Waiting 0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
2:54.478 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
2:55.806 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice
2:56.976 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
2:58.147 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:59.319 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, whisper_of_the_nathrezim
3:00.000 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, blade_of_wrath, shield_of_vengeance
3:00.490 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, blade_of_wrath, shield_of_vengeance
3:01.660 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
3:02.831 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:04.001 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:05.173 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:05.173 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:06.343 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:07.515 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:08.684 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:09.854 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:11.010 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance, mark_of_the_claw
3:12.165 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance, mark_of_the_claw
3:13.320 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:14.476 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:15.630 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:16.800 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
3:17.970 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:19.125 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:20.279 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw
3:21.434 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, cleansed_wisps_blessing, mark_of_the_claw
3:22.587 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing, mark_of_the_claw
3:23.742 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing
3:24.911 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing
3:26.082 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:27.251 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:28.421 Waiting 0.200 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:28.621 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:29.973 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:31.143 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:32.313 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
3:33.484 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
3:34.655 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:35.826 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
3:36.998 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:38.170 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:39.341 Waiting 0.600 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power the_fires_of_justice, whisper_of_the_nathrezim
3:39.941 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power the_fires_of_justice, whisper_of_the_nathrezim
3:41.268 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice
3:42.440 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice
3:43.609 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice
3:44.779 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
3:45.949 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:47.118 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:48.289 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:49.458 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
3:50.628 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim
3:51.800 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, whisper_of_the_nathrezim
3:52.971 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice
3:54.141 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:55.313 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, whisper_of_the_nathrezim, cleansed_wisps_blessing
3:56.485 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:57.657 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:58.827 Waiting 0.600 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
3:59.427 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power cleansed_wisps_blessing
4:00.753 Waiting 0.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power cleansed_wisps_blessing
4:00.853 crusade Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power cleansed_wisps_blessing
4:01.070 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, cleansed_wisps_blessing
4:02.259 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, cleansed_wisps_blessing
4:03.388 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), whisper_of_the_nathrezim, cleansed_wisps_blessing
4:04.415 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), whisper_of_the_nathrezim
4:05.444 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), whisper_of_the_nathrezim
4:06.386 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), blade_of_wrath, whisper_of_the_nathrezim
4:07.326 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), blade_of_wrath, whisper_of_the_nathrezim
4:08.267 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim
4:09.134 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim
4:10.001 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), whisper_of_the_nathrezim
4:11.009 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim
4:11.877 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim
4:12.682 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:13.476 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:14.272 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), whisper_of_the_nathrezim, mark_of_the_claw
4:15.065 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:15.822 Waiting 0.400 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:16.222 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:17.132 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:17.891 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:18.650 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:19.407 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), whisper_of_the_nathrezim
4:20.176 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
4:20.945 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
4:21.715 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), whisper_of_the_nathrezim
4:22.485 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
4:23.255 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
4:24.024 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim
4:24.793 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim
4:25.563 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:26.332 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:27.100 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:27.868 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:28.638 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:29.397 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:30.000 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:30.154 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:30.914 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:31.674 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:32.828 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:33.982 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:35.152 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:35.173 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:36.343 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance
4:37.513 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:38.684 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:39.838 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:40.993 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, blade_of_wrath, shield_of_vengeance, mark_of_the_claw
4:42.146 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, shield_of_vengeance, mark_of_the_claw
4:43.299 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:44.454 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:45.626 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
4:46.798 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
4:47.968 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:49.139 Waiting 0.900 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:50.039 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:51.370 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power cleansed_wisps_blessing
4:52.542 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
4:53.713 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing
4:54.884 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 27937 26231 14754 (12368)
Agility 3202 3202 0
Stamina 42162 42162 26174
Intellect 7331 7331 0
Spirit 2 2 0
Health 2529720 2529720 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 27937 26231 0
Crit 22.90% 22.90% 5916
Haste 28.63% 27.48% 8931
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 27937 26231 0
Mastery 37.10% 37.10% 5856
Armor 4346 4346 4346
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Crown of Steely Brambles
ilevel: 880, stats: { 593 Armor, +2573 Sta, +1715 StrInt, +949 Crit, +511 Mastery }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1448 Sta, +1115 Mastery, +939 Haste }, enchant: mark_of_the_claw
Local Shoulders Midnight Herald's Pauldrons
ilevel: 880, stats: { 547 Armor, +1930 Sta, +1287 StrInt, +735 Haste, +360 Crit }
Local Chest Horror Inscribed Chestguard
ilevel: 880, stats: { 729 Armor, +2573 Sta, +1715 StrInt, +1043 Crit, +417 Haste }
Local Waist Waistplate of Nameless Horror
ilevel: 880, stats: { 410 Armor, +1930 Sta, +1287 StrInt, +665 Haste, +430 Crit }
Local Legs Storm-Battered Legplates
ilevel: 880, stats: { 638 Armor, +2573 Sta, +1715 StrInt, +855 Haste, +605 Mastery }
Local Feet Trampling Warboots
ilevel: 880, stats: { 501 Armor, +1930 Sta, +1287 StrInt, +618 Mastery, +477 Haste }
Local Wrists Dragonbone Wristclamps
ilevel: 880, stats: { 319 Armor, +1447 Sta, +965 StrInt, +551 Mastery, +270 Haste }
Local Hands Fitted Ironbark Gauntlets
ilevel: 880, stats: { 456 Armor, +1930 Sta, +1287 StrInt, +712 Haste, +383 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Haste }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Haste }
Local Trinket1 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Trinket2 Spiked Counterweight
ilevel: 880, stats: { +1043 Haste }
Local Back Whisper of the Nathrezim
ilevel: 895, stats: { 153 Armor, +1665 Sta, +1110 StrInt, +559 Crit, +310 Haste }, enchant: { +200 Str }
Local Main Hand Ashbringer
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Seal of Light (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Paladin_Retribution_T19M"
level=110
race=blood_elf
role=attack
position=back
talents=1112112
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:44:3:47:3:49:1:50:3:51:3:52:3:53:3:54:1:350:1:351:1:352:1:353:1:1275:1
spec=retribution

head=crown_of_steely_brambles,id=139231,bonus_id=1806
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806,enchant=mark_of_the_claw
shoulders=midnight_heralds_pauldrons,id=139232,bonus_id=1806
back=whisper_of_the_nathrezim,id=137020,enchant=binding_of_strength
chest=horror_inscribed_chestguard,id=138216,bonus_id=1806
wrists=dragonbone_wristclamps,id=138218,bonus_id=1806
hands=fitted_ironbark_gauntlets,id=139225,bonus_id=1806
waist=waistplate_of_nameless_horror,id=139227,bonus_id=1806
legs=stormbattered_legplates,id=139230,bonus_id=1806
feet=trampling_warboots,id=139234,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=binding_of_haste
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=binding_of_haste
trinket1=natures_call,id=139334,bonus_id=1806
trinket2=spiked_counterweight,id=136715,bonus_id=1806
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=139265/139266/139265,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=882.73
# gear_strength=14754
# gear_stamina=26174
# gear_crit_rating=5916
# gear_haste_rating=8931
# gear_mastery_rating=5856
# gear_armor=4346

Priest_Shadow_T19M : 424147 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
424147.4 424147.4 236.8 / 0.056% 41261.3 / 9.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.16% 54.5 100.0% 100%
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Void Lord (Shadow Priest)
  • 75: Shadowy Insight (Shadow Priest)
  • 90: Power Infusion (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Priest_Shadow_T19M 424147
Deadly Grace 16486 3.8% 40.9 7.49sec 119033 0 Direct 40.9 95399 190737 119057 24.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.94 40.93 0.00 0.00 0.0000 0.0000 4872915.39 4872915.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.77 75.19% 95399.28 87090 104508 95395.16 90877 99864 2935746 2935746 0.00
crit 10.16 24.81% 190736.72 174181 209017 190741.89 174181 209017 1937170 1937170 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 91955 21.7% 110.3 2.71sec 250392 288688 Direct 111.3 198896 397605 248141 24.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.32 111.32 0.00 0.00 0.8673 0.0000 27623388.96 27623388.96 0.00 288687.88 288687.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.73 75.22% 198895.82 153942 240149 198876.43 189303 208452 16653767 16653767 0.00
crit 27.59 24.78% 397605.37 307883 480298 397550.62 358611 438314 10969622 10969622 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 33292 7.9% 75.9 3.89sec 131898 94748 Periodic 223.9 35834 71666 44735 24.8% 32.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.95 0.00 223.93 223.93 1.3921 0.4315 10017528.75 10017528.75 0.00 94748.12 94748.12
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.3 75.16% 35834.01 29483 46111 35841.50 34106 37943 6031149 6031149 0.00
crit 55.6 24.84% 71666.16 58966 92221 71682.54 65320 78529 3986380 3986380 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Plague Swarm 17626 4.2% 20.5 14.45sec 258002 0 Periodic 84.4 50282 100542 62726 24.8% 54.9%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.53 0.00 84.43 84.43 0.0000 1.9552 5295698.64 5295698.64 0.00 32081.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.5 75.24% 50282.19 24 57685 50298.61 46986 53534 3194092 3194092 0.00
crit 20.9 24.76% 100542.36 48 115371 100561.52 83971 111525 2101607 2101607 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 5360 1.3% 5.3 10.69sec 300563 342604 Direct 5.3 240637 482021 300558 24.8%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 5.34 0.00 0.00 0.8775 0.0000 1605097.98 1605097.98 0.00 342603.62 342603.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.01 75.17% 240636.99 192121 249757 240300.05 0 249757 966050 966050 0.00
crit 1.33 24.83% 482021.21 384241 499514 373116.35 0 499514 639048 639048 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 55614 (62084) 13.1% (14.6%) 3.6 107.58sec 5244335 5953412 Direct 3.6 36902 73975 46121 24.9%  
Periodic 264.9 50037 100123 62451 24.8% 98.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 3.56 264.91 264.91 0.8811 1.1174 16707936.40 16707936.40 0.00 62350.34 5953412.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.67 75.13% 36902.46 31076 63023 36046.16 0 62053 98612 98612 0.00
crit 0.88 24.87% 73975.02 62153 126046 45710.07 0 124107 65418 65418 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.2 75.21% 50036.74 37 90171 50031.18 47122 53110 9969775 9969775 0.00
crit 65.7 24.79% 100123.02 80 176464 100117.05 88377 112799 6574132 6574132 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.410000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 6471 1.5% 188.8 1.53sec 10300 0 Direct 104.2 18665 0 18665 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 188.75 104.16 0.00 0.00 0.0000 0.0000 1944104.38 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.16 100.00% 18665.14 9603 142152 18687.74 15680 22470 1944104 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 5560 1.3% 85.4 3.48sec 19570 0 Direct 84.2 15920 31835 19854 24.7%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.38 84.16 0.00 0.00 0.0000 0.0000 1670836.16 1670836.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.35 75.28% 15919.83 12315 19212 15920.30 14817 16972 1008551 1008551 0.00
crit 20.80 24.72% 31834.93 24631 38424 31832.50 27094 35698 662286 662286 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Tormenting Cyclone 9983 2.4% 15.4 19.00sec 195189 0 Direct 105.6 22761 45532 28396 24.7%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.36 105.60 0.00 0.00 0.0000 0.0000 2998533.29 2998533.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.46 75.25% 22760.60 17562 27396 22763.89 19956 25574 1808590 1808590 0.00
crit 26.13 24.75% 45531.71 35123 54792 45536.73 38635 52007 1189944 1189944 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Vampiric Touch 69505 16.4% 1.0 0.00sec 20878795 23678416 Periodic 177.3 94408 188858 117820 24.8% 99.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 177.26 177.26 0.8825 1.6807 20884363.17 20884363.17 0.00 69896.23 23678416.30
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.3 75.21% 94408.03 19645 167502 94400.33 89479 99600 12586100 12586100 0.00
crit 43.9 24.79% 188858.25 39088 331362 188843.92 161126 216061 8298263 8298263 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 64189 15.1% 75.8 3.76sec 254303 299154 Direct 75.5 204827 409479 255445 24.7%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.82 75.48 0.00 0.00 0.8501 0.0000 19281945.58 19281945.58 0.00 299153.60 299153.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.81 75.27% 204827.15 147731 230460 204816.71 198588 210420 11637229 11637229 0.00
crit 18.67 24.73% 409478.75 295462 460921 409480.66 384101 445557 7644717 7644717 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 4356 1.0% 7.3 42.56sec 178560 0 Direct 14.6 71780 143549 89698 25.0%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 14.59 0.00 0.00 0.0000 0.0000 1308256.89 1308256.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.94 75.04% 71780.19 67176 80611 71769.70 67176 77924 785596 785596 0.00
crit 3.64 24.96% 143549.47 134351 161222 140999.39 0 161222 522661 522661 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 21445 5.1% 5.1 62.67sec 1265199 299471 Periodic 40.1 128922 257382 160747 24.8% 6.7%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.10 0.00 40.13 40.13 4.2249 0.5049 6450002.39 6450002.39 0.00 299470.81 299470.81
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.2 75.23% 128922.47 194 153697 128902.63 114266 140753 3891474 3891474 0.00
crit 9.9 24.77% 257381.56 389 307394 257443.66 137311 307394 2558529 2558529 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 128012 / 9513
melee 128012 2.2% 27.7 7.00sec 102505 132144 Direct 27.7 82073 164141 102503 24.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.75 27.75 0.00 0.00 0.7757 0.0000 2844261.76 2844261.76 0.00 132143.74 132143.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.84 75.10% 82073.29 73399 84409 82039.28 78117 84409 1710349 1710349 0.00
crit 6.91 24.90% 164141.29 146798 168817 163846.00 0 168817 1133912 1133912 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 43980 / 10534
Mind Flay (_void_tendril) 43980 (51019) 2.5% (4.2%) 7.3 38.43sec 728386 82341 Periodic 64.8 39147 78294 48875 24.8% 21.6%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 0.00 64.83 64.83 8.8460 1.0000 3168369.94 3168369.94 0.00 82341.07 82341.07
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.7 75.15% 39147.00 39147 39147 39147.00 39147 39147 1907126 1907126 0.00
crit 16.1 24.85% 78294.00 78294 78294 78294.00 78294 78294 1261244 1261244 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43899 0.6% 1.8 85.90sec 432702 48841 Periodic 15.9 39147 78294 48840 24.8% 5.3%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.79 0.00 15.89 15.89 8.8598 1.0000 776273.16 776273.16 0.00 48840.64 48840.64
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.0 75.24% 39147.00 39147 39147 39080.80 0 39147 468182 468182 0.00
crit 3.9 24.76% 78294.00 78294 78294 74758.65 0 78294 308091 308091 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43920 0.4% 1.1 88.95sec 433334 48976 Periodic 9.4 39147 78294 48973 25.1% 3.1%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.06 0.00 9.39 9.39 8.8484 1.0000 459787.58 459787.58 0.00 48976.10 48976.10
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.0 74.90% 39147.00 39147 39147 38957.33 0 39147 275281 275281 0.00
crit 2.4 25.10% 78294.00 78294 78294 71921.23 0 78294 184507 184507 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43357 0.3% 1.0 0.00sec 424500 48343 Periodic 8.8 39147 78294 48342 23.5% 2.9%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 8.78 8.78 8.7812 1.0000 424500.28 424500.28 0.00 48343.05 48343.05
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.7 76.51% 39147.00 39147 39147 39147.00 39147 39147 263019 263019 0.00
crit 2.1 23.49% 78294.00 78294 78294 68507.25 0 78294 161481 161481 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 50891 0.4% 1.0 0.00sec 508911 56546 Periodic 9.0 39147 78294 56546 44.4% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 508911.00 508911.00 0.00 56545.67 56545.67
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.0 55.56% 39147.00 39147 39147 39147.00 39147 39147 195735 195735 0.00
crit 4.0 44.44% 78294.00 78294 78294 78294.00 78294 78294 313176 313176 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Priest_Shadow_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 181.93sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:false
  • if_expr:
 
Mental Fortitude 177.3 1.68sec

Stats details: mental_fortitude

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 177.26 177.26 0.00 0.00 0.0000 0.0000 0.00 13033605.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.23 75.16% 0.00 0 0 0.00 0 0 0 7850743 100.00
crit 44.02 24.84% 0.00 0 0 0.00 0 0 0 5182862 100.00
 
 

Action details: mental_fortitude

Static Values
  • id:194018
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:true
  • if_expr:
Spelldata
  • id:194018
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:51889.17
  • base_dd_max:51889.17
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Power Infusion 2.7 126.18sec

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.insanity_drain_stacks.stack>=85
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
 
Shadowfiend 1.9 199.11sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.89 0.00 0.00 0.00 0.8622 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Summons a shadowy fiend to attack the target for {$d=12 seconds}.
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - shadowfiend
Shadowcrawl 3.7 66.77sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.75 0.00 0.00 0.00 0.8597 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 182.0sec 182.0sec 6.77% 8.82% 0.0(0.0) 2.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 14.50% 0.0(0.0) 1.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 7.3 188.8 42.5sec 42.5sec 69.84% 69.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:5.03%
  • insanity_drain_stacks_2:2.43%
  • insanity_drain_stacks_3:2.50%
  • insanity_drain_stacks_4:2.48%
  • insanity_drain_stacks_5:2.40%
  • insanity_drain_stacks_6:2.42%
  • insanity_drain_stacks_7:2.39%
  • insanity_drain_stacks_8:2.39%
  • insanity_drain_stacks_9:2.45%
  • insanity_drain_stacks_10:2.36%
  • insanity_drain_stacks_11:2.92%
  • insanity_drain_stacks_12:2.86%
  • insanity_drain_stacks_13:2.38%
  • insanity_drain_stacks_14:3.22%
  • insanity_drain_stacks_15:2.67%
  • insanity_drain_stacks_16:2.36%
  • insanity_drain_stacks_17:2.56%
  • insanity_drain_stacks_18:2.40%
  • insanity_drain_stacks_19:2.27%
  • insanity_drain_stacks_20:2.29%
  • insanity_drain_stacks_21:2.26%
  • insanity_drain_stacks_22:2.12%
  • insanity_drain_stacks_23:1.97%
  • insanity_drain_stacks_24:1.80%
  • insanity_drain_stacks_25:1.51%
  • insanity_drain_stacks_26:1.30%
  • insanity_drain_stacks_27:1.10%
  • insanity_drain_stacks_28:0.96%
  • insanity_drain_stacks_29:0.89%
  • insanity_drain_stacks_30:0.85%
  • insanity_drain_stacks_31:0.80%
  • insanity_drain_stacks_32:0.69%
  • insanity_drain_stacks_33:0.49%
  • insanity_drain_stacks_34:0.24%
  • insanity_drain_stacks_35:0.10%
  • insanity_drain_stacks_36:0.02%
  • insanity_drain_stacks_37:0.00%
  • insanity_drain_stacks_38:0.00%
  • insanity_drain_stacks_39:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 7.3 0.0 39.8sec 39.8sec 43.00% 86.11% 0.0(0.0) 6.1

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_20:0.01%
  • lingering_insanity_21:0.72%
  • lingering_insanity_22:3.55%
  • lingering_insanity_23:1.71%
  • lingering_insanity_24:3.69%
  • lingering_insanity_25:1.60%
  • lingering_insanity_26:0.53%
  • lingering_insanity_27:0.81%
  • lingering_insanity_28:1.47%
  • lingering_insanity_29:3.85%
  • lingering_insanity_30:2.64%
  • lingering_insanity_31:3.26%
  • lingering_insanity_32:1.51%
  • lingering_insanity_33:1.18%
  • lingering_insanity_34:1.77%
  • lingering_insanity_35:2.38%
  • lingering_insanity_36:4.97%
  • lingering_insanity_37:4.15%
  • lingering_insanity_38:2.22%
  • lingering_insanity_39:0.92%
  • lingering_insanity_40:0.05%
  • lingering_insanity_41:0.02%
  • lingering_insanity_42:0.00%
  • lingering_insanity_43:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.3 3.0 26.3sec 20.3sec 25.34% 25.34% 3.0(3.0) 11.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Mental Fortitude 1.0 176.3 3.5sec 1.7sec 98.81% 98.81% 176.3(176.3) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • mental_fortitude_1:98.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194018
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 264.3sec 0.0sec 19.62% 19.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power Infusion 2.7 0.0 126.2sec 126.2sec 17.40% 17.40% 0.0(0.0) 2.5

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • power_infusion_1:17.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowy Insight 25.2 1.3 11.5sec 10.9sec 9.03% 9.03% 1.3(1.3) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

  • shadowy_insight_1:9.03%

Trigger Attempt Success

  • trigger_pct:10.00%

Spelldata details

  • id:162452
  • name:Shadowy Insight
  • tooltip:
  • description:Shadow Word: Pain periodic damage has a {$h=10}% chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
Sphere of Insanity 7.3 0.0 42.5sec 42.5sec 69.84% 71.07% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:69.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 1.0 195.6 0.0sec 0.5sec 34.99% 34.99% 195.6(195.6) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:34.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 5.1 0.0 62.7sec 62.7sec 6.74% 6.74% 0.0(0.0) 5.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 7.3 0.0 42.5sec 42.5sec 69.84% 73.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.44%
  • voidform_2:2.43%
  • voidform_3:2.42%
  • voidform_4:2.41%
  • voidform_5:2.41%
  • voidform_6:2.40%
  • voidform_7:2.39%
  • voidform_8:2.38%
  • voidform_9:2.37%
  • voidform_10:2.36%
  • voidform_11:2.35%
  • voidform_12:2.34%
  • voidform_13:2.34%
  • voidform_14:2.33%
  • voidform_15:2.32%
  • voidform_16:2.31%
  • voidform_17:2.30%
  • voidform_18:2.29%
  • voidform_19:2.28%
  • voidform_20:2.27%
  • voidform_21:2.26%
  • voidform_22:2.14%
  • voidform_23:1.98%
  • voidform_24:1.85%
  • voidform_25:1.70%
  • voidform_26:1.65%
  • voidform_27:1.61%
  • voidform_28:1.55%
  • voidform_29:1.41%
  • voidform_30:1.24%
  • voidform_31:1.08%
  • voidform_32:0.95%
  • voidform_33:0.88%
  • voidform_34:0.81%
  • voidform_35:0.70%
  • voidform_36:0.51%
  • voidform_37:0.25%
  • voidform_38:0.11%
  • voidform_39:0.02%
  • voidform_40:0.00%
  • voidform_41:0.00%
  • voidform_42:0.00%
  • voidform_43:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend: Shadowcrawl 3.7 0.0 66.7sec 66.7sec 83.50% 78.45% 0.0(0.0) 3.7

Buff details

  • buff initial source:Priest_Shadow_T19M_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:83.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T19M
Resource Gains Type Count Total Average Overflow
Insanity Drained by Voidform Insanity 4199.00 -3191.35 (-4982.37%) -0.76 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 111.32 1318.58 (2058.58%) 11.85 17.25 1.29%
Insanity Gained from Mind Flay Insanity 223.94 447.87 (699.22%) 2.00 0.00 0.00%
Insanity Gained from Power Infusion Insanity 77.49 126.21 (197.04%) 1.63 70.21 35.74%
Insanity Gained from Shadow Word: Death Insanity 5.34 51.66 (80.66%) 9.67 1.86 3.48%
Insanity Gained from Shadow Word: Pain Casts Insanity 3.56 10.67 (16.66%) 3.00 0.00 0.00%
Insanity Gained from Vampiric Touch Casts Insanity 1.00 4.00 (6.25%) 4.00 0.00 0.00%
Insanity Gained from Void Bolt Insanity 75.82 1058.15 (1651.99%) 13.96 155.01 12.78%
Insanity Saved by Void Torrent Insanity 402.84 238.26 (371.97%) 0.59 0.00 0.00%
Health from Vampiric Touch Ticks Health 177.26 0.00 (0.00%) 0.00 10442107.89 100.00%
mp5_regen Mana 888.37 0.00 (0.00%) 0.00 2642254.25 100.00%
Resource RPS-Gain RPS-Loss
Insanity 10.83 10.62
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 63.79 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 85.4 3.5sec
Shadowy Insight Mind Blast CD Reset from Shadow Word: Pain 25.2 11.5sec
Shadowy Insight Mind Blast CD Reset lost to overflow 1.3 78.8sec
Void Eruption casted when a target with both DoTs was up 7.3 42.5sec
Void Tendril spawned from Call to the Void 8.9 30.9sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Priest_Shadow_T19M Damage Per Second
Count 7499
Mean 424147.40
Minimum 387786.17
Maximum 470953.97
Spread ( max - min ) 83167.80
Range [ ( max - min ) / 2 * 100% ] 9.80%
Standard Deviation 10462.3746
5th Percentile 407175.99
95th Percentile 442142.66
( 95th Percentile - 5th Percentile ) 34966.68
Mean Distribution
Standard Deviation 120.8172
95.00% Confidence Intervall ( 423910.60 - 424384.20 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2337
0.1 Scale Factor Error with Delta=300 934424
0.05 Scale Factor Error with Delta=300 3737697
0.01 Scale Factor Error with Delta=300 93442446
Priority Target DPS
Sample Data Priest_Shadow_T19M Priority Target Damage Per Second
Count 7499
Mean 424147.40
Minimum 387786.17
Maximum 470953.97
Spread ( max - min ) 83167.80
Range [ ( max - min ) / 2 * 100% ] 9.80%
Standard Deviation 10462.3746
5th Percentile 407175.99
95th Percentile 442142.66
( 95th Percentile - 5th Percentile ) 34966.68
Mean Distribution
Standard Deviation 120.8172
95.00% Confidence Intervall ( 423910.60 - 424384.20 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2337
0.1 Scale Factor Error with Delta=300 934424
0.05 Scale Factor Error with Delta=300 3737697
0.01 Scale Factor Error with Delta=300 93442446
DPS(e)
Sample Data Priest_Shadow_T19M Damage Per Second (Effective)
Count 7499
Mean 424147.40
Minimum 387786.17
Maximum 470953.97
Spread ( max - min ) 83167.80
Range [ ( max - min ) / 2 * 100% ] 9.80%
Damage
Sample Data Priest_Shadow_T19M Damage
Count 7499
Mean 120660607.98
Minimum 88728277.19
Maximum 155204460.00
Spread ( max - min ) 66476182.81
Range [ ( max - min ) / 2 * 100% ] 27.55%
DTPS
Sample Data Priest_Shadow_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Priest_Shadow_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Priest_Shadow_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Priest_Shadow_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 2.58 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 1.00 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 7.33 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
E 0.83 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
F 27.92 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
G 1.18 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
H 20.50 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
I 2.71 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
J 2.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
K 3.23 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
L 72.59 void_bolt
M 5.10 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
N 1.41 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
O 81.48 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
P 3.10 shadow_word_death,if=cooldown.shadow_word_death.charges=2
Q 1.89 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
R 0.97 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
S 0.00 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
T 36.32 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain

Sample Sequence

012456BCFFHFFDMKOOKRTIJLOLOLOLOLOLOLOLOLOLOLOLOLOOLOOLOOLQFFHFHFDTLTLOOLOOLMLOOLOOLTLOTLOOHFFHFFHDTLOOLOTLOOLTLOTLOTLTFHFHFFHBDMLOOLOOILOOLOTLOOLTLOTLOTLTLOOLTLOTHFFFHFFHDTLOTLOTLOOLOTLTLMJLOOLOOLOOLTFHFHFFFFHDTLOOLOTLOTLOTLOOLOPLOQLNOLFFHFH7EFDMKOOLOOILPTLOOLOOLTLOOLOPLOTLTLOOLOOLNN

Sample Sequence Table

time name target resources buffs
Pre flask Priest_Shadow_T19M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Priest_Shadow_T19M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Priest_Shadow_T19M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity mark_of_the_claw, potion_of_deadly_grace
0:00.000 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity mark_of_the_claw, potion_of_deadly_grace
0:00.877 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:01.754 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:02.630 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:03.505 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:08.159 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:09.047 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:09.933 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:09.933 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace, mental_fortitude
0:14.125 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.2/100: 85% insanity bloodlust, sphere_of_insanity, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace, mental_fortitude
0:14.970 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.3/100: 92% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
0:15.808 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.8/100: 96% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
0:16.645 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.3/100: 99% insanity bloodlust, sphere_of_insanity, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace, mental_fortitude
0:17.465 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 91% insanity bloodlust, sphere_of_insanity, voidform(8), insanity_drain_stacks(5), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:18.273 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity bloodlust, sphere_of_insanity, voidform(9), insanity_drain_stacks(6), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:19.075 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity bloodlust, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:19.075 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:19.075 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:19.828 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:20.576 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:21.470 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(9), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:22.221 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.7/100: 96% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:23.093 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:23.853 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.5/100: 95% insanity bloodlust, berserking, power_infusion, shadowy_insight, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
0:24.704 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), potion_of_deadly_grace, mental_fortitude
0:25.454 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), potion_of_deadly_grace, mental_fortitude
0:26.298 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), potion_of_deadly_grace, mental_fortitude
0:27.050 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.4/100: 92% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
0:27.875 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
0:28.624 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mental_fortitude
0:29.476 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.7/100: 87% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mental_fortitude
0:30.228 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), mental_fortitude
0:31.131 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.1/100: 87% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mental_fortitude
0:31.885 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mental_fortitude
0:32.871 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), mental_fortitude
0:33.621 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mental_fortitude
0:34.579 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mental_fortitude
0:35.330 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.1/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), mental_fortitude
0:36.274 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), mental_fortitude
0:37.026 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), mental_fortitude
0:37.944 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.3/100: 84% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mental_fortitude
0:38.698 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 84% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mental_fortitude
0:39.712 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity bloodlust, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mental_fortitude
0:40.599 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mental_fortitude
0:41.480 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.3/100: 66% insanity shadowy_insight, sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mental_fortitude
0:42.349 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.6/100: 62% insanity sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mental_fortitude
0:43.211 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.8/100: 54% insanity sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mental_fortitude
0:44.070 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.4/100: 45% insanity sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mental_fortitude
0:44.925 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mental_fortitude
0:45.779 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.7/100: 32% insanity sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mental_fortitude
0:46.651 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.2/100: 21% insanity sphere_of_insanity, voidform(37), insanity_drain_stacks(34), mental_fortitude
0:47.488 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.4/100: 15% insanity sphere_of_insanity, voidform(38), insanity_drain_stacks(35), mental_fortitude
0:48.319 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(39), mental_fortitude
0:49.150 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(39), mental_fortitude
0:49.982 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(39), mental_fortitude
0:54.399 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity lingering_insanity(39), mental_fortitude
0:55.228 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity lingering_insanity(39), mental_fortitude
0:59.176 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(39), mark_of_the_claw, mental_fortitude
0:59.995 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity lingering_insanity(39), mark_of_the_claw, mental_fortitude
0:59.995 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity sphere_of_insanity, voidform, lingering_insanity(39), insanity_drain_stacks, mark_of_the_claw, mental_fortitude
1:01.765 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.2/100: 78% insanity sphere_of_insanity, voidform(2), lingering_insanity(39), insanity_drain_stacks(2), mark_of_the_claw, mental_fortitude
1:02.563 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity sphere_of_insanity, voidform(3), lingering_insanity(39), insanity_drain_stacks(3), mark_of_the_claw, mental_fortitude
1:04.457 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.9/100: 75% insanity sphere_of_insanity, voidform(5), lingering_insanity(39), insanity_drain_stacks(5), mental_fortitude
1:05.244 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity sphere_of_insanity, voidform(6), lingering_insanity(39), insanity_drain_stacks(6), mental_fortitude
1:06.027 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.9/100: 86% insanity sphere_of_insanity, voidform(7), lingering_insanity(39), insanity_drain_stacks(7), mental_fortitude
1:06.803 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.3/100: 88% insanity sphere_of_insanity, voidform(7), lingering_insanity(39), insanity_drain_stacks(7), mental_fortitude
1:07.572 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity sphere_of_insanity, voidform(8), lingering_insanity(39), insanity_drain_stacks(8), mental_fortitude
1:08.469 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
1:09.526 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity shadowy_insight, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
1:10.566 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity shadowy_insight, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:14.793 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity shadowy_insight, sphere_of_insanity, voidform(15), insanity_drain_stacks(11), mental_fortitude
1:15.790 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(12), mental_fortitude
1:16.778 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.1/100: 82% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(13), mental_fortitude
1:17.763 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(14), mental_fortitude
1:18.732 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.1/100: 80% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(15), mental_fortitude
1:19.701 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.1/100: 76% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(16), mental_fortitude
1:20.709 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mental_fortitude
1:21.656 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.3/100: 71% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mental_fortitude
1:23.724 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.7/100: 43% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mental_fortitude
1:24.646 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.9/100: 41% insanity sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mental_fortitude
1:25.569 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.8/100: 36% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
1:26.469 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.2/100: 22% insanity sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mark_of_the_claw, mental_fortitude
1:27.363 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.2/100: 20% insanity sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mark_of_the_claw, mental_fortitude
1:28.250 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.9/100: 14% insanity sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mark_of_the_claw, mental_fortitude
1:29.132 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(29), mark_of_the_claw, mental_fortitude
1:31.609 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity lingering_insanity(29), mental_fortitude
1:32.503 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity lingering_insanity(29), mental_fortitude
1:33.396 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity lingering_insanity(29), mental_fortitude
1:36.359 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(29), mental_fortitude
1:37.255 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(29), mental_fortitude
1:38.149 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity lingering_insanity(29), mental_fortitude
1:39.641 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity lingering_insanity(29), mental_fortitude
1:39.641 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity sphere_of_insanity, voidform, lingering_insanity(29), insanity_drain_stacks, mental_fortitude
1:41.643 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity sphere_of_insanity, voidform(3), lingering_insanity(29), insanity_drain_stacks(3), mental_fortitude
1:42.510 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity sphere_of_insanity, voidform(3), lingering_insanity(29), insanity_drain_stacks(3), mental_fortitude
1:43.371 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity sphere_of_insanity, voidform(4), lingering_insanity(29), insanity_drain_stacks(4), mental_fortitude
1:44.230 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity sphere_of_insanity, voidform(5), lingering_insanity(29), insanity_drain_stacks(5), mental_fortitude
1:45.076 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity sphere_of_insanity, voidform(6), lingering_insanity(29), insanity_drain_stacks(6), mental_fortitude
1:45.920 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity sphere_of_insanity, voidform(7), lingering_insanity(29), insanity_drain_stacks(7), mental_fortitude
1:46.754 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.8/100: 87% insanity sphere_of_insanity, voidform(8), lingering_insanity(29), insanity_drain_stacks(8), mental_fortitude
1:47.581 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity sphere_of_insanity, voidform(8), lingering_insanity(29), insanity_drain_stacks(8), mental_fortitude
1:48.620 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
1:49.680 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:50.717 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
1:52.957 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.4/100: 60% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:53.966 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.1/100: 61% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
1:54.968 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.1/100: 57% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
1:55.960 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.7/100: 45% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
1:56.941 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.6/100: 45% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
1:57.917 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.3/100: 39% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
1:58.886 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.2/100: 26% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
1:59.843 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
2:01.973 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity lingering_insanity(22), mental_fortitude
2:02.917 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity lingering_insanity(22), mental_fortitude
2:04.558 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(22), mental_fortitude
2:05.502 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(22), mental_fortitude
2:09.140 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity lingering_insanity(22), mental_fortitude
2:10.083 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(22), mental_fortitude
2:11.028 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(22), mental_fortitude
2:15.452 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity lingering_insanity(22), mental_fortitude
2:16.397 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity lingering_insanity(22), mental_fortitude
2:16.397 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity sphere_of_insanity, voidform, lingering_insanity(22), insanity_drain_stacks, mental_fortitude
2:20.633 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity shadowy_insight, sphere_of_insanity, voidform(5), lingering_insanity(22), insanity_drain_stacks(2), mental_fortitude
2:21.532 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity sphere_of_insanity, voidform(6), lingering_insanity(22), insanity_drain_stacks(3), mental_fortitude
2:22.422 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(4), mental_fortitude
2:23.306 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(4), mental_fortitude
2:24.182 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity sphere_of_insanity, voidform(8), lingering_insanity(22), insanity_drain_stacks(5), mental_fortitude
2:25.194 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(6), mental_fortitude
2:26.244 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mental_fortitude
2:26.244 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mental_fortitude
2:27.074 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), mental_fortitude
2:27.906 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.1/100: 94% insanity power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(9), mental_fortitude
2:28.729 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.6/100: 99% insanity power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), mental_fortitude
2:29.544 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), mental_fortitude
2:30.355 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.5/100: 93% insanity power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), mark_of_the_claw, mental_fortitude
2:31.154 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), mark_of_the_claw, mental_fortitude
2:31.942 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), mark_of_the_claw, mental_fortitude
2:32.726 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), mark_of_the_claw, mental_fortitude
2:33.503 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.9/100: 91% insanity power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), mark_of_the_claw, mental_fortitude
2:34.274 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), mark_of_the_claw, mental_fortitude
2:36.025 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.4/100: 69% insanity power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mental_fortitude
2:36.790 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.6/100: 77% insanity power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), mental_fortitude
2:37.554 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.8/100: 78% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mental_fortitude
2:38.309 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.3/100: 69% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mental_fortitude
2:39.059 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), mental_fortitude
2:39.811 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mental_fortitude
2:40.556 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.6/100: 68% insanity power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
2:41.310 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.4/100: 73% insanity power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
2:42.961 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.4/100: 50% insanity power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), mark_of_the_claw, mental_fortitude
2:43.713 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), mark_of_the_claw, mental_fortitude
2:44.467 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.3/100: 54% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mark_of_the_claw, mental_fortitude
2:45.319 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.5/100: 51% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mark_of_the_claw, mental_fortitude
2:46.070 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity power_infusion, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mental_fortitude
2:47.732 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.4/100: 26% insanity sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mental_fortitude
2:48.603 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.7/100: 22% insanity sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mental_fortitude
2:49.469 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mental_fortitude
2:50.330 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity lingering_insanity(34), mental_fortitude
2:51.553 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity lingering_insanity(34), mental_fortitude
2:52.413 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(34), mental_fortitude
2:53.273 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(34), mental_fortitude
2:54.134 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(34), mental_fortitude
2:56.631 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity lingering_insanity(34), mental_fortitude
2:57.490 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity lingering_insanity(34), mental_fortitude
2:58.350 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity lingering_insanity(34), mental_fortitude
3:00.665 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity lingering_insanity(34), mental_fortitude
3:00.665 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity sphere_of_insanity, voidform, lingering_insanity(34), insanity_drain_stacks, mental_fortitude
3:02.492 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.8/100: 78% insanity sphere_of_insanity, voidform(2), lingering_insanity(34), insanity_drain_stacks(2), mental_fortitude
3:03.329 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity sphere_of_insanity, voidform(3), lingering_insanity(34), insanity_drain_stacks(3), mental_fortitude
3:04.164 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity sphere_of_insanity, voidform(4), lingering_insanity(34), insanity_drain_stacks(4), mental_fortitude
3:04.990 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity sphere_of_insanity, voidform(5), lingering_insanity(34), insanity_drain_stacks(5), mental_fortitude
3:05.807 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.2/100: 91% insanity sphere_of_insanity, voidform(6), lingering_insanity(34), insanity_drain_stacks(6), mental_fortitude
3:06.618 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.9/100: 94% insanity sphere_of_insanity, voidform(6), lingering_insanity(34), insanity_drain_stacks(6), mental_fortitude
3:07.430 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.3/100: 88% insanity sphere_of_insanity, voidform(7), lingering_insanity(34), insanity_drain_stacks(7), mental_fortitude
3:08.226 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity sphere_of_insanity, voidform(8), lingering_insanity(34), insanity_drain_stacks(8), mental_fortitude
3:09.139 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.1/100: 91% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
3:10.190 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
3:11.232 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
3:12.270 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
3:13.298 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
3:14.310 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.4/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
3:16.539 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.7/100: 46% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
3:17.521 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.8/100: 45% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
3:21.734 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.4/100: 41% insanity twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mark_of_the_claw, mental_fortitude
3:21.734 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.4/100: 41% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mark_of_the_claw, mental_fortitude
3:22.545 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.8/100: 44% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mark_of_the_claw, mental_fortitude
3:23.357 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.5/100: 42% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(19), mental_fortitude
3:24.172 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.2/100: 38% insanity berserking, twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mental_fortitude
3:24.979 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.5/100: 39% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mental_fortitude
3:25.781 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.3/100: 36% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mental_fortitude
3:26.576 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.1/100: 33% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
3:27.357 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.1/100: 34% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mark_of_the_claw, mental_fortitude
3:28.138 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.1/100: 30% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mark_of_the_claw, mental_fortitude
3:28.947 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.8/100: 26% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mark_of_the_claw, mental_fortitude
3:29.714 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.1/100: 26% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mark_of_the_claw, mental_fortitude
3:31.425 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity berserking, twist_of_fate, lingering_insanity(31), mark_of_the_claw, mental_fortitude
3:32.246 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity twist_of_fate, lingering_insanity(31), mark_of_the_claw, mental_fortitude
3:33.883 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity twist_of_fate, lingering_insanity(31), mental_fortitude
3:34.763 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity twist_of_fate, lingering_insanity(31), mental_fortitude
3:35.919 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity twist_of_fate, lingering_insanity(31), mental_fortitude
3:36.801 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity twist_of_fate, lingering_insanity(31), mental_fortitude
3:37.682 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity twist_of_fate, lingering_insanity(31), mental_fortitude
3:38.563 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, lingering_insanity(31), mental_fortitude
3:39.444 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity twist_of_fate, lingering_insanity(31), mental_fortitude
3:40.543 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, lingering_insanity(31), mental_fortitude
3:40.543 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(31), insanity_drain_stacks, mental_fortitude
3:42.644 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(31), insanity_drain_stacks(3), mental_fortitude
3:43.498 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(31), insanity_drain_stacks(3), mental_fortitude
3:44.353 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.9/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(31), insanity_drain_stacks(4), mental_fortitude
3:45.359 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.1/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(31), insanity_drain_stacks(5), mental_fortitude
3:46.189 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.2/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(31), insanity_drain_stacks(6), mental_fortitude
3:47.014 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(31), insanity_drain_stacks(7), mental_fortitude
3:47.839 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(31), insanity_drain_stacks(8), mental_fortitude
3:48.690 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.7/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
3:49.745 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
3:50.791 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.1/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
3:51.827 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.4/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
3:52.855 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.3/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
3:53.875 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.3/100: 65% insanity twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
3:54.881 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
3:55.882 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
3:56.876 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.6/100: 58% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
3:57.859 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.6/100: 57% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
3:58.835 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.2/100: 52% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
3:59.800 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.2/100: 44% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
4:00.760 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.8/100: 43% insanity twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
4:01.711 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.8/100: 37% insanity twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mental_fortitude
4:02.654 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.6/100: 19% insanity twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mental_fortitude
4:03.590 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.6/100: 17% insanity twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(24), insanity_drain_stacks(24), mental_fortitude
4:04.520 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.6/100: 8% insanity twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(24), mental_fortitude
4:05.441 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.7/100: 1% insanity twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(25), mental_fortitude
4:06.357 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(26), mental_fortitude
4:07.272 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(26), mental_fortitude
4:08.188 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity twist_of_fate, lingering_insanity(26), mental_fortitude
4:12.917 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity twist_of_fate, lingering_insanity(26), mental_fortitude
4:13.832 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity twist_of_fate, lingering_insanity(26), mental_fortitude
4:17.357 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, shadowy_insight, lingering_insanity(26), mental_fortitude
4:17.357 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, shadowy_insight, lingering_insanity(26), potion_of_deadly_grace, mental_fortitude
4:18.273 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, lingering_insanity(26), potion_of_deadly_grace, mental_fortitude
4:19.189 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity twist_of_fate, lingering_insanity(26), potion_of_deadly_grace, mental_fortitude
4:19.189 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(26), insanity_drain_stacks, potion_of_deadly_grace, mental_fortitude
4:23.388 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(5), lingering_insanity(26), insanity_drain_stacks(2), potion_of_deadly_grace, mental_fortitude
4:24.258 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(26), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
4:25.122 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(26), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
4:25.987 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(26), insanity_drain_stacks(4), potion_of_deadly_grace, mental_fortitude
4:26.836 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.9/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(26), insanity_drain_stacks(5), potion_of_deadly_grace, mental_fortitude
4:27.805 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.9/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(6), potion_of_deadly_grace, mental_fortitude
4:28.864 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.6/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
4:28.864 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.6/100: 92% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
4:29.697 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace, mental_fortitude
4:30.515 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(9), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:31.329 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity power_infusion, twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:32.136 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.6/100: 90% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:32.938 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.8/100: 89% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:33.736 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.6/100: 93% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:34.527 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:35.310 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:36.089 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:36.862 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:38.581 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.5/100: 70% insanity power_infusion, twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:39.337 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.7/100: 78% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:40.092 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:40.847 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), potion_of_deadly_grace, mental_fortitude
4:41.599 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), potion_of_deadly_grace, mental_fortitude
4:42.352 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.8/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), potion_of_deadly_grace, mental_fortitude
4:43.106 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), potion_of_deadly_grace, mental_fortitude
4:43.854 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), potion_of_deadly_grace, mental_fortitude
4:44.603 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), potion_of_deadly_grace, mental_fortitude
4:45.355 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), potion_of_deadly_grace, mental_fortitude
4:46.110 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.0/100: 81% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), potion_of_deadly_grace, mental_fortitude
4:47.855 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.4/100: 54% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mental_fortitude
4:48.606 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.2/100: 58% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mental_fortitude
4:49.483 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.5/100: 51% insanity twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mental_fortitude
4:50.361 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.5/100: 43% insanity twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mental_fortitude
4:51.234 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.9/100: 40% insanity twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mental_fortitude
4:52.102 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.2/100: 31% insanity twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mental_fortitude
4:52.970 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.9/100: 23% insanity twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mark_of_the_claw, mental_fortitude
4:53.815 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.5/100: 18% insanity twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mark_of_the_claw, mental_fortitude
4:54.657 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.6/100: 8% insanity twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mark_of_the_claw, mental_fortitude

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 42217 42217 26216
Intellect 39146 37440 28334 (2596)
Spirit 1 1 0
Health 2533020 2533020 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 39146 37440 0
Crit 24.40% 24.40% 6790
Haste 30.67% 29.51% 9592
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 8800 8800 0
Mastery 43.43% 43.43% 3280
Armor 1819 1819 1819
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 884.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_claw
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Dreamscale Inlaid Vestments
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +918 Haste, +542 Mastery }
Local Waist Mangaza's Madness
ilevel: 895, stats: { 172 Armor, +2219 Sta, +1479 Int, +745 Crit, +413 Haste }
Local Legs Ragged Horrorweave Leggings
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +824 Haste, +636 Mastery }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +735 Haste, +360 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +569 Haste, +252 Mastery }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Haste }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Haste }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 906, weapon: { 1922 - 3571, 1.8 }, stats: { +937 Int, +1405 Sta, +350 Crit, +337 Mastery, +11921 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Secrets of the Void
ilevel: 906, stats: { +1230 Int, +1844 Sta, +627 Haste, +278 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Priest_Shadow_T19M"
level=110
race=troll
role=spell
position=back
talents=1211311
artifact=47:139251:139257:139251:0:764:1:765:1:766:1:767:3:768:1:769:1:770:1:771:3:772:5:773:3:774:3:775:3:776:4:777:3:778:3:779:1:1347:1
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_claw
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=200int
chest=dreamscale_inlaid_vestments,id=138215,bonus_id=1806
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1806
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=mangazas_madness,id=132864
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1806
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=200haste
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200haste
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=139251/139257/139251,relic_id=1806/1806/1806
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=884.19
# gear_stamina=26216
# gear_intellect=28334
# gear_crit_rating=6790
# gear_haste_rating=9592
# gear_mastery_rating=3280
# gear_armor=1819

Priest_Shadow_T19M_S2M : 475577 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
475577.2 475577.2 872.0 / 0.183% 163009.7 / 34.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 5.44% 51.7 100.0% 100%
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Shadowy Insight (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Surrender to Madness (Shadow Priest)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Priest_Shadow_T19M_S2M 475577
Deadly Grace 18871 3.9% 46.0 6.33sec 121082 0 Direct 46.0 97193 194248 121083 24.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.98 45.98 0.00 0.00 0.0000 0.0000 5567443.04 5567443.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.66 75.38% 97192.91 79173 104508 96944.60 86562 101699 3368795 3368795 0.00
crit 11.32 24.62% 194247.52 158346 209017 193754.93 0 209017 2198648 2198648 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 86547 18.2% 100.8 2.80sec 257550 293219 Direct 101.8 204372 408588 255021 24.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.78 101.78 0.00 0.00 0.8784 0.0000 25956337.87 25956337.87 0.00 293219.06 293219.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.54 75.20% 204372.34 153942 240149 204378.16 189053 214794 15642417 15642417 0.00
crit 25.24 24.80% 408588.23 307883 480298 408610.56 344829 450829 10313921 10313921 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 25484 5.4% 58.9 4.23sec 130031 90722 Periodic 172.4 35596 71176 44411 24.8% 25.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.88 0.00 172.39 172.39 1.4333 0.4494 7656149.14 7656149.14 0.00 90722.34 90722.34
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 129.7 75.23% 35595.56 29483 46111 35626.19 33669 37862 4616198 4616198 0.00
crit 42.7 24.77% 71176.25 58966 92221 71239.12 64307 79969 3039951 3039951 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Plague Swarm 17538 3.7% 20.3 14.31sec 259446 0 Periodic 83.6 50485 100931 63011 24.8% 54.4%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.29 0.00 83.55 83.55 0.0000 1.9563 5264860.84 5264860.84 0.00 32209.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.8 75.17% 50484.86 24 57685 50514.31 45046 54481 3170836 3170836 0.00
crit 20.7 24.83% 100930.87 44 115371 100971.37 81227 113623 2094024 2094024 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 8867 1.9% 8.5 10.69sec 311123 394373 Direct 8.5 249406 498716 311137 24.8%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.51 8.51 0.00 0.00 0.7889 0.0000 2649005.36 2649005.36 0.00 394373.29 394373.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 75.24% 249405.52 160101 249757 248889.89 0 249757 1597838 1597838 0.00
crit 2.11 24.76% 498716.41 320201 499514 447795.85 0 499514 1051168 1051168 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 78046 (84955) 16.4% (17.8%) 2.8 73.38sec 9226049 10189503 Direct 2.8 32453 65139 40611 25.0%  
Periodic 262.5 70861 141769 88424 24.8% 97.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.75 2.75 262.51 262.51 0.9057 1.1165 23324065.73 23324065.73 0.00 85905.62 10189502.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.07 75.04% 32453.38 31076 66901 30614.88 0 63023 67024 67024 0.00
crit 0.69 24.96% 65139.49 62153 127985 34533.05 0 127985 44753 44753 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 197.5 75.23% 70861.05 21 145438 70941.66 50844 84216 13994110 13994110 0.00
crit 65.0 24.77% 141768.79 168 290875 141914.43 94486 195069 9218179 9218179 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.410000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 6909 1.5% 206.0 1.35sec 10041 0 Direct 111.8 18500 0 18500 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 205.97 111.79 0.00 0.00 0.0000 0.0000 2068175.46 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.79 100.00% 18499.93 9603 139424 18515.66 15721 22001 2068175 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 5705 1.2% 84.5 3.46sec 20251 0 Direct 83.5 16422 32834 20484 24.7%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.49 83.53 0.00 0.00 0.0000 0.0000 1711042.55 1711042.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.86 75.25% 16421.88 10708 19212 16423.39 14574 17669 1032260 1032260 0.00
crit 20.67 24.75% 32833.62 21416 38424 32832.57 27412 37357 678783 678783 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Tormenting Cyclone 10213 2.2% 15.3 18.76sec 200728 0 Direct 105.2 23312 46653 29106 24.8%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.26 105.24 0.00 0.00 0.0000 0.0000 3063303.79 3063303.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.12 75.18% 23311.55 15965 27396 23318.90 19452 26205 1844391 1844391 0.00
crit 26.13 24.82% 46652.92 31930 54792 46666.68 38061 54377 1218912 1218912 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Vampiric Touch 97205 20.4% 1.2 147.87sec 24622198 27563094 Periodic 174.7 133189 266320 166264 24.8% 97.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.18 0.00 174.73 174.73 0.8934 1.6783 29051500.94 29051500.94 0.00 98714.24 27563093.87
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.3 75.16% 133189.12 67 273101 133391.97 94378 166637 17490547 17490547 0.00
crit 43.4 24.84% 266319.56 263 546202 266679.15 182694 362506 11560954 11560954 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 68923 14.5% 78.9 3.51sec 261540 300616 Direct 78.8 209855 419862 261971 24.8%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.88 78.75 0.00 0.00 0.8700 0.0000 20630703.47 20630703.47 0.00 300616.42 300616.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.21 75.18% 209854.90 147731 230460 209743.48 192050 215430 12425090 12425090 0.00
crit 19.54 24.82% 419861.77 295462 460921 419612.15 384101 451318 8205613 8205613 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 2880 0.6% 5.2 38.73sec 168191 0 Direct 10.3 67271 134545 84093 25.0%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.17 10.34 0.00 0.00 0.0000 0.0000 869528.67 869528.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.75 74.99% 67271.31 67176 80611 67249.02 67176 71014 521620 521620 0.00
crit 2.59 25.01% 134545.34 134351 161222 126161.69 0 161222 347909 347909 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 14893 3.2% 3.3 78.04sec 1402755 330835 Periodic 27.8 131624 263348 164184 24.7% 4.3%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.26 0.00 27.82 27.82 4.2401 0.4670 4568165.39 4568165.39 0.00 330834.69 330834.69
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.9 75.28% 131623.55 261 153697 132421.57 114759 150038 2756918 2756918 0.00
crit 6.9 24.72% 263347.92 523 307394 264577.34 0 307394 1811247 1811247 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - mindbender 94281 / 22655
melee 94281 4.8% 82.2 3.25sec 82758 96970 Direct 82.2 66273 132542 82758 24.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.25 82.25 0.00 0.00 0.8535 0.0000 6806613.46 6806613.46 0.00 96969.98 96969.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.79 75.12% 66273.50 58719 67527 66270.31 65325 67243 4094836 4094836 0.00
crit 20.46 24.88% 132542.01 117438 135054 132531.45 126246 135054 2711778 2711778 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 43966 / 9020
Mind Flay (_void_tendril) 43966 (50653) 1.9% (3.3%) 6.2 40.20sec 761433 84894 Periodic 55.5 39147 78294 48866 24.8% 18.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.19 0.00 55.51 55.51 8.9693 1.0000 2712450.16 2712450.16 0.00 84893.62 84893.62
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.7 75.17% 39147.00 39147 39147 39147.00 39147 39147 1633509 1633509 0.00
crit 13.8 24.83% 78294.00 78294 78294 78283.56 0 78294 1078941 1078941 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43865 0.5% 1.6 84.26sec 438006 48734 Periodic 14.4 39147 78294 48731 24.5% 4.8%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.61 0.00 14.44 14.44 8.9884 1.0000 703517.40 703517.40 0.00 48733.54 48733.54
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.9 75.52% 39147.00 39147 39147 39132.25 0 39147 426811 426811 0.00
crit 3.5 24.48% 78294.00 78294 78294 74694.28 0 78294 276707 276707 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43771 0.3% 1.0 93.60sec 438197 48689 Periodic 9.4 39147 78294 48689 24.4% 3.1%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.04 0.00 9.37 9.37 9.0000 1.0000 456213.12 456213.12 0.00 48688.70 48688.70
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.1 75.63% 39147.00 39147 39147 39147.00 39147 39147 277404 277404 0.00
crit 2.3 24.37% 78294.00 78294 78294 72479.06 0 78294 178809 178809 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 44862 0.3% 1.0 0.00sec 448625 49847 Periodic 9.0 39147 78294 49847 27.3% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 448624.62 448624.62 0.00 49847.18 49847.18
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.5 72.67% 39147.00 39147 39147 39147.00 39147 39147 256021 256021 0.00
crit 2.5 27.33% 78294.00 78294 78294 73596.36 0 78294 192603 192603 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 39147 0.3% 1.0 0.00sec 391470 43497 Periodic 9.0 39147 78294 43497 11.1% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 391470.00 391470.00 0.00 43496.67 43496.67
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.0 88.89% 39147.00 39147 39147 39147.00 39147 39147 313176 313176 0.00
crit 1.0 11.11% 78294.00 78294 78294 78294.00 78294 78294 78294 78294 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Priest_Shadow_T19M_S2M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:false
  • if_expr:
 
Berserking 1.5 258.75sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dispersion 2.0 90.19sec

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.95 0.00 11.72 0.00 6.2518 1.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage taken by {$s1=60}%. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:Disperse into pure Shadow energy for {$d=6 seconds}, reducing all damage you take by {$47585s1=60}%, but you are unable to attack or cast spells. Castable while stunned, feared, or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed. Voidform does not drain Insanity while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:false
  • if_expr:
 
Mental Fortitude 174.7 1.68sec

Stats details: mental_fortitude

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 174.73 174.73 0.00 0.00 0.0000 0.0000 0.00 18133617.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.29 75.14% 0.00 0 0 0.00 0 0 0 10917861 100.00
crit 43.44 24.86% 0.00 0 0 0.00 0 0 0 7215757 100.00
 
 

Action details: mental_fortitude

Static Values
  • id:194018
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:true
  • if_expr:
Spelldata
  • id:194018
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:30442.82
  • base_dd_max:30442.82
 
Mindbender 5.0 64.44sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.9397 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
Surrender to Madness 1.0 0.00sec

Stats details: surrender_to_madness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: surrender_to_madness

Static Values
  • id:193223
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
Spelldata
  • id:193223
  • name:Surrender to Madness
  • school:physical
  • tooltip:Generating {$s1=150}% more Insanity. When you exit Voidform, you will die.
  • description:All your Insanity-generating abilities generate {$s1=150}% more Insanity, and you can cast while moving, until you exit Voidform. Then you die. Horribly.
 
pet - mindbender
Shadowcrawl 14.6 19.42sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.57 0.00 0.00 0.00 0.9127 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Well Fed (azshari_salad) 1.0 0.0 0.0sec 0.0sec 94.83% 94.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:94.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 1.5 0.0 258.3sec 258.3sec 4.78% 6.08% 0.0(0.0) 1.4

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:4.78%

Trigger Attempt Success

  • trigger_pct:97.41%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 14.46% 0.0(0.0) 1.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 94.83% 94.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:94.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dispersion 2.0 0.0 0.0sec 0.0sec 3.97% 3.97% 11.7(11.7) 2.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_dispersion
  • max_stacks:1
  • duration:6.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • dispersion_1:3.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:47585
  • name:Dispersion
  • tooltip:Reduces all damage taken by {$s1=60}%. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:Disperse into pure Shadow energy for {$d=6 seconds}, reducing all damage you take by {$47585s1=60}%, but you are unable to attack or cast spells. Castable while stunned, feared, or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed. Voidform does not drain Insanity while dispersed.
  • max_stacks:0
  • duration:6.00
  • cooldown:120.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 94.83% 94.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:94.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
insanity_drain_stacks 5.2 200.2 38.7sec 38.7sec 75.37% 75.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.24%
  • insanity_drain_stacks_2:2.16%
  • insanity_drain_stacks_3:2.94%
  • insanity_drain_stacks_4:1.86%
  • insanity_drain_stacks_5:1.72%
  • insanity_drain_stacks_6:1.72%
  • insanity_drain_stacks_7:1.73%
  • insanity_drain_stacks_8:1.73%
  • insanity_drain_stacks_9:1.73%
  • insanity_drain_stacks_10:1.72%
  • insanity_drain_stacks_11:1.77%
  • insanity_drain_stacks_12:1.75%
  • insanity_drain_stacks_13:1.74%
  • insanity_drain_stacks_14:1.78%
  • insanity_drain_stacks_15:1.76%
  • insanity_drain_stacks_16:1.79%
  • insanity_drain_stacks_17:1.78%
  • insanity_drain_stacks_18:1.80%
  • insanity_drain_stacks_19:1.74%
  • insanity_drain_stacks_20:1.76%
  • insanity_drain_stacks_21:1.66%
  • insanity_drain_stacks_22:1.46%
  • insanity_drain_stacks_23:1.47%
  • insanity_drain_stacks_24:1.25%
  • insanity_drain_stacks_25:1.22%
  • insanity_drain_stacks_26:1.12%
  • insanity_drain_stacks_27:0.97%
  • insanity_drain_stacks_28:0.83%
  • insanity_drain_stacks_29:0.67%
  • insanity_drain_stacks_30:0.55%
  • insanity_drain_stacks_31:0.44%
  • insanity_drain_stacks_32:0.38%
  • insanity_drain_stacks_33:0.35%
  • insanity_drain_stacks_34:0.34%
  • insanity_drain_stacks_35:0.34%
  • insanity_drain_stacks_36:0.34%
  • insanity_drain_stacks_37:0.34%
  • insanity_drain_stacks_38:0.34%
  • insanity_drain_stacks_39:0.34%
  • insanity_drain_stacks_40:0.34%
  • insanity_drain_stacks_41:0.34%
  • insanity_drain_stacks_42:0.34%
  • insanity_drain_stacks_43:0.34%
  • insanity_drain_stacks_44:0.34%
  • insanity_drain_stacks_45:0.34%
  • insanity_drain_stacks_46:0.34%
  • insanity_drain_stacks_47:0.34%
  • insanity_drain_stacks_48:0.34%
  • insanity_drain_stacks_49:0.34%
  • insanity_drain_stacks_50:0.34%
  • insanity_drain_stacks_51:0.34%
  • insanity_drain_stacks_52:0.34%
  • insanity_drain_stacks_53:0.34%
  • insanity_drain_stacks_54:0.34%
  • insanity_drain_stacks_55:0.34%
  • insanity_drain_stacks_56:0.34%
  • insanity_drain_stacks_57:0.34%
  • insanity_drain_stacks_58:0.34%
  • insanity_drain_stacks_59:1.09%
  • insanity_drain_stacks_60:0.90%
  • insanity_drain_stacks_61:0.36%
  • insanity_drain_stacks_62:0.34%
  • insanity_drain_stacks_63:0.34%
  • insanity_drain_stacks_64:0.34%
  • insanity_drain_stacks_65:0.34%
  • insanity_drain_stacks_66:0.34%
  • insanity_drain_stacks_67:0.34%
  • insanity_drain_stacks_68:0.34%
  • insanity_drain_stacks_69:0.34%
  • insanity_drain_stacks_70:0.34%
  • insanity_drain_stacks_71:0.34%
  • insanity_drain_stacks_72:0.33%
  • insanity_drain_stacks_73:0.33%
  • insanity_drain_stacks_74:0.33%
  • insanity_drain_stacks_75:0.33%
  • insanity_drain_stacks_76:0.33%
  • insanity_drain_stacks_77:0.33%
  • insanity_drain_stacks_78:2.17%
  • insanity_drain_stacks_79:0.32%
  • insanity_drain_stacks_80:0.32%
  • insanity_drain_stacks_81:0.31%
  • insanity_drain_stacks_82:0.31%
  • insanity_drain_stacks_83:0.31%
  • insanity_drain_stacks_84:0.31%
  • insanity_drain_stacks_85:0.31%
  • insanity_drain_stacks_86:0.31%
  • insanity_drain_stacks_87:0.31%
  • insanity_drain_stacks_88:0.31%
  • insanity_drain_stacks_89:0.31%
  • insanity_drain_stacks_90:0.31%
  • insanity_drain_stacks_91:0.31%
  • insanity_drain_stacks_92:0.30%
  • insanity_drain_stacks_93:0.30%
  • insanity_drain_stacks_94:0.29%
  • insanity_drain_stacks_95:0.26%
  • insanity_drain_stacks_96:0.23%
  • insanity_drain_stacks_97:0.16%
  • insanity_drain_stacks_98:0.12%
  • insanity_drain_stacks_99:0.08%
  • insanity_drain_stacks_100:0.08%
  • insanity_drain_stacks_101:0.07%
  • insanity_drain_stacks_102:0.06%
  • insanity_drain_stacks_103:0.06%
  • insanity_drain_stacks_104:0.06%
  • insanity_drain_stacks_105:0.05%
  • insanity_drain_stacks_106:0.05%
  • insanity_drain_stacks_107:0.05%
  • insanity_drain_stacks_108:0.04%
  • insanity_drain_stacks_109:0.05%
  • insanity_drain_stacks_110:0.06%
  • insanity_drain_stacks_111:0.03%
  • insanity_drain_stacks_112:0.01%
  • insanity_drain_stacks_113:0.00%
  • insanity_drain_stacks_114:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 5.2 0.0 58.9sec 58.9sec 16.75% 16.75% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_19:0.08%
  • lingering_insanity_20:0.44%
  • lingering_insanity_21:1.63%
  • lingering_insanity_22:0.83%
  • lingering_insanity_23:1.33%
  • lingering_insanity_24:0.92%
  • lingering_insanity_25:0.65%
  • lingering_insanity_26:1.23%
  • lingering_insanity_27:1.92%
  • lingering_insanity_28:1.39%
  • lingering_insanity_29:1.32%
  • lingering_insanity_30:0.90%
  • lingering_insanity_31:0.60%
  • lingering_insanity_32:0.63%
  • lingering_insanity_33:0.63%
  • lingering_insanity_34:0.81%
  • lingering_insanity_35:0.75%
  • lingering_insanity_36:0.44%
  • lingering_insanity_37:0.19%
  • lingering_insanity_38:0.05%
  • lingering_insanity_39:0.01%
  • lingering_insanity_40:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.2 3.0 26.2sec 20.3sec 24.99% 24.99% 3.0(3.0) 10.8

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:24.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Mental Fortitude 1.8 172.9 277.9sec 1.7sec 98.35% 98.35% 172.9(172.9) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • mental_fortitude_1:98.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194018
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 254.7sec 0.0sec 19.06% 19.06% 0.0(0.0) 1.6

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 94.83% 94.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:94.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 24.0 2.2 11.8sec 10.9sec 13.12% 13.12% 2.2(2.2) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

  • shadowy_insight_1:13.12%

Trigger Attempt Success

  • trigger_pct:9.98%

Spelldata details

  • id:162452
  • name:Shadowy Insight
  • tooltip:
  • description:Shadow Word: Pain periodic damage has a {$h=10}% chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
Sphere of Insanity 5.2 0.0 38.7sec 38.7sec 75.37% 78.71% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:75.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Surrender to Madness 1.0 0.0 0.0sec 0.0sec 40.40% 45.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_surrender_to_madness
  • max_stacks:1
  • duration:180.00
  • cooldown:600.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • surrender_to_madness_1:40.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193223
  • name:Surrender to Madness
  • tooltip:Generating {$s1=150}% more Insanity. When you exit Voidform, you will die.
  • description:All your Insanity-generating abilities generate {$s1=150}% more Insanity, and you can cast while moving, until you exit Voidform. Then you die. Horribly.
  • max_stacks:0
  • duration:180.00
  • cooldown:600.00
  • default_chance:0.00%
Surrender to Madness (_death) 0.8 0.0 0.0sec 0.0sec 5.17% 5.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_surrender_to_madness_death
  • max_stacks:1
  • duration:0.00
  • cooldown:600.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • surrender_to_madness_death_1:5.17%

Trigger Attempt Success

  • trigger_pct:82.16%

Spelldata details

  • id:193223
  • name:Surrender to Madness
  • tooltip:Generating {$s1=150}% more Insanity. When you exit Voidform, you will die.
  • description:All your Insanity-generating abilities generate {$s1=150}% more Insanity, and you can cast while moving, until you exit Voidform. Then you die. Horribly.
  • max_stacks:0
  • duration:180.00
  • cooldown:600.00
  • default_chance:0.00%
Twist of Fate 1.9 225.3 79.2sec 0.4sec 34.08% 34.08% 225.3(225.3) 0.2

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:34.08%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 3.3 0.0 77.9sec 77.9sec 4.22% 4.22% 0.0(0.0) 3.2

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:4.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 5.2 0.0 38.7sec 38.7sec 75.37% 80.36% 6.7(6.7) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:3.03%
  • voidform_2:2.15%
  • voidform_3:1.71%
  • voidform_4:1.71%
  • voidform_5:1.71%
  • voidform_6:1.71%
  • voidform_7:1.71%
  • voidform_8:1.71%
  • voidform_9:1.71%
  • voidform_10:1.71%
  • voidform_11:1.71%
  • voidform_12:1.71%
  • voidform_13:1.71%
  • voidform_14:1.71%
  • voidform_15:1.71%
  • voidform_16:1.71%
  • voidform_17:1.71%
  • voidform_18:1.71%
  • voidform_19:1.71%
  • voidform_20:1.69%
  • voidform_21:1.59%
  • voidform_22:1.46%
  • voidform_23:1.39%
  • voidform_24:1.26%
  • voidform_25:1.19%
  • voidform_26:1.11%
  • voidform_27:0.97%
  • voidform_28:0.86%
  • voidform_29:0.75%
  • voidform_30:0.67%
  • voidform_31:0.62%
  • voidform_32:0.57%
  • voidform_33:0.53%
  • voidform_34:0.47%
  • voidform_35:0.41%
  • voidform_36:0.37%
  • voidform_37:0.35%
  • voidform_38:0.34%
  • voidform_39:0.34%
  • voidform_40:0.34%
  • voidform_41:0.34%
  • voidform_42:0.34%
  • voidform_43:0.34%
  • voidform_44:0.34%
  • voidform_45:0.34%
  • voidform_46:0.34%
  • voidform_47:0.34%
  • voidform_48:0.34%
  • voidform_49:0.34%
  • voidform_50:0.34%
  • voidform_51:0.34%
  • voidform_52:0.34%
  • voidform_53:0.34%
  • voidform_54:0.34%
  • voidform_55:0.34%
  • voidform_56:0.34%
  • voidform_57:0.34%
  • voidform_58:0.34%
  • voidform_59:0.34%
  • voidform_60:0.34%
  • voidform_61:0.34%
  • voidform_62:0.34%
  • voidform_63:0.34%
  • voidform_64:0.34%
  • voidform_65:0.34%
  • voidform_66:0.34%
  • voidform_67:0.34%
  • voidform_68:0.34%
  • voidform_69:0.34%
  • voidform_70:0.34%
  • voidform_71:0.34%
  • voidform_72:0.34%
  • voidform_73:0.34%
  • voidform_74:0.34%
  • voidform_75:0.34%
  • voidform_76:0.34%
  • voidform_77:0.34%
  • voidform_78:0.34%
  • voidform_79:0.34%
  • voidform_80:0.33%
  • voidform_81:0.33%
  • voidform_82:0.33%
  • voidform_83:0.33%
  • voidform_84:0.33%
  • voidform_85:0.33%
  • voidform_86:2.17%
  • voidform_87:0.32%
  • voidform_88:0.32%
  • voidform_89:0.31%
  • voidform_90:0.31%
  • voidform_91:0.31%
  • voidform_92:0.31%
  • voidform_93:0.31%
  • voidform_94:0.31%
  • voidform_95:0.31%
  • voidform_96:0.31%
  • voidform_97:0.31%
  • voidform_98:0.31%
  • voidform_99:0.31%
  • voidform_100:2.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: Shadowcrawl 14.6 0.0 19.4sec 19.4sec 86.70% 85.72% 0.0(0.0) 9.6

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T19M_S2M
Resource Gains Type Count Total Average Overflow
Insanity Saved by Dispersion Insanity 233.32 321.88 (3246.20%) 1.38 0.00 0.00%
Insanity Drained by Voidform Insanity 4520.81 -5346.38 (-53919.04%) -1.18 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 101.78 1181.41 (11914.72%) 11.61 39.95 3.27%
Insanity Gained from Mind Flay Insanity 172.40 340.44 (3433.35%) 1.97 4.35 1.26%
Insanity Gained from Mindbender Insanity 82.25 283.59 (2860.06%) 3.45 45.40 13.80%
Insanity Gained from Shadow Word: Death Insanity 8.51 194.08 (1957.32%) 22.79 61.35 24.02%
Insanity Gained from Shadow Word: Pain Casts Insanity 2.75 6.13 (61.81%) 2.23 2.13 25.78%
Insanity Gained from Surrender to Madness Insanity 168.70 1658.55 (16726.75%) 9.83 890.04 34.92%
Insanity Gained from Vampiric Touch Casts Insanity 1.18 4.37 (44.09%) 3.71 0.35 7.36%
Insanity Gained from Void Bolt Insanity 78.88 1084.17 (10933.97%) 13.74 177.93 14.10%
Insanity Saved by Void Torrent Insanity 259.59 281.68 (2840.77%) 1.09 0.00 0.00%
Health from Vampiric Touch Ticks Health 174.73 0.00 (0.00%) 0.00 14525804.72 100.00%
mp5_regen Mana 1016.50 0.00 (0.00%) 0.00 2642754.48 100.00%
Resource RPS-Gain RPS-Loss
Insanity 17.82 17.79
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 9.59 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 84.5 3.5sec
Shadowy Insight Mind Blast CD Reset from Shadow Word: Pain 24.0 11.8sec
Shadowy Insight Mind Blast CD Reset lost to overflow 2.2 58.2sec
Void Eruption casted when a target with both DoTs was up 5.2 38.7sec
Void Tendril spawned from Call to the Void 7.4 32.7sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T19M_S2M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Priest_Shadow_T19M_S2M Damage Per Second
Count 7499
Mean 475577.20
Minimum 189519.03
Maximum 592553.94
Spread ( max - min ) 403034.91
Range [ ( max - min ) / 2 * 100% ] 42.37%
Standard Deviation 38529.2212
5th Percentile 386579.45
95th Percentile 524390.80
( 95th Percentile - 5th Percentile ) 137811.35
Mean Distribution
Standard Deviation 444.9268
95.00% Confidence Intervall ( 474705.16 - 476449.24 )
Normalized 95.00% Confidence Intervall ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 252
0.1% Error 25213
0.1 Scale Factor Error with Delta=300 12672553
0.05 Scale Factor Error with Delta=300 50690213
0.01 Scale Factor Error with Delta=300 1267255340
Priority Target DPS
Sample Data Priest_Shadow_T19M_S2M Priority Target Damage Per Second
Count 7499
Mean 475577.20
Minimum 189519.03
Maximum 592553.94
Spread ( max - min ) 403034.91
Range [ ( max - min ) / 2 * 100% ] 42.37%
Standard Deviation 38529.2212
5th Percentile 386579.45
95th Percentile 524390.80
( 95th Percentile - 5th Percentile ) 137811.35
Mean Distribution
Standard Deviation 444.9268
95.00% Confidence Intervall ( 474705.16 - 476449.24 )
Normalized 95.00% Confidence Intervall ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 252
0.1% Error 25213
0.1 Scale Factor Error with Delta=300 12672553
0.05 Scale Factor Error with Delta=300 50690213
0.01 Scale Factor Error with Delta=300 1267255340
DPS(e)
Sample Data Priest_Shadow_T19M_S2M Damage Per Second (Effective)
Count 7499
Mean 475577.20
Minimum 189519.03
Maximum 592553.94
Spread ( max - min ) 403034.91
Range [ ( max - min ) / 2 * 100% ] 42.37%
Damage
Sample Data Priest_Shadow_T19M_S2M Damage
Count 7499
Mean 132380282.22
Minimum 43077530.07
Maximum 174140403.16
Spread ( max - min ) 131062873.08
Range [ ( max - min ) / 2 * 100% ] 49.50%
DTPS
Sample Data Priest_Shadow_T19M_S2M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T19M_S2M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Priest_Shadow_T19M_S2M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T19M_S2M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T19M_S2M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T19M_S2M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Priest_Shadow_T19M_S2MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Priest_Shadow_T19M_S2M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
B 1.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
C 1.07 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
D 2.55 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
E 1.10 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
F 5.17 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
G 0.02 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
0.00 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
H 19.31 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
I 12.85 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain
actions.s2m
# count action,conditions
0.00 shadow_crash,if=talent.shadow_crash.enabled
J 1.92 mindbender,if=talent.mindbender.enabled
K 1.95 dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
0.00 power_infusion,if=buff.insanity_drain_stacks.stack>=85
L 0.92 berserking,if=buff.voidform.stack>=90
M 0.04 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
N 0.62 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
O 42.51 void_bolt
P 2.06 void_torrent
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
Q 3.57 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
R 43.73 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
S 4.92 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
T 0.13 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
U 0.07 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
V 11.04 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
actions.vf
# count action,conditions
W 0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
X 1.53 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
Y 0.55 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
Z 1.20 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
a 34.59 void_bolt
0.00 void_torrent,if=!talent.surrender_to_madness.enabled
b 1.19 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
c 0.01 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
d 38.26 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
e 0.00 shadow_word_death,if=cooldown.shadow_word_death.charges=2
f 0.48 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
g 0.08 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
h 0.01 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
i 23.63 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain

Sample Sequence

012456CDEHHIHFddaddadiadiaiadiaddaddaddaiadadadIHIHIHIDFiadiaXdadiaiaddabaddadiadiadIHIHIHIHFiZiZdgadiaiaddaXHHIHHFdiaddaiaddaddadiaddaiBHHIHFKOPORRORVORVORJORRORVORVOSROVORVORRORROSVORRORVOVORSORVORVOVORROPORRORROSROVOROJ7

Sample Sequence Table

time name target resources buffs
Pre flask Priest_Shadow_T19M_S2M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Priest_Shadow_T19M_S2M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Priest_Shadow_T19M_S2M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.887 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity bloodlust, potion_of_deadly_grace
0:01.773 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity bloodlust, potion_of_deadly_grace
0:02.659 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity bloodlust, potion_of_deadly_grace
0:03.547 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:04.423 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:07.274 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:08.149 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, shadowy_insight, mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:08.149 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:09.015 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.3/100: 96% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:09.883 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, shadowy_insight, sphere_of_insanity, voidform(2), insanity_drain_stacks(2), potion_of_deadly_grace, mental_fortitude
0:10.745 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.7/100: 96% insanity bloodlust, sphere_of_insanity, voidform(3), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
0:11.601 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity bloodlust, sphere_of_insanity, voidform(4), insanity_drain_stacks(4), potion_of_deadly_grace, mental_fortitude
0:12.455 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, sphere_of_insanity, voidform(5), insanity_drain_stacks(5), potion_of_deadly_grace, mental_fortitude
0:13.298 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(6), potion_of_deadly_grace, mental_fortitude
0:14.135 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(6), potion_of_deadly_grace, mental_fortitude
0:14.971 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.8/100: 98% insanity bloodlust, sphere_of_insanity, voidform(7), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
0:15.794 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity bloodlust, sphere_of_insanity, voidform(8), insanity_drain_stacks(8), potion_of_deadly_grace, mental_fortitude
0:16.617 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity bloodlust, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), potion_of_deadly_grace, mental_fortitude
0:17.430 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity bloodlust, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), potion_of_deadly_grace, mental_fortitude
0:18.236 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity bloodlust, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
0:20.021 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.3/100: 72% insanity bloodlust, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace, mental_fortitude
0:20.806 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.4/100: 76% insanity bloodlust, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace, mental_fortitude
0:21.591 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.1/100: 77% insanity bloodlust, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), potion_of_deadly_grace, mental_fortitude
0:22.371 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.9/100: 69% insanity bloodlust, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
0:23.143 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.9/100: 73% insanity bloodlust, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
0:23.913 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.1/100: 72% insanity bloodlust, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), potion_of_deadly_grace, mental_fortitude
0:24.673 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.5/100: 72% insanity bloodlust, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), potion_of_deadly_grace, mental_fortitude
0:25.429 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.8/100: 75% insanity bloodlust, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace, mental_fortitude
0:26.180 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity bloodlust, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), potion_of_deadly_grace, mental_fortitude
0:26.934 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.5/100: 73% insanity bloodlust, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), potion_of_deadly_grace, mental_fortitude
0:27.684 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), potion_of_deadly_grace, mental_fortitude
0:28.434 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.2/100: 73% insanity bloodlust, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
0:29.186 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity bloodlust, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mental_fortitude
0:29.941 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.7/100: 73% insanity bloodlust, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mental_fortitude
0:31.569 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.9/100: 48% insanity bloodlust, sphere_of_insanity, voidform(24), insanity_drain_stacks(24), mental_fortitude
0:32.312 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.7/100: 49% insanity bloodlust, sphere_of_insanity, voidform(25), insanity_drain_stacks(25), mark_of_the_claw, mental_fortitude
0:33.665 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.3/100: 32% insanity bloodlust, sphere_of_insanity, voidform(26), insanity_drain_stacks(26), mark_of_the_claw, mental_fortitude
0:34.417 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.3/100: 32% insanity bloodlust, sphere_of_insanity, voidform(27), insanity_drain_stacks(27), mark_of_the_claw, mental_fortitude
0:35.722 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.7/100: 16% insanity bloodlust, sphere_of_insanity, voidform(28), insanity_drain_stacks(28), mark_of_the_claw, mental_fortitude
0:36.475 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.8/100: 15% insanity bloodlust, sphere_of_insanity, voidform(29), insanity_drain_stacks(29), mark_of_the_claw, mental_fortitude
0:37.400 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity bloodlust, lingering_insanity(29), mark_of_the_claw, mental_fortitude
0:39.694 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity bloodlust, lingering_insanity(29), mental_fortitude
0:40.581 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(29), mental_fortitude
0:43.522 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(29), mental_fortitude
0:44.416 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(29), mental_fortitude
0:49.043 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(29), mental_fortitude
0:49.937 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity lingering_insanity(29), mental_fortitude
0:52.770 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(29), mental_fortitude
0:53.663 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(29), mental_fortitude
0:53.663 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
0:56.244 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
0:57.355 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mental_fortitude
0:58.463 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity sphere_of_insanity, voidform(5), insanity_drain_stacks(5), mental_fortitude
0:59.561 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.1/100: 81% insanity sphere_of_insanity, voidform(6), insanity_drain_stacks(6), mental_fortitude
1:00.636 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mental_fortitude
1:01.701 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
1:02.757 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
1:03.803 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.9/100: 80% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:04.843 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
1:05.873 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.3/100: 74% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
1:06.888 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.3/100: 79% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:09.221 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.4/100: 62% insanity shadowy_insight, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
1:10.209 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.7/100: 67% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
1:11.189 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.7/100: 66% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
1:12.164 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.1/100: 64% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
1:13.129 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
1:17.369 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.5/100: 71% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
1:18.282 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.7/100: 70% insanity sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mark_of_the_claw, mental_fortitude
1:19.192 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.6/100: 65% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
1:20.095 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mark_of_the_claw, mental_fortitude
1:20.989 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mark_of_the_claw, mental_fortitude
1:21.878 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.8/100: 51% insanity sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mark_of_the_claw, mental_fortitude
1:22.766 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.9/100: 36% insanity sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mental_fortitude
1:23.655 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mental_fortitude
1:24.542 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.2/100: 26% insanity sphere_of_insanity, voidform(31), insanity_drain_stacks(27), mental_fortitude
1:25.424 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.4/100: 10% insanity sphere_of_insanity, voidform(32), insanity_drain_stacks(28), mental_fortitude
1:26.295 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.1/100: 7% insanity sphere_of_insanity, voidform(33), insanity_drain_stacks(29), mental_fortitude
1:27.172 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(33), mental_fortitude
1:29.950 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(33), mental_fortitude
1:30.818 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(33), mental_fortitude
1:35.473 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity lingering_insanity(33), mental_fortitude
1:36.341 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity lingering_insanity(33), mental_fortitude
1:37.865 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(33), mental_fortitude
1:38.732 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity lingering_insanity(33), mental_fortitude
1:40.347 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity lingering_insanity(33), mental_fortitude
1:41.216 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(33), mental_fortitude
1:41.216 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
1:43.782 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
1:44.896 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mental_fortitude
1:47.306 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mental_fortitude
1:48.380 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(8), mental_fortitude
1:49.446 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.8/100: 73% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
1:50.501 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.1/100: 62% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
1:51.544 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.1/100: 64% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:52.583 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
1:53.611 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
1:54.627 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.3/100: 51% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:56.865 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.6/100: 25% insanity shadowy_insight, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mark_of_the_claw, mental_fortitude
1:57.840 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
1:58.808 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.8/100: 20% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mark_of_the_claw, mental_fortitude
1:59.771 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.2/100: 14% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mark_of_the_claw, mental_fortitude
2:00.724 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.1/100: 13% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
2:01.680 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(21), mental_fortitude
2:02.633 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(21), mental_fortitude
2:03.584 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(21), mental_fortitude
2:08.126 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(21), mental_fortitude
2:09.079 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity lingering_insanity(21), mental_fortitude
2:10.032 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(21), mental_fortitude
2:10.032 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
2:11.174 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform(2), insanity_drain_stacks(2), mental_fortitude
2:12.304 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
2:13.417 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mental_fortitude
2:14.520 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity sphere_of_insanity, voidform(5), insanity_drain_stacks(5), mental_fortitude
2:15.618 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.4/100: 95% insanity sphere_of_insanity, voidform(6), insanity_drain_stacks(6), mental_fortitude
2:16.697 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.2/100: 87% insanity sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mental_fortitude
2:19.070 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mark_of_the_claw, mental_fortitude
2:20.103 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.2/100: 68% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mark_of_the_claw, mental_fortitude
2:21.126 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.2/100: 66% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mark_of_the_claw, mental_fortitude
2:22.139 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.3/100: 63% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mark_of_the_claw, mental_fortitude
2:23.148 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.3/100: 64% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
2:24.160 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.2/100: 61% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
2:25.163 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.2/100: 57% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
2:26.157 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.1/100: 57% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
2:27.142 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
2:28.118 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.8/100: 40% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
2:29.086 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.8/100: 38% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
2:30.045 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.7/100: 33% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
2:30.996 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.6/100: 27% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
2:31.941 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.6/100: 25% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mental_fortitude
2:34.025 surrender_to_madness Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity shadowy_insight, lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:34.025 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity surrender_to_madness, lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:34.943 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity surrender_to_madness, lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:35.860 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity surrender_to_madness, lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:37.394 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity surrender_to_madness, lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:38.310 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:38.310 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform, insanity_drain_stacks, mark_of_the_claw, mental_fortitude
2:44.525 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.7/100: 98% insanity surrender_to_madness, sphere_of_insanity, voidform(2), insanity_drain_stacks(2), mental_fortitude
2:45.652 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.7/100: 90% insanity surrender_to_madness, sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
2:49.894 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.2/100: 87% insanity surrender_to_madness, sphere_of_insanity, voidform(7), insanity_drain_stacks(3), mental_fortitude
2:50.962 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity surrender_to_madness, sphere_of_insanity, voidform(8), insanity_drain_stacks(4), mental_fortitude
2:52.030 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(9), insanity_drain_stacks(5), mental_fortitude
2:53.088 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(10), insanity_drain_stacks(6), mental_fortitude
2:54.127 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity surrender_to_madness, sphere_of_insanity, voidform(11), insanity_drain_stacks(7), mental_fortitude
2:55.166 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(12), insanity_drain_stacks(8), mark_of_the_claw, mental_fortitude
2:56.180 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.1/100: 97% insanity surrender_to_madness, sphere_of_insanity, voidform(13), insanity_drain_stacks(9), mark_of_the_claw, mental_fortitude
2:57.178 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity surrender_to_madness, sphere_of_insanity, voidform(14), insanity_drain_stacks(10), mark_of_the_claw, mental_fortitude
2:58.177 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(15), insanity_drain_stacks(11), mark_of_the_claw, mental_fortitude
2:59.166 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(16), insanity_drain_stacks(12), mark_of_the_claw, mental_fortitude
3:00.140 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.8/100: 86% insanity surrender_to_madness, sphere_of_insanity, voidform(17), insanity_drain_stacks(13), mark_of_the_claw, mental_fortitude
3:01.116 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity surrender_to_madness, sphere_of_insanity, voidform(18), insanity_drain_stacks(14), mental_fortitude
3:02.086 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity surrender_to_madness, sphere_of_insanity, voidform(19), insanity_drain_stacks(15), mental_fortitude
3:03.048 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.8/100: 85% insanity surrender_to_madness, sphere_of_insanity, voidform(20), insanity_drain_stacks(16), mental_fortitude
3:04.008 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mental_fortitude
3:04.960 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.2/100: 99% insanity surrender_to_madness, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mental_fortitude
3:05.900 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.1/100: 84% insanity surrender_to_madness, sphere_of_insanity, voidform(23), insanity_drain_stacks(19), mental_fortitude
3:06.837 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mental_fortitude
3:07.765 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.3/100: 93% insanity surrender_to_madness, sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mental_fortitude
3:08.685 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity surrender_to_madness, sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mental_fortitude
3:09.601 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mental_fortitude
3:10.508 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity surrender_to_madness, sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mental_fortitude
3:11.408 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mental_fortitude
3:12.302 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mental_fortitude
3:13.194 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mental_fortitude
3:14.076 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(31), insanity_drain_stacks(27), mental_fortitude
3:16.011 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.7/100: 88% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(33), insanity_drain_stacks(29), mark_of_the_claw, mental_fortitude
3:16.863 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.4/100: 80% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(34), insanity_drain_stacks(30), mark_of_the_claw, mental_fortitude
3:17.712 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(35), insanity_drain_stacks(31), mark_of_the_claw, mental_fortitude
3:18.555 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(36), insanity_drain_stacks(32), mark_of_the_claw, mental_fortitude
3:19.391 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.5/100: 79% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(37), insanity_drain_stacks(33), mark_of_the_claw, mental_fortitude
3:20.222 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(37), insanity_drain_stacks(33), mark_of_the_claw, mental_fortitude
3:21.054 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(38), insanity_drain_stacks(34), mark_of_the_claw, mental_fortitude
3:21.877 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.2/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(39), insanity_drain_stacks(35), mental_fortitude
3:22.706 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(40), insanity_drain_stacks(36), mental_fortitude
3:23.528 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(41), insanity_drain_stacks(37), mental_fortitude
3:24.346 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(42), insanity_drain_stacks(38), mental_fortitude
3:25.158 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(42), insanity_drain_stacks(38), mental_fortitude
3:25.970 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.8/100: 65% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(43), insanity_drain_stacks(39), mental_fortitude
3:26.772 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(44), insanity_drain_stacks(40), mental_fortitude
3:27.571 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(45), insanity_drain_stacks(41), mental_fortitude
3:28.367 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.1/100: 84% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(46), insanity_drain_stacks(42), mental_fortitude
3:29.157 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.2/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(46), insanity_drain_stacks(42), mental_fortitude
3:29.969 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(47), insanity_drain_stacks(43), mental_fortitude
3:30.754 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.4/100: 70% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(48), insanity_drain_stacks(44), mental_fortitude
3:31.533 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(49), insanity_drain_stacks(45), mental_fortitude
3:33.408 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.3/100: 38% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(51), insanity_drain_stacks(47), mental_fortitude
3:34.173 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.7/100: 53% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(51), insanity_drain_stacks(47), mental_fortitude
3:34.937 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.7/100: 59% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(52), insanity_drain_stacks(48), mental_fortitude
3:35.692 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.6/100: 76% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(53), insanity_drain_stacks(49), mental_fortitude
3:36.445 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.2/100: 75% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(54), insanity_drain_stacks(50), mental_fortitude
3:37.198 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.5/100: 80% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(54), insanity_drain_stacks(50), mental_fortitude
3:37.947 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.1/100: 65% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(55), insanity_drain_stacks(51), mental_fortitude
3:38.698 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.5/100: 74% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(56), insanity_drain_stacks(52), mental_fortitude
3:39.452 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.8/100: 79% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(57), insanity_drain_stacks(53), mental_fortitude
3:40.205 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.6/100: 63% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(57), insanity_drain_stacks(53), mental_fortitude
3:40.956 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(58), insanity_drain_stacks(54), mental_fortitude
3:42.654 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.9/100: 33% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(60), insanity_drain_stacks(56), mental_fortitude
3:43.407 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.8/100: 46% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(61), insanity_drain_stacks(57), mental_fortitude
3:44.163 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.2/100: 46% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(61), insanity_drain_stacks(57), mental_fortitude
3:44.965 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.6/100: 47% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(62), insanity_drain_stacks(58), mental_fortitude
3:45.715 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.4/100: 58% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(63), insanity_drain_stacks(59), mental_fortitude
3:49.951 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.8/100: 51% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(67), insanity_drain_stacks(59), mental_fortitude
3:50.703 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(68), insanity_drain_stacks(60), mental_fortitude
3:51.457 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.6/100: 64% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(69), insanity_drain_stacks(61), mental_fortitude
3:52.212 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.4/100: 62% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(69), insanity_drain_stacks(61), mental_fortitude
3:52.964 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.7/100: 71% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(70), insanity_drain_stacks(62), mental_fortitude
3:53.715 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(71), insanity_drain_stacks(63), mental_fortitude
3:54.468 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(72), insanity_drain_stacks(64), mental_fortitude
3:55.222 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(72), insanity_drain_stacks(64), mental_fortitude
3:55.974 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.3/100: 69% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(73), insanity_drain_stacks(65), mental_fortitude
3:56.898 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.4/100: 62% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(74), insanity_drain_stacks(66), mental_fortitude
3:57.651 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.9/100: 69% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(75), insanity_drain_stacks(67), mental_fortitude
3:58.636 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.9/100: 42% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(76), insanity_drain_stacks(68), mental_fortitude
3:59.617 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.6/100: 40% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(77), insanity_drain_stacks(69), mental_fortitude
4:00.808 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.1/100: 20% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(78), insanity_drain_stacks(70), mental_fortitude
4:01.562 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.4/100: 25% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(79), insanity_drain_stacks(71), mental_fortitude
4:02.439 Waiting 14.400 sec 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity surrender_to_madness_death, mental_fortitude
4:16.839 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity surrender_to_madness_death, mental_fortitude
4:16.839 Waiting 38.100 sec 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity surrender_to_madness_death, potion_of_deadly_grace, mental_fortitude

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 42217 42217 26216
Intellect 39146 37440 28334 (2596)
Spirit 1 1 0
Health 2533020 2533020 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 39146 37440 0
Crit 24.40% 24.40% 6790
Haste 30.67% 29.51% 9592
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 8800 8800 0
Mastery 43.43% 43.43% 3280
Armor 1819 1819 1819
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 884.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_claw
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Dreamscale Inlaid Vestments
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +918 Haste, +542 Mastery }
Local Waist Mangaza's Madness
ilevel: 895, stats: { 172 Armor, +2219 Sta, +1479 Int, +745 Crit, +413 Haste }
Local Legs Ragged Horrorweave Leggings
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +824 Haste, +636 Mastery }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +735 Haste, +360 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +569 Haste, +252 Mastery }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Haste }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Haste }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 906, weapon: { 1922 - 3571, 1.8 }, stats: { +937 Int, +1405 Sta, +350 Crit, +337 Mastery, +11921 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Secrets of the Void
ilevel: 906, stats: { +1230 Int, +1844 Sta, +627 Haste, +278 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Priest_Shadow_T19M_S2M"
level=110
race=troll
role=spell
position=back
talents=1212333
artifact=47:139251:139257:139251:0:764:1:765:1:766:1:767:3:768:1:769:1:770:1:771:3:772:5:773:3:774:3:775:3:776:4:777:3:778:3:779:1:1347:1
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_claw
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=200int
chest=dreamscale_inlaid_vestments,id=138215,bonus_id=1806
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1806
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=mangazas_madness,id=132864
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1806
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=200haste
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200haste
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=139251/139257/139251,relic_id=1806/1806/1806
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=884.19
# gear_stamina=26216
# gear_intellect=28334
# gear_crit_rating=6790
# gear_haste_rating=9592
# gear_mastery_rating=3280
# gear_armor=1819

Rogue_Assassination_Exsg_T19M : 380771 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
380771.1 380771.1 286.0 / 0.075% 49632.0 / 13.0% 15103.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
25.2 25.2 Energy 41.83% 36.1 100.0% 100%
Talents
  • 15: Elaborate Planning
  • 30: Nightstalker
  • 45: Deeper Stratagem
  • 75: Thuggee (Assassination Rogue)
  • 90: Exsanguinate
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Assassination_Exsg_T19M 380771
auto_attack_mh 16425 4.3% 195.5 1.54sec 25230 16558 Direct 195.5 20148 40300 25230 44.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.49 195.49 0.00 0.00 1.5237 0.0000 4932172.34 7250760.52 31.98 16558.30 16558.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.84 36.75% 20147.60 16694 26417 20152.04 19040 21363 1447307 2127679 31.98
crit 86.47 44.23% 40299.60 33388 52834 40308.17 38232 42373 3484865 5123081 31.98
miss 37.18 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 8122 2.1% 193.5 1.55sec 12604 8191 Direct 193.5 10064 20128 12604 44.2% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 193.49 193.49 0.00 0.00 1.5387 0.0000 2438676.91 3585086.06 31.98 8191.04 8191.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.11 36.75% 10064.05 8347 13208 10066.73 9552 10671 715614 1052021 31.98
crit 85.60 44.24% 20128.40 16694 26417 20132.98 19157 21433 1723063 2533065 31.98
miss 36.78 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deadly Poison (_dot) 14423 3.8% 359.4 0.96sec 12059 0 Periodic 99.5 30183 60379 43561 44.3% 0.0% 99.3%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 359.41 0.00 99.49 99.49 0.0000 3.0000 4334012.27 4334012.27 0.00 14520.37 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.4 55.70% 30183.19 25044 40474 30193.21 28189 32468 1672554 1672554 0.00
crit 44.1 44.30% 60378.79 50088 80948 60398.29 55713 65084 2661458 2661458 0.00
 
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance to poison the enemy for ${$2818m1*4} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.357500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Deadly Poison (_instant) 32796 8.6% 358.4 0.96sec 27481 0 Direct 358.4 19051 38093 27482 44.3% 0.0%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 358.41 358.41 0.00 0.00 0.0000 0.0000 9849611.86 9849611.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.74 55.73% 19051.44 15482 25020 19055.58 18274 19865 3805253 3805253 0.00
crit 158.67 44.27% 38092.81 30963 50041 38102.63 36175 40038 6044359 6044359 0.00
 
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
Envenom 36242 9.5% 27.1 10.82sec 401295 399509 Direct 27.1 278479 556310 401301 44.2% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.13 27.13 0.00 0.00 1.0045 0.0000 10885814.18 10885814.18 0.00 399508.74 399508.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.14 55.79% 278478.75 211923 410991 278554.62 233116 331868 4214791 4214791 0.00
crit 11.99 44.21% 556310.43 423847 821982 556633.60 445039 700889 6671023 6671023 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
From the Shadows 9653 2.5% 142.4 3.77sec 20348 0 Direct 142.4 14103 28208 20348 44.3% 0.0%  

Stats details: from_the_shadows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 142.35 142.35 0.00 0.00 0.0000 0.0000 2896587.09 2896587.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.33 55.73% 14102.96 12065 14998 14110.87 13632 14526 1118781 1118781 0.00
crit 63.02 44.27% 28208.35 24131 29996 28225.31 27324 29066 1777806 1777806 0.00
 
 

Action details: from_the_shadows

Static Values
  • id:192434
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192434
  • name:From the Shadows
  • school:nature
  • tooltip:
  • description:{$@spelldesc192428=Declaring your Vendetta unleashes a barrage of poisoned daggers at the target for ${20*{$192434s1=10}*$m1} Nature damage over {$192432d=20 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.350000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10.00
  • base_dd_max:10.00
 
Garrote 32495 8.5% 20.0 15.47sec 489180 486995 Periodic 173.0 39114 78213 56413 44.2% 0.0% 97.6%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.95 0.00 173.00 173.00 1.0045 1.6949 9759388.90 9759388.90 0.00 31154.28 486995.45
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.5 55.76% 39113.81 30995 75136 39143.05 36308 42428 3772797 3772797 0.00
crit 76.5 44.24% 78213.34 61989 150272 78275.77 72581 86615 5986591 5986591 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Kingsbane 14983 (20488) 3.9% (5.4%) 6.8 46.51sec 903498 899479 Periodic 46.4 67210 134510 96966 44.2% 0.0% 30.9%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.81 0.00 46.41 46.41 1.0045 2.0000 4500703.07 4500703.07 0.00 61728.69 899479.03
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.9 55.79% 67210.32 21026 151128 67214.54 48013 87293 1740289 1740289 0.00
crit 20.5 44.21% 134509.62 42053 295001 134525.95 93500 171761 2760414 2760414 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 3666 1.0% 6.8 46.51sec 161536 0 Direct 6.8 112067 224184 161537 44.1% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.81 6.81 0.00 0.00 0.0000 0.0000 1099989.91 1099989.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.81 55.88% 112067.22 110222 116562 111632.02 0 116562 426419 426419 0.00
crit 3.00 44.12% 224184.06 220444 233125 219653.09 0 233125 673570 673570 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 1838 0.5% 6.8 46.51sec 81025 0 Direct 6.8 56035 112087 81023 44.6% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.81 6.81 0.00 0.00 0.0000 0.0000 551743.55 551743.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.77 55.42% 56035.49 55111 58281 55750.27 0 58281 211461 211461 0.00
crit 3.04 44.58% 112087.09 110222 116562 109674.60 0 116562 340282 340282 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mark of the Hidden Satyr 5467 1.4% 16.7 17.86sec 98346 0 Direct 16.7 68165 136376 98345 44.2% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.68 16.68 0.00 0.00 0.0000 0.0000 1640481.85 1640481.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.30 55.75% 68164.66 61572 70808 68158.05 61572 70808 633945 633945 0.00
crit 7.38 44.25% 136375.96 123145 141616 136357.16 0 141616 1006536 1006536 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Mutilate 0 (55385) 0.0% (14.6%) 90.3 3.33sec 184130 183306

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.33 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 183305.52 183305.52
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit<=1&energy.deficit<=30
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage.{$?s1329=true}|!c1[][ Replaces Sinister Strike.] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 36928 9.7% 90.3 3.33sec 122765 0 Direct 90.3 81684 163421 122765 50.3% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.33 90.33 0.00 0.00 0.0000 0.0000 11089973.33 16303311.26 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.93 49.74% 81683.97 66346 104893 81700.18 75417 88236 3670219 5395570 31.98
crit 45.40 50.26% 163421.23 132692 209786 163452.33 151342 174324 7419754 10907741 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 18458 4.8% 90.3 3.33sec 61365 0 Direct 90.3 40841 81704 61365 50.2% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.33 90.33 0.00 0.00 0.0000 0.0000 5543353.10 8149254.13 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.96 49.77% 40841.22 33171 52444 40853.10 38031 43701 1836357 2699619 31.98
crit 45.37 50.23% 81703.64 66343 104888 81717.92 76555 88126 3706996 5449635 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Poison Bomb 14331 3.8% 33.3 6.45sec 129193 0 Direct 33.3 89593 179153 129194 44.2% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.34 33.34 0.00 0.00 0.0000 0.0000 4306851.26 4306851.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.60 55.78% 89593.35 88620 95799 89587.09 88620 95147 1666121 1666121 0.00
crit 14.74 44.22% 179152.51 177240 191599 179128.85 177240 189804 2640730 2640730 0.00
 
 

Action details: poison_bomb

Static Values
  • id:192660
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192660
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc192657=Envenom has a chance to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$192660s1=1}*6} Nature damage over {$192661d=3 seconds} to all enemies within it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Potion of the Old War 18630 4.8% 23.6 5.54sec 233378 0 Direct 23.6 161674 323347 233382 44.4% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.59 23.59 0.00 0.00 0.0000 0.0000 5505064.87 8092966.81 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.13 55.65% 161674.37 143757 165320 161661.20 149918 165320 2122242 3119897 31.98
crit 10.46 44.35% 323346.88 287514 330641 323321.19 298295 330641 3382823 4973070 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rupture 116314 30.6% 20.6 14.81sec 1700943 1693397 Periodic 207.3 109334 218699 168701 54.3% 0.0% 97.4%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.56 0.00 207.25 207.25 1.0045 1.4118 34963577.17 34963577.17 0.00 111619.49 1693397.45
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.7 45.72% 109334.37 66 319567 109317.33 85706 143712 10359259 10359259 0.00
crit 112.5 54.28% 218699.19 132 639135 218673.69 169832 279182 24604318 24604318 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${{$s1=0}*1*8/2} over 8 sec 2 points: ${{$s1=0}*2*12/2} over 12 sec 3 points: ${{$s1=0}*3*16/2} over 16 sec 4 points: ${{$s1=0}*4*20/2} over 20 sec 5 points: ${{$s1=0}*5*24/2} over 24 sec{$?s193531=false}[ 6 points: ${{$s1=0}*6*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Rogue_Assassination_Exsg_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_Exsg_T19M
  • harmful:false
  • if_expr:
 
Blood Fury 2.0 186.78sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.vendetta.up
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
Exsanguinate 6.8 46.51sec

Stats details: exsanguinate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.83 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: exsanguinate

Static Values
  • id:200806
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
Spelldata
  • id:200806
  • name:Exsanguinate
  • school:physical
  • tooltip:
  • description:Twist your blades into the target's wounds, causing your Bleed effects on them to bleed out {$s1=100}% faster.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_Exsg_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_Exsg_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.6 139.55sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.62 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 3.6 93.59sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.64 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<20
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Fury 2.0 0.0 186.7sec 186.7sec 10.19% 10.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:10.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 29.03% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elaborate Planning 35.5 12.2 8.5sec 6.3sec 74.25% 59.46% 12.2(12.2) 34.7

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.15

Stack Uptimes

  • elaborate_planning_1:74.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Increases damage done by {$s1=15}%.
  • description:Increases damage done by {$s1=15}% for {$d=5 seconds}.
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom 16.7 10.4 17.7sec 10.8sec 57.80% 56.26% 10.4(10.4) 16.2

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:57.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 97.9sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Vanish 2.6 0.0 139.6sec 139.6sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Assassination_Exsg_T19M
envenom Energy 27.1 949.4 35.0 35.0 11465.6
envenom Combo Points 27.1 153.3 5.7 5.7 70990.3
garrote Energy 20.0 897.8 45.0 45.0 10870.6
kingsbane Energy 6.8 238.3 35.0 35.0 25814.0
mutilate Energy 90.3 4968.4 55.0 55.0 3347.8
rupture Energy 20.6 513.9 25.0 25.0 68037.8
rupture Combo Points 20.6 118.1 5.7 5.7 296094.8
Resource Gains Type Count Total Average Overflow
kingsbane Combo Points 6.81 6.81 (2.48%) 1.00 0.00 0.00%
mutilate Combo Points 90.34 177.91 (64.86%) 1.97 2.76 1.53%
garrote Combo Points 19.95 19.95 (7.27%) 1.00 0.00 0.00%
energy_regen Energy 1816.12 3446.22 (46.03%) 1.90 31.08 0.89%
seal_fate Combo Points 93.80 69.64 (25.39%) 0.74 24.16 25.75%
Venomous Vim Energy 380.22 3742.92 (50.00%) 9.84 59.28 1.56%
Urge to Kill Energy 3.64 296.99 (3.97%) 81.48 140.38 32.10%
Resource RPS-Gain RPS-Loss
Energy 24.91 25.18
Combo Points 0.91 0.90
Combat End Resource Mean Min Max
Energy 38.28 0.01 120.00
Combo Points 2.87 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
Seal Fate 93.8 4.2sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Assassination_Exsg_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Rogue_Assassination_Exsg_T19M Damage Per Second
Count 7499
Mean 380771.06
Minimum 342299.38
Maximum 432260.70
Spread ( max - min ) 89961.32
Range [ ( max - min ) / 2 * 100% ] 11.81%
Standard Deviation 12636.4792
5th Percentile 360644.66
95th Percentile 402205.12
( 95th Percentile - 5th Percentile ) 41560.46
Mean Distribution
Standard Deviation 145.9232
95.00% Confidence Intervall ( 380485.05 - 381057.06 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4230
0.1 Scale Factor Error with Delta=300 1363125
0.05 Scale Factor Error with Delta=300 5452502
0.01 Scale Factor Error with Delta=300 136312551
Priority Target DPS
Sample Data Rogue_Assassination_Exsg_T19M Priority Target Damage Per Second
Count 7499
Mean 380771.06
Minimum 342299.38
Maximum 432260.70
Spread ( max - min ) 89961.32
Range [ ( max - min ) / 2 * 100% ] 11.81%
Standard Deviation 12636.4792
5th Percentile 360644.66
95th Percentile 402205.12
( 95th Percentile - 5th Percentile ) 41560.46
Mean Distribution
Standard Deviation 145.9232
95.00% Confidence Intervall ( 380485.05 - 381057.06 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4230
0.1 Scale Factor Error with Delta=300 1363125
0.05 Scale Factor Error with Delta=300 5452502
0.01 Scale Factor Error with Delta=300 136312551
DPS(e)
Sample Data Rogue_Assassination_Exsg_T19M Damage Per Second (Effective)
Count 7499
Mean 380771.06
Minimum 342299.38
Maximum 432260.70
Spread ( max - min ) 89961.32
Range [ ( max - min ) / 2 * 100% ] 11.81%
Damage
Sample Data Rogue_Assassination_Exsg_T19M Damage
Count 7499
Mean 114298001.66
Minimum 82959715.50
Maximum 145822107.98
Spread ( max - min ) 62862392.49
Range [ ( max - min ) / 2 * 100% ] 27.50%
DTPS
Sample Data Rogue_Assassination_Exsg_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Assassination_Exsg_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Assassination_Exsg_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Assassination_Exsg_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Assassination_Exsg_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Assassination_Exsg_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Assassination_Exsg_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Assassination_Exsg_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=old_war
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
9 2.01 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
A 0.00 call_action_list,name=cds
B 4.32 rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
0.00 pool_resource,for_next=1
C 6.81 kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
D 0.00 run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
E 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
F 0.00 call_action_list,name=exsang,if=dot.rupture.exsanguinated
G 6.52 rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
H 0.00 call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
I 0.00 call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
J 0.00 call_action_list,name=build_ex,if=talent.exsanguinate.enabled
K 0.00 call_action_list,name=build_noex,if=!talent.exsanguinate.enabled
actions.build_ex
# count action,conditions
0.00 hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
0.00 hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
0.00 fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
0.00 fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
0.00 hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&((dot.rupture.exsanguinated&dot.rupture.remains<=2)|cooldown.exsanguinate.remains<=2))
L 2.36 mutilate,if=combo_points.deficit<=1&energy.deficit<=30
M 87.98 mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2
actions.cds
# count action,conditions
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
N 0.17 vendetta,if=target.time_to_die<20
O 3.48 vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
0.00 vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
0.00 vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25
actions.exsang
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die>6
P 2.86 rupture,if=combo_points>=cp_max_spend&ticks_remain<2
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
Q 16.26 envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang_combo
# count action,conditions
R 2.62 vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
S 6.85 rupture,if=combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)
T 6.83 exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
U 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
0.00 hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
V 0.00 call_action_list,name=build_ex
actions.finish_ex
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
0.00 rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
W 9.04 envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
X 1.82 envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.garrote
# count action,conditions
0.00 pool_resource,for_next=1
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
0.00 pool_resource,for_next=1
Y 19.95 garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

Sample Sequence

012456YMBO9MMRSTCMMQMYMQMMPMMWYMMGMMWMYMSTCMMQMMQYMQMMBMYMGMMWMYMO8LSTCMMQMMQYMMLBMMGYMMWMMXYMLRSTCMMQYMQMMQMMBYMMGMMXYMMO9STCMQMMQYMMQMMBMYMGMMWMYMSTCMMQMMQYMQMMBMYMGMMWMYMNLRSTCMMQMMQYM

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Assassination_Exsg_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Assassination_Exsg_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Assassination_Exsg_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.006 mutilate Fluffy_Pillow 89.6/120: 75% energy | 1.0/6: 17% combo_points bloodlust, potion_of_the_old_war
0:02.010 rupture Fluffy_Pillow 59.1/120: 49% energy | 5.0/6: 83% combo_points bloodlust, potion_of_the_old_war
0:03.015 vendetta Fluffy_Pillow 48.6/120: 41% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:03.015 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:03.015 mutilate Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:04.020 mutilate Fluffy_Pillow 99.5/120: 83% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:05.025 vanish Fluffy_Pillow 59.1/120: 49% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:05.025 rupture Fluffy_Pillow 59.1/120: 49% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, vanish, elaborate_planning, potion_of_the_old_war
0:06.029 exsanguinate Fluffy_Pillow 68.6/120: 57% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:07.034 kingsbane Fluffy_Pillow 103.2/120: 86% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:08.039 mutilate Fluffy_Pillow 102.7/120: 86% energy | 1.0/6: 17% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:09.043 mutilate Fluffy_Pillow 82.2/120: 69% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:10.047 envenom Fluffy_Pillow 61.8/120: 51% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, potion_of_the_old_war
0:11.050 mutilate Fluffy_Pillow 61.3/120: 51% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:12.055 Waiting 2.700 sec 40.8/120: 34% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:14.755 garrote Fluffy_Pillow 99.9/120: 83% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:16.006 mutilate Fluffy_Pillow 83.0/120: 69% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, envenom, potion_of_the_old_war
0:17.011 envenom Fluffy_Pillow 62.6/120: 52% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, envenom, potion_of_the_old_war
0:18.015 Waiting 0.100 sec 52.1/120: 43% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:18.115 mutilate Fluffy_Pillow 63.5/120: 53% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:19.118 Waiting 0.900 sec 43.1/120: 36% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:20.018 mutilate Fluffy_Pillow 56.1/120: 47% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:21.021 Waiting 1.800 sec 45.6/120: 38% energy | 6.0/6: 100% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:22.821 rupture Fluffy_Pillow 81.7/120: 68% energy | 6.0/6: 100% combo_points bloodlust, envenom, potion_of_the_old_war
0:23.827 mutilate Fluffy_Pillow 91.2/120: 76% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:24.831 Waiting 0.200 sec 50.7/120: 42% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:25.031 mutilate Fluffy_Pillow 73.6/120: 61% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:26.035 Waiting 1.900 sec 33.2/120: 28% energy | 5.0/6: 83% combo_points bloodlust, elaborate_planning
0:27.935 envenom Fluffy_Pillow 80.7/120: 67% energy | 5.0/6: 83% combo_points bloodlust
0:28.939 Waiting 0.900 sec 60.2/120: 50% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:29.839 garrote Fluffy_Pillow 93.2/120: 78% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:31.004 mutilate Fluffy_Pillow 75.1/120: 63% energy | 1.0/6: 17% combo_points bloodlust, envenom, elaborate_planning
0:32.010 Waiting 0.800 sec 44.7/120: 37% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning
0:32.810 mutilate Fluffy_Pillow 56.2/120: 47% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning
0:33.812 rupture Fluffy_Pillow 35.7/120: 30% energy | 6.0/6: 100% combo_points bloodlust, envenom
0:34.817 Waiting 0.700 sec 25.3/120: 21% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning
0:35.517 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning
0:36.523 Waiting 1.393 sec 15.0/120: 12% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning
0:37.916 mutilate Fluffy_Pillow 55.1/120: 46% energy | 2.0/6: 33% combo_points bloodlust, elaborate_planning
0:38.921 Waiting 2.113 sec 14.7/120: 12% energy | 6.0/6: 100% combo_points bloodlust
0:41.034 envenom Fluffy_Pillow 81.6/120: 68% energy | 6.0/6: 100% combo_points
0:42.039 mutilate Fluffy_Pillow 57.8/120: 48% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:43.044 Waiting 2.600 sec 34.0/120: 28% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
0:45.644 garrote Fluffy_Pillow 82.9/120: 69% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
0:46.647 Waiting 0.400 sec 49.1/120: 41% energy | 4.0/6: 67% combo_points envenom
0:47.047 mutilate Fluffy_Pillow 73.5/120: 61% energy | 4.0/6: 67% combo_points envenom
0:48.050 Waiting 2.000 sec 29.7/120: 25% energy | 6.0/6: 100% combo_points
0:50.050 rupture Fluffy_Pillow 72.0/120: 60% energy | 6.0/6: 100% combo_points
0:51.056 exsanguinate Fluffy_Pillow 78.2/120: 65% energy | 0.0/6: 0% combo_points elaborate_planning
0:52.062 kingsbane Fluffy_Pillow 109.4/120: 91% energy | 0.0/6: 0% combo_points elaborate_planning
0:53.068 mutilate Fluffy_Pillow 105.6/120: 88% energy | 1.0/6: 17% combo_points elaborate_planning
0:54.073 mutilate Fluffy_Pillow 81.7/120: 68% energy | 4.0/6: 67% combo_points elaborate_planning
0:55.077 envenom Fluffy_Pillow 57.9/120: 48% energy | 6.0/6: 100% combo_points
0:56.083 Waiting 0.100 sec 54.1/120: 45% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:56.183 mutilate Fluffy_Pillow 55.2/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:57.188 Waiting 0.900 sec 31.4/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
0:58.088 mutilate Fluffy_Pillow 61.4/120: 51% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
0:59.093 envenom Fluffy_Pillow 37.6/120: 31% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
1:00.097 Waiting 0.300 sec 33.8/120: 28% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:01.165 garrote Fluffy_Pillow 55.7/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:02.172 Waiting 1.000 sec 31.9/120: 27% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
1:03.172 mutilate Fluffy_Pillow 63.1/120: 53% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
1:04.176 Waiting 0.600 sec 29.2/120: 24% energy | 5.0/6: 83% combo_points envenom
1:04.776 envenom Fluffy_Pillow 35.9/120: 30% energy | 5.0/6: 83% combo_points envenom
1:05.781 Waiting 1.200 sec 32.1/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:06.981 mutilate Fluffy_Pillow 55.5/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:07.986 Waiting 0.800 sec 31.6/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
1:08.786 mutilate Fluffy_Pillow 60.6/120: 50% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
1:09.791 rupture Fluffy_Pillow 26.7/120: 22% energy | 6.0/6: 100% combo_points envenom
1:10.796 Waiting 1.984 sec 12.9/120: 11% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:12.780 mutilate Fluffy_Pillow 55.0/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
1:13.786 Waiting 2.139 sec 21.2/120: 18% energy | 3.0/6: 50% combo_points elaborate_planning
1:15.925 garrote Fluffy_Pillow 75.0/120: 63% energy | 3.0/6: 50% combo_points
1:17.169 Waiting 0.200 sec 53.9/120: 45% energy | 4.0/6: 67% combo_points
1:17.369 mutilate Fluffy_Pillow 56.1/120: 47% energy | 4.0/6: 67% combo_points
1:18.374 Waiting 0.342 sec 22.3/120: 19% energy | 6.0/6: 100% combo_points
1:18.716 rupture Fluffy_Pillow 26.1/120: 22% energy | 6.0/6: 100% combo_points
1:19.721 Waiting 1.543 sec 22.3/120: 19% energy | 0.0/6: 0% combo_points elaborate_planning
1:21.264 mutilate Fluffy_Pillow 59.5/120: 50% energy | 0.0/6: 0% combo_points elaborate_planning
1:22.268 Waiting 1.600 sec 25.7/120: 21% energy | 4.0/6: 67% combo_points elaborate_planning
1:23.868 mutilate Fluffy_Pillow 63.5/120: 53% energy | 4.0/6: 67% combo_points
1:24.872 Waiting 2.781 sec 19.6/120: 16% energy | 6.0/6: 100% combo_points
1:27.653 envenom Fluffy_Pillow 80.6/120: 67% energy | 6.0/6: 100% combo_points
1:28.658 mutilate Fluffy_Pillow 66.8/120: 56% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:29.663 Waiting 2.200 sec 33.0/120: 27% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
1:31.863 garrote Fluffy_Pillow 87.5/120: 73% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
1:32.867 Waiting 0.200 sec 53.7/120: 45% energy | 3.0/6: 50% combo_points envenom
1:33.067 mutilate Fluffy_Pillow 55.9/120: 47% energy | 3.0/6: 50% combo_points envenom
1:34.070 Waiting 1.000 sec 32.0/120: 27% energy | 5.0/6: 83% combo_points envenom
1:35.070 vendetta Fluffy_Pillow 43.2/120: 36% energy | 5.0/6: 83% combo_points
1:35.070 potion Fluffy_Pillow 120.0/120: 100% energy | 5.0/6: 83% combo_points
1:35.070 mutilate Fluffy_Pillow 120.0/120: 100% energy | 5.0/6: 83% combo_points potion_of_the_old_war
1:36.074 rupture Fluffy_Pillow 96.2/120: 80% energy | 6.0/6: 100% combo_points potion_of_the_old_war
1:37.080 exsanguinate Fluffy_Pillow 82.4/120: 69% energy | 0.0/6: 0% combo_points elaborate_planning, potion_of_the_old_war
1:38.084 kingsbane Fluffy_Pillow 113.6/120: 95% energy | 0.0/6: 0% combo_points elaborate_planning, potion_of_the_old_war
1:39.090 mutilate Fluffy_Pillow 109.8/120: 91% energy | 1.0/6: 17% combo_points elaborate_planning, potion_of_the_old_war
1:40.095 mutilate Fluffy_Pillow 85.9/120: 72% energy | 3.0/6: 50% combo_points elaborate_planning, potion_of_the_old_war
1:41.099 envenom Fluffy_Pillow 62.1/120: 52% energy | 6.0/6: 100% combo_points potion_of_the_old_war
1:42.104 mutilate Fluffy_Pillow 58.3/120: 49% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:43.107 Waiting 0.400 sec 34.5/120: 29% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:43.507 mutilate Fluffy_Pillow 58.9/120: 49% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:44.512 envenom Fluffy_Pillow 35.1/120: 29% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:45.517 Waiting 1.100 sec 31.3/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:46.617 garrote Fluffy_Pillow 63.6/120: 53% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:47.868 Waiting 0.600 sec 42.5/120: 35% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:48.468 mutilate Fluffy_Pillow 59.2/120: 49% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:49.472 Waiting 1.000 sec 35.3/120: 29% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:50.472 mutilate Fluffy_Pillow 56.5/120: 47% energy | 3.0/6: 50% combo_points envenom, potion_of_the_old_war
1:51.478 Waiting 2.500 sec 32.7/120: 27% energy | 5.0/6: 83% combo_points envenom, potion_of_the_old_war
1:53.978 mutilate Fluffy_Pillow 90.5/120: 75% energy | 5.0/6: 83% combo_points potion_of_the_old_war
1:54.982 rupture Fluffy_Pillow 76.7/120: 64% energy | 6.0/6: 100% combo_points potion_of_the_old_war
1:55.987 mutilate Fluffy_Pillow 62.9/120: 52% energy | 0.0/6: 0% combo_points elaborate_planning, potion_of_the_old_war
1:56.991 Waiting 1.500 sec 39.1/120: 33% energy | 4.0/6: 67% combo_points elaborate_planning, potion_of_the_old_war
1:58.491 mutilate Fluffy_Pillow 55.8/120: 46% energy | 4.0/6: 67% combo_points elaborate_planning, potion_of_the_old_war
1:59.496 rupture Fluffy_Pillow 31.9/120: 27% energy | 6.0/6: 100% combo_points elaborate_planning, potion_of_the_old_war
2:00.499 Waiting 1.119 sec 18.1/120: 15% energy | 0.0/6: 0% combo_points elaborate_planning
2:01.618 garrote Fluffy_Pillow 50.6/120: 42% energy | 0.0/6: 0% combo_points elaborate_planning
2:02.866 Waiting 1.400 sec 29.5/120: 25% energy | 1.0/6: 17% combo_points elaborate_planning
2:04.266 mutilate Fluffy_Pillow 55.0/120: 46% energy | 1.0/6: 17% combo_points elaborate_planning
2:05.270 Waiting 1.600 sec 31.2/120: 26% energy | 4.0/6: 67% combo_points
2:06.870 mutilate Fluffy_Pillow 59.0/120: 49% energy | 4.0/6: 67% combo_points
2:07.874 Waiting 3.000 sec 25.2/120: 21% energy | 6.0/6: 100% combo_points
2:10.874 envenom Fluffy_Pillow 88.6/120: 74% energy | 6.0/6: 100% combo_points
2:11.878 mutilate Fluffy_Pillow 74.8/120: 62% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:12.882 Waiting 0.400 sec 41.0/120: 34% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
2:13.282 mutilate Fluffy_Pillow 55.4/120: 46% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
2:14.286 Waiting 1.603 sec 11.6/120: 10% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:15.889 envenom Fluffy_Pillow 49.4/120: 41% energy | 6.0/6: 100% combo_points envenom
2:16.894 Waiting 0.600 sec 35.6/120: 30% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:17.494 garrote Fluffy_Pillow 52.3/120: 44% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:18.498 Waiting 1.484 sec 18.5/120: 15% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
2:19.982 mutilate Fluffy_Pillow 55.0/120: 46% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
2:20.987 Waiting 3.500 sec 31.2/120: 26% energy | 5.0/6: 83% combo_points envenom
2:24.487 mutilate Fluffy_Pillow 90.2/120: 75% energy | 5.0/6: 83% combo_points envenom
2:25.490 vanish Fluffy_Pillow 66.3/120: 55% energy | 6.0/6: 100% combo_points
2:25.490 rupture Fluffy_Pillow 66.3/120: 55% energy | 6.0/6: 100% combo_points vanish
2:26.497 exsanguinate Fluffy_Pillow 52.5/120: 44% energy | 0.0/6: 0% combo_points elaborate_planning
2:27.501 kingsbane Fluffy_Pillow 83.7/120: 70% energy | 0.0/6: 0% combo_points elaborate_planning
2:28.505 mutilate Fluffy_Pillow 79.9/120: 67% energy | 2.0/6: 33% combo_points elaborate_planning
2:29.510 mutilate Fluffy_Pillow 56.1/120: 47% energy | 4.0/6: 67% combo_points elaborate_planning
2:30.515 Waiting 0.200 sec 32.3/120: 27% energy | 6.0/6: 100% combo_points
2:30.715 envenom Fluffy_Pillow 44.5/120: 37% energy | 6.0/6: 100% combo_points
2:31.722 Waiting 2.000 sec 40.7/120: 34% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:33.722 garrote Fluffy_Pillow 103.0/120: 86% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:34.725 mutilate Fluffy_Pillow 79.2/120: 66% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
2:35.730 envenom Fluffy_Pillow 55.3/120: 46% energy | 5.0/6: 83% combo_points envenom
2:36.736 Waiting 0.400 sec 41.5/120: 35% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:37.136 mutilate Fluffy_Pillow 56.0/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:38.139 Waiting 1.200 sec 32.2/120: 27% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
2:39.339 mutilate Fluffy_Pillow 55.5/120: 46% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
2:40.342 Waiting 0.300 sec 31.7/120: 26% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
2:40.642 envenom Fluffy_Pillow 35.0/120: 29% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
2:41.646 Waiting 1.140 sec 21.2/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:42.786 mutilate Fluffy_Pillow 63.9/120: 53% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:43.791 Waiting 0.500 sec 40.1/120: 33% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:44.291 mutilate Fluffy_Pillow 55.7/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:45.297 Waiting 1.180 sec 11.9/120: 10% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:46.477 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points envenom
2:47.482 Waiting 1.043 sec 21.2/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:48.525 garrote Fluffy_Pillow 52.8/120: 44% energy | 0.0/6: 0% combo_points elaborate_planning
2:49.726 Waiting 1.300 sec 31.2/120: 26% energy | 1.0/6: 17% combo_points elaborate_planning
2:51.026 mutilate Fluffy_Pillow 55.6/120: 46% energy | 1.0/6: 17% combo_points elaborate_planning
2:52.029 Waiting 1.787 sec 21.8/120: 18% energy | 4.0/6: 67% combo_points
2:53.816 mutilate Fluffy_Pillow 61.7/120: 51% energy | 4.0/6: 67% combo_points
2:54.820 rupture Fluffy_Pillow 27.9/120: 23% energy | 6.0/6: 100% combo_points
2:55.824 Waiting 1.900 sec 24.1/120: 20% energy | 0.0/6: 0% combo_points elaborate_planning
2:57.724 mutilate Fluffy_Pillow 65.2/120: 54% energy | 0.0/6: 0% combo_points elaborate_planning
2:58.729 Waiting 1.300 sec 31.4/120: 26% energy | 4.0/6: 67% combo_points elaborate_planning
3:00.029 mutilate Fluffy_Pillow 55.9/120: 47% energy | 4.0/6: 67% combo_points
3:01.035 Waiting 1.763 sec 22.1/120: 18% energy | 6.0/6: 100% combo_points
3:02.798 envenom Fluffy_Pillow 61.7/120: 51% energy | 6.0/6: 100% combo_points
3:03.802 Waiting 0.600 sec 47.9/120: 40% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:04.402 garrote Fluffy_Pillow 54.6/120: 45% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:05.407 Waiting 1.100 sec 30.7/120: 26% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
3:06.507 mutilate Fluffy_Pillow 63.0/120: 52% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
3:07.511 Waiting 1.423 sec 19.2/120: 16% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
3:08.934 mutilate Fluffy_Pillow 55.0/120: 46% energy | 4.0/6: 67% combo_points envenom
3:09.937 Waiting 0.643 sec 21.2/120: 18% energy | 6.0/6: 100% combo_points
3:10.580 vendetta Fluffy_Pillow 38.3/120: 32% energy | 6.0/6: 100% combo_points
3:10.580 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 6.0/6: 100% combo_points
3:10.580 rupture Fluffy_Pillow 120.0/120: 100% energy | 6.0/6: 100% combo_points blood_fury
3:11.584 exsanguinate Fluffy_Pillow 106.2/120: 88% energy | 0.0/6: 0% combo_points blood_fury, elaborate_planning
3:12.587 kingsbane Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points blood_fury, elaborate_planning
3:13.591 mutilate Fluffy_Pillow 116.2/120: 97% energy | 2.0/6: 33% combo_points blood_fury, elaborate_planning
3:14.596 envenom Fluffy_Pillow 92.4/120: 77% energy | 5.0/6: 83% combo_points blood_fury, elaborate_planning
3:15.599 mutilate Fluffy_Pillow 88.5/120: 74% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
3:16.604 mutilate Fluffy_Pillow 64.7/120: 54% energy | 2.0/6: 33% combo_points blood_fury, envenom, elaborate_planning
3:17.607 envenom Fluffy_Pillow 40.9/120: 34% energy | 6.0/6: 100% combo_points blood_fury, envenom, elaborate_planning
3:18.611 Waiting 1.100 sec 37.1/120: 31% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
3:19.711 garrote Fluffy_Pillow 79.3/120: 66% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
3:20.716 mutilate Fluffy_Pillow 55.5/120: 46% energy | 1.0/6: 17% combo_points blood_fury, envenom, elaborate_planning
3:21.721 Waiting 1.200 sec 31.7/120: 26% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning
3:22.921 mutilate Fluffy_Pillow 55.1/120: 46% energy | 3.0/6: 50% combo_points blood_fury, envenom
3:23.926 Waiting 0.200 sec 31.2/120: 26% energy | 6.0/6: 100% combo_points blood_fury, envenom
3:24.126 envenom Fluffy_Pillow 43.5/120: 36% energy | 6.0/6: 100% combo_points blood_fury, envenom
3:25.130 Waiting 0.900 sec 29.6/120: 25% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
3:26.030 mutilate Fluffy_Pillow 59.7/120: 50% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:27.034 Waiting 1.000 sec 25.8/120: 22% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:28.034 mutilate Fluffy_Pillow 57.0/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:29.040 Waiting 0.263 sec 23.2/120: 19% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
3:29.303 rupture Fluffy_Pillow 36.1/120: 30% energy | 6.0/6: 100% combo_points envenom
3:30.307 Waiting 1.200 sec 32.3/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:31.507 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:32.512 Waiting 1.984 sec 21.8/120: 18% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:34.496 garrote Fluffy_Pillow 63.9/120: 53% energy | 3.0/6: 50% combo_points
3:35.713 Waiting 0.300 sec 52.5/120: 44% energy | 4.0/6: 67% combo_points
3:36.013 mutilate Fluffy_Pillow 55.8/120: 47% energy | 4.0/6: 67% combo_points
3:37.017 Waiting 1.169 sec 12.0/120: 10% energy | 6.0/6: 100% combo_points
3:38.186 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points
3:39.190 Waiting 0.600 sec 31.2/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning
3:39.790 mutilate Fluffy_Pillow 57.9/120: 48% energy | 0.0/6: 0% combo_points elaborate_planning
3:40.794 Waiting 1.884 sec 14.0/120: 12% energy | 2.0/6: 33% combo_points elaborate_planning
3:42.678 mutilate Fluffy_Pillow 55.0/120: 46% energy | 2.0/6: 33% combo_points elaborate_planning
3:43.682 Waiting 2.642 sec 21.2/120: 18% energy | 6.0/6: 100% combo_points
3:46.324 envenom Fluffy_Pillow 80.6/120: 67% energy | 6.0/6: 100% combo_points
3:47.327 mutilate Fluffy_Pillow 66.8/120: 56% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:48.332 Waiting 2.000 sec 33.0/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:50.332 garrote Fluffy_Pillow 75.2/120: 63% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:51.337 Waiting 0.400 sec 51.4/120: 43% energy | 4.0/6: 67% combo_points envenom
3:51.737 mutilate Fluffy_Pillow 65.9/120: 55% energy | 4.0/6: 67% combo_points envenom
3:52.743 Waiting 2.863 sec 22.1/120: 18% energy | 6.0/6: 100% combo_points envenom
3:55.606 rupture Fluffy_Pillow 83.9/120: 70% energy | 6.0/6: 100% combo_points
3:56.611 exsanguinate Fluffy_Pillow 80.1/120: 67% energy | 0.0/6: 0% combo_points elaborate_planning
3:57.615 kingsbane Fluffy_Pillow 111.3/120: 93% energy | 0.0/6: 0% combo_points elaborate_planning
3:58.620 mutilate Fluffy_Pillow 107.5/120: 90% energy | 2.0/6: 33% combo_points elaborate_planning
3:59.625 mutilate Fluffy_Pillow 83.7/120: 70% energy | 4.0/6: 67% combo_points elaborate_planning
4:00.630 envenom Fluffy_Pillow 59.9/120: 50% energy | 6.0/6: 100% combo_points
4:01.632 mutilate Fluffy_Pillow 56.0/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:02.637 Waiting 0.600 sec 32.2/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:03.237 mutilate Fluffy_Pillow 58.9/120: 49% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:04.241 envenom Fluffy_Pillow 35.1/120: 29% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
4:06.009 garrote Fluffy_Pillow 49.8/120: 41% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:07.010 Waiting 1.000 sec 25.9/120: 22% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
4:08.010 mutilate Fluffy_Pillow 57.0/120: 48% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
4:09.014 Waiting 0.960 sec 23.2/120: 19% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
4:09.974 envenom Fluffy_Pillow 43.9/120: 37% energy | 5.0/6: 83% combo_points envenom
4:10.977 Waiting 1.000 sec 40.1/120: 33% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:11.977 mutilate Fluffy_Pillow 61.2/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:12.982 Waiting 1.000 sec 37.4/120: 31% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:13.982 mutilate Fluffy_Pillow 58.5/120: 49% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:14.986 rupture Fluffy_Pillow 34.7/120: 29% energy | 5.0/6: 83% combo_points envenom
4:15.990 Waiting 1.270 sec 20.9/120: 17% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:17.260 mutilate Fluffy_Pillow 55.0/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:18.262 Waiting 2.543 sec 21.2/120: 18% energy | 2.0/6: 33% combo_points elaborate_planning
4:20.805 garrote Fluffy_Pillow 69.5/120: 58% energy | 2.0/6: 33% combo_points
4:22.015 mutilate Fluffy_Pillow 58.0/120: 48% energy | 3.0/6: 50% combo_points
4:23.020 Waiting 0.100 sec 24.1/120: 20% energy | 6.0/6: 100% combo_points
4:23.120 rupture Fluffy_Pillow 25.3/120: 21% energy | 6.0/6: 100% combo_points
4:24.126 Waiting 1.917 sec 21.5/120: 18% energy | 0.0/6: 0% combo_points elaborate_planning
4:26.043 mutilate Fluffy_Pillow 62.8/120: 52% energy | 0.0/6: 0% combo_points elaborate_planning
4:27.047 Waiting 1.500 sec 29.0/120: 24% energy | 4.0/6: 67% combo_points elaborate_planning
4:28.547 mutilate Fluffy_Pillow 55.7/120: 46% energy | 4.0/6: 67% combo_points
4:29.552 Waiting 2.581 sec 21.9/120: 18% energy | 6.0/6: 100% combo_points
4:32.133 envenom Fluffy_Pillow 80.6/120: 67% energy | 6.0/6: 100% combo_points
4:33.136 mutilate Fluffy_Pillow 66.8/120: 56% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:34.142 Waiting 2.500 sec 33.0/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:36.642 garrote Fluffy_Pillow 80.8/120: 67% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:37.649 mutilate Fluffy_Pillow 57.0/120: 48% energy | 4.0/6: 67% combo_points envenom
4:38.655 Waiting 1.760 sec 23.2/120: 19% energy | 6.0/6: 100% combo_points envenom
4:40.415 vendetta Fluffy_Pillow 62.8/120: 52% energy | 6.0/6: 100% combo_points
4:40.580 mutilate Fluffy_Pillow 120.0/120: 100% energy | 6.0/6: 100% combo_points
4:41.583 vanish Fluffy_Pillow 86.2/120: 72% energy | 6.0/6: 100% combo_points
4:41.583 rupture Fluffy_Pillow 86.2/120: 72% energy | 6.0/6: 100% combo_points vanish
4:42.588 exsanguinate Fluffy_Pillow 82.4/120: 69% energy | 0.0/6: 0% combo_points elaborate_planning
4:43.594 kingsbane Fluffy_Pillow 113.6/120: 95% energy | 0.0/6: 0% combo_points elaborate_planning
4:44.599 mutilate Fluffy_Pillow 109.7/120: 91% energy | 2.0/6: 33% combo_points elaborate_planning
4:45.602 mutilate Fluffy_Pillow 85.9/120: 72% energy | 4.0/6: 67% combo_points elaborate_planning
4:46.607 envenom Fluffy_Pillow 62.1/120: 52% energy | 6.0/6: 100% combo_points
4:47.611 mutilate Fluffy_Pillow 58.3/120: 49% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:48.615 Waiting 0.700 sec 34.5/120: 29% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:49.315 mutilate Fluffy_Pillow 62.2/120: 52% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:50.320 envenom Fluffy_Pillow 38.4/120: 32% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
4:51.323 Waiting 0.100 sec 34.6/120: 29% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:51.934 garrote Fluffy_Pillow 51.4/120: 43% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:52.940 Waiting 1.000 sec 27.6/120: 23% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
4:53.940 mutilate Fluffy_Pillow 58.7/120: 49% energy | 1.0/6: 17% combo_points envenom, elaborate_planning

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8809 8484 0
Agility 27685 25978 15715 (13641)
Stamina 41360 41360 25556
Intellect 5322 4997 0
Spirit 2 2 0
Health 2481600 2481600 0
Energy 120 120 0
Combo Points 6 6 0
Crit 44.27% 44.27% 10245
Haste 11.33% 11.33% 3683
Damage / Heal Versatility 6.31% 5.38% 2151
Attack Power 27685 25978 0
Mastery 69.52% 69.52% 3284
Armor 2236 2236 2236
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +1012 Crit, +448 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Dragonspur Wristguards
ilevel: 880, stats: { 159 Armor, +1447 Sta, +965 AgiInt, +569 Crit, +252 Haste }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Ascended Glory
ilevel: 885, stats: { +1516 Sta, +1136 Haste, +957 Crit }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Hunger of the Pack
ilevel: 865, stats: { +1418 StrAgi, +986 Crit }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand The Kingslayers
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand The Kingslayers
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Assassination_Exsg_T19M"
level=110
race=orc
role=attack
position=back
talents=2110131
artifact=43:0:0:0:0:323:3:324:3:325:3:326:3:327:3:328:3:329:3:330:3:331:3:332:1:333:1:334:1:335:1:337:1:346:1:347:1:1276:1
spec=assassination

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions+=/blood_fury,if=debuff.vendetta.up
actions+=/berserking,if=debuff.vendetta.up
actions+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions+=/call_action_list,name=cds
actions+=/rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
actions+=/pool_resource,for_next=1
actions+=/kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
actions+=/run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
actions+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions+=/call_action_list,name=exsang,if=dot.rupture.exsanguinated
actions+=/rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
actions+=/call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
actions+=/call_action_list,name=build_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=build_noex,if=!talent.exsanguinate.enabled

actions.build_ex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_ex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_ex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_ex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_ex+=/hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&((dot.rupture.exsanguinated&dot.rupture.remains<=2)|cooldown.exsanguinate.remains<=2))
actions.build_ex+=/mutilate,if=combo_points.deficit<=1&energy.deficit<=30
actions.build_ex+=/mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2

actions.build_noex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_noex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_noex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_noex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_noex+=/hemorrhage,if=combo_points.deficit>=1&refreshable
actions.build_noex+=/mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2

actions.cds=marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=target.time_to_die<20
actions.cds+=/vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
actions.cds+=/vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
actions.cds+=/vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25

actions.exsang=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die>6
actions.exsang+=/rupture,if=combo_points>=cp_max_spend&ticks_remain<2
actions.exsang+=/death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang+=/envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)

actions.exsang_combo=vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
actions.exsang_combo+=/rupture,if=combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)
actions.exsang_combo+=/exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
actions.exsang_combo+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions.exsang_combo+=/hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
actions.exsang_combo+=/call_action_list,name=build_ex

actions.finish_ex=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_ex+=/rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
actions.finish_ex+=/death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)

actions.finish_noex=variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_noex+=/rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_noex+=/rupture,if=combo_points>=cp_max_spend&((dot.rupture.refreshable|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
actions.finish_noex+=/death_from_above,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
actions.finish_noex+=/envenom,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)

actions.garrote=pool_resource,for_next=1
actions.garrote+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
actions.garrote+=/pool_resource,for_next=1
actions.garrote+=/garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=grove_keepers_robe,id=139207,bonus_id=1806
wrists=dragonspur_wristguards,id=138219,bonus_id=1806
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=ring_of_ascended_glory,id=142520,bonus_id=3469,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=hunger_of_the_pack,id=136975,bonus_id=1517
main_hand=the_kingslayers,id=128870,bonus_id=741,gem_id=139268/139261/139260,relic_id=1806/1806/1806
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=882.80
# gear_agility=15715
# gear_stamina=25556
# gear_crit_rating=10245
# gear_haste_rating=3683
# gear_mastery_rating=3284
# gear_versatility_rating=2151
# gear_armor=2236

Rogue_Assassination_T19M : 399746 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
399745.8 399745.8 318.2 / 0.080% 55039.7 / 13.8% 17618.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
22.7 22.7 Energy 49.91% 32.0 100.0% 100%
Talents
  • 15: Elaborate Planning
  • 30: Nightstalker
  • 45: Deeper Stratagem
  • 75: Thuggee (Assassination Rogue)
  • 90: Agonizing Poison (Assassination Rogue)
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Assassination_T19M 399746
auto_attack_mh 21160 5.3% 198.8 1.52sec 31962 21405 Direct 198.8 26263 52503 31962 40.7% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.81 198.81 0.00 0.00 1.4932 0.0000 6354362.11 9341514.21 31.98 21405.39 21405.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.08 40.28% 26262.56 16209 33994 26262.27 24492 27934 2103014 3091630 31.98
crit 80.97 40.73% 52502.70 32417 67988 52500.96 49358 55665 4251348 6249884 31.98
miss 37.76 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 10493 2.6% 197.0 1.53sec 15996 10608 Direct 197.0 13128 26265 15996 40.8% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 197.01 197.01 0.00 0.00 1.5079 0.0000 3151381.25 4632828.95 31.98 10608.18 10608.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.20 40.20% 13127.92 8104 16997 13127.12 12338 13934 1039726 1528495 31.98
crit 80.40 40.81% 26265.50 16209 33994 26265.75 24786 27741 2111656 3104334 31.98
miss 37.42 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Envenom 59877 15.0% 33.2 8.90sec 542336 539920 Direct 33.2 385483 771129 542330 40.7% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.17 33.17 0.00 0.00 1.0045 0.0000 17989064.82 17989064.82 0.00 539920.31 539920.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.68 59.33% 385483.08 189924 609182 385819.60 318804 467320 7585753 7585753 0.00
crit 13.49 40.67% 771129.34 379847 1218365 771798.16 540295 989371 10403312 10403312 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
From the Shadows 17490 4.4% 203.8 2.77sec 25794 0 Direct 203.8 18325 36650 25794 40.8% 0.0%  

Stats details: from_the_shadows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.84 203.84 0.00 0.00 0.0000 0.0000 5257882.14 5257882.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 120.76 59.24% 18325.20 12072 19855 18327.37 17746 18747 2213049 2213049 0.00
crit 83.08 40.76% 36650.42 26097 39711 36654.66 35232 37899 3044833 3044833 0.00
 
 

Action details: from_the_shadows

Static Values
  • id:192434
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192434
  • name:From the Shadows
  • school:nature
  • tooltip:
  • description:{$@spelldesc192428=Declaring your Vendetta unleashes a barrage of poisoned daggers at the target for ${20*{$192434s1=10}*$m1} Nature damage over {$192432d=20 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.350000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10.00
  • base_dd_max:10.00
 
Garrote 36137 9.0% 17.5 17.84sec 620419 617670 Periodic 149.8 51526 102997 72483 40.7% 0.0% 99.7%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.50 0.00 149.78 149.78 1.0045 2.0000 10856787.16 10856787.16 0.00 34232.77 617670.09
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.8 59.28% 51525.72 31011 99469 51546.77 47777 55088 4575397 4575397 0.00
crit 61.0 40.72% 102996.69 62023 198939 103046.11 94302 114866 6281390 6281390 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Horrific Slam 20194 5.1% 119.2 2.18sec 50889 0 Direct 119.2 36149 72294 50889 40.8% 0.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.23 119.23 0.00 0.00 0.0000 0.0000 6067345.08 6067345.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.61 59.22% 36149.43 24898 37886 36147.76 33471 37616 2552429 2552429 0.00
crit 48.62 40.78% 72294.02 49795 75772 72289.32 65995 75744 3514916 3514916 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Kingsbane 14647 (21911) 3.7% (5.5%) 6.9 46.49sec 956427 952277 Periodic 46.9 66634 133047 93728 40.8% 0.0% 31.2%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 0.00 46.87 46.87 1.0045 2.0000 4393218.82 4393218.82 0.00 65314.42 952277.27
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.7 59.20% 66634.25 25461 183602 66765.78 51063 87939 1849024 1849024 0.00
crit 19.1 40.80% 133046.57 47109 344013 133312.32 96718 185950 2544195 2544195 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 4842 1.2% 6.9 46.49sec 211466 0 Direct 6.9 150129 300278 211468 40.9% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.87 0.00 0.00 0.0000 0.0000 1453415.17 1453415.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.07 59.15% 150129.46 119666 216239 149799.98 0 167734 610333 610333 0.00
crit 2.81 40.85% 300278.42 246550 335469 291067.95 0 335469 843083 843083 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 2422 0.6% 6.9 46.49sec 105766 0 Direct 6.9 75176 150373 105768 40.7% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.87 0.00 0.00 0.0000 0.0000 726936.00 726936.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.08 59.32% 75175.66 63383 83867 74944.20 0 83867 306496 306496 0.00
crit 2.80 40.68% 150372.83 123275 167734 145649.33 0 167734 420440 420440 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mark of the Hidden Satyr 7059 1.8% 17.0 17.62sec 124556 0 Direct 17.0 88347 176817 124554 40.9% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.02 17.02 0.00 0.00 0.0000 0.0000 2120022.43 2120022.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.05 59.07% 88346.91 61572 93693 88317.40 74207 93693 888302 888302 0.00
crit 6.97 40.93% 176816.81 123145 187385 176549.56 0 187385 1231720 1231720 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Mutilate 0 (60588) 0.0% (15.2%) 78.6 3.82sec 231364 230328

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.65 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 230328.21 230328.21
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit<=1&energy.deficit<=30
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage.{$?s1329=true}|!c1[][ Replaces Sinister Strike.] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 40394 10.1% 78.6 3.82sec 154255 0 Direct 78.6 105072 210146 154255 46.8% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.65 78.65 0.00 0.00 0.0000 0.0000 12131599.08 17834599.79 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.83 53.19% 105071.70 64335 134814 105074.93 96255 113815 4395514 6461822 31.98
crit 36.81 46.81% 210145.81 128669 269628 210136.09 187642 233981 7736085 11372778 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 20193 5.1% 78.6 3.82sec 77109 0 Direct 78.6 52563 105130 77109 46.7% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.65 78.65 0.00 0.00 0.0000 0.0000 6064329.50 8915138.79 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.92 53.31% 52563.06 32166 67404 52566.79 48249 56611 2203596 3239495 31.98
crit 36.72 46.69% 105129.77 64331 134807 105109.30 95909 115142 3860733 5675644 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Poison Bomb 23479 5.9% 37.9 5.96sec 186443 0 Direct 37.9 132564 265162 186447 40.6% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.86 37.86 0.00 0.00 0.0000 0.0000 7059136.77 7059136.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.48 59.37% 132563.51 97470 141997 132582.00 122482 141997 2979664 2979664 0.00
crit 15.38 40.63% 265162.26 194941 283993 265184.77 247378 283993 4079473 4079473 0.00
 
 

Action details: poison_bomb

Static Values
  • id:192660
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192660
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc192657=Envenom has a chance to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$192660s1=1}*6} Nature damage over {$192661d=3 seconds} to all enemies within it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Potion of the Old War 23461 5.8% 24.1 4.10sec 287764 0 Direct 24.1 204324 408660 287770 40.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.09 24.09 0.00 0.00 0.0000 0.0000 6931274.06 10189629.42 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.25 59.17% 204323.53 143757 218750 204305.00 164954 218750 2911860 4280711 31.98
crit 9.84 40.83% 408659.52 287514 437500 408540.75 322912 437500 4019414 5908919 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rupture 97898 24.5% 11.8 26.11sec 2489716 2478636 Periodic 146.8 132956 265611 200433 50.9% 0.0% 97.3%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.82 0.00 146.79 146.79 1.0045 1.9925 29421414.08 29421414.08 0.00 96669.99 2478636.40
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.1 49.13% 132956.20 123 401178 133003.19 105316 176741 9588971 9588971 0.00
crit 74.7 50.87% 265610.52 245 802356 265713.58 216197 342014 19832443 19832443 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${{$s1=0}*1*8/2} over 8 sec 2 points: ${{$s1=0}*2*12/2} over 12 sec 3 points: ${{$s1=0}*3*16/2} over 16 sec 4 points: ${{$s1=0}*4*20/2} over 20 sec 5 points: ${{$s1=0}*5*24/2} over 24 sec{$?s193531=false}[ 6 points: ${{$s1=0}*6*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Rogue_Assassination_T19M
Agonizing Poison 200.1 1.60sec

Stats details: agonizing_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.05 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: agonizing_poison

Static Values
  • id:200803
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200803
  • name:Agonizing Poison
  • school:nature
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=20}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${{$200803s1=4}}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T19M
  • harmful:false
  • if_expr:
 
Blood Fury 2.9 124.17sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.vendetta.up
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.9 122.65sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 5.3 62.06sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.27 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<20
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 10.6 6.6 28.6sec 17.1sec 45.14% 45.14% 6.6(6.6) 10.2

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 124.1sec 124.1sec 14.02% 14.02% 0.0(0.0) 2.7

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:14.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 12.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elaborate Planning 33.1 11.9 9.1sec 6.7sec 70.18% 56.90% 11.9(11.9) 32.4

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.15

Stack Uptimes

  • elaborate_planning_1:70.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Increases damage done by {$s1=15}%.
  • description:Increases damage done by {$s1=15}% for {$d=5 seconds}.
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom 18.6 14.6 16.1sec 8.9sec 63.30% 60.75% 14.6(14.6) 18.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:63.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Horrific Appendages 6.2 2.2 47.0sec 33.5sec 30.38% 30.38% 121.4(121.4) 5.9

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:30.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 69.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Vanish 2.9 0.0 122.7sec 122.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Assassination_T19M
envenom Energy 33.2 1160.9 35.0 35.0 15495.4
envenom Combo Points 33.2 167.1 5.0 5.0 107655.2
garrote Energy 17.5 787.5 45.0 45.0 13787.2
kingsbane Energy 6.9 240.6 35.0 35.0 27326.3
mutilate Energy 78.6 4325.5 55.0 55.0 4206.6
rupture Energy 11.8 295.4 25.0 25.0 99588.2
rupture Combo Points 11.8 70.9 6.0 6.0 414951.0
Resource Gains Type Count Total Average Overflow
kingsbane Combo Points 6.87 6.15 (2.56%) 0.89 0.72 10.51%
mutilate Combo Points 78.65 153.44 (63.86%) 1.95 3.85 2.45%
garrote Combo Points 17.50 17.50 (7.28%) 1.00 0.00 0.00%
energy_regen Energy 2109.73 3431.86 (50.98%) 1.63 112.00 3.16%
seal_fate Combo Points 76.32 63.17 (26.29%) 0.83 13.15 17.23%
Venomous Vim Energy 296.01 2853.24 (42.39%) 9.64 106.90 3.61%
Urge to Kill Energy 5.27 446.05 (6.63%) 84.61 186.58 29.49%
Resource RPS-Gain RPS-Loss
Energy 22.40 22.66
Combo Points 0.80 0.79
Combat End Resource Mean Min Max
Energy 41.30 0.03 120.00
Combo Points 2.24 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 3.1%

Procs

Count Interval
Seal Fate 76.3 5.1sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Assassination_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Rogue_Assassination_T19M Damage Per Second
Count 7499
Mean 399745.76
Minimum 349100.38
Maximum 468977.25
Spread ( max - min ) 119876.87
Range [ ( max - min ) / 2 * 100% ] 14.99%
Standard Deviation 14057.5116
5th Percentile 377589.90
95th Percentile 423812.01
( 95th Percentile - 5th Percentile ) 46222.11
Mean Distribution
Standard Deviation 162.3330
95.00% Confidence Intervall ( 399427.59 - 400063.93 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4750
0.1 Scale Factor Error with Delta=300 1686943
0.05 Scale Factor Error with Delta=300 6747774
0.01 Scale Factor Error with Delta=300 168694361
Priority Target DPS
Sample Data Rogue_Assassination_T19M Priority Target Damage Per Second
Count 7499
Mean 399745.76
Minimum 349100.38
Maximum 468977.25
Spread ( max - min ) 119876.87
Range [ ( max - min ) / 2 * 100% ] 14.99%
Standard Deviation 14057.5116
5th Percentile 377589.90
95th Percentile 423812.01
( 95th Percentile - 5th Percentile ) 46222.11
Mean Distribution
Standard Deviation 162.3330
95.00% Confidence Intervall ( 399427.59 - 400063.93 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4750
0.1 Scale Factor Error with Delta=300 1686943
0.05 Scale Factor Error with Delta=300 6747774
0.01 Scale Factor Error with Delta=300 168694361
DPS(e)
Sample Data Rogue_Assassination_T19M Damage Per Second (Effective)
Count 7499
Mean 399745.76
Minimum 349100.38
Maximum 468977.25
Spread ( max - min ) 119876.87
Range [ ( max - min ) / 2 * 100% ] 14.99%
Damage
Sample Data Rogue_Assassination_T19M Damage
Count 7499
Mean 119978168.50
Minimum 86885895.30
Maximum 157207259.70
Spread ( max - min ) 70321364.40
Range [ ( max - min ) / 2 * 100% ] 29.31%
DTPS
Sample Data Rogue_Assassination_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Assassination_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Assassination_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Assassination_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Assassination_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Assassination_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Assassination_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Assassination_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=old_war
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
9 2.87 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
A 0.00 call_action_list,name=cds
0.00 rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
0.00 pool_resource,for_next=1
B 6.88 kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
C 0.00 run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
D 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
E 0.00 call_action_list,name=exsang,if=dot.rupture.exsanguinated
0.00 rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
F 0.00 call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
G 0.00 call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
H 0.00 call_action_list,name=build_ex,if=talent.exsanguinate.enabled
I 0.00 call_action_list,name=build_noex,if=!talent.exsanguinate.enabled
actions.build_noex
# count action,conditions
0.00 hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
0.00 hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
0.00 fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
0.00 fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
0.00 hemorrhage,if=combo_points.deficit>=1&refreshable
J 78.65 mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2
actions.cds
# count action,conditions
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
K 0.32 vendetta,if=target.time_to_die<20
L 4.96 vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
0.00 vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
M 2.90 vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25
actions.finish_noex
# count action,conditions
0.00 variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
P 11.82 rupture,if=combo_points>=cp_max_spend&((dot.rupture.refreshable|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
0.00 death_from_above,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
Q 33.17 envenom,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
actions.garrote
# count action,conditions
0.00 pool_resource,for_next=1
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
0.00 pool_resource,for_next=1
R 17.50 garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

Sample Sequence

012456RJJMPL9BJQJJQRJQJJQJJRPJJQJJQRBJPJJQJRJQL8JJJQJJQRJJPJQBJQRJJQJJJPRJJJMPL9JJQJRBQJJQJJQRJJPJJQRJQJJQJRJPLBJJQJJQRJQJJJPJQRJQJQJJBRMPJJQJL9JQJJQRJQJJJPRJJQBJQJ

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Assassination_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Assassination_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Assassination_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.004 mutilate Fluffy_Pillow 89.2/120: 74% energy | 1.0/6: 17% combo_points bloodlust, potion_of_the_old_war
0:02.008 mutilate Fluffy_Pillow 58.5/120: 49% energy | 5.0/6: 83% combo_points bloodlust, potion_of_the_old_war
0:03.013 Waiting 0.610 sec 17.8/120: 15% energy | 6.0/6: 100% combo_points bloodlust, potion_of_the_old_war
0:03.623 vanish Fluffy_Pillow 26.4/120: 22% energy | 6.0/6: 100% combo_points bloodlust, potion_of_the_old_war
0:03.623 rupture Fluffy_Pillow 26.4/120: 22% energy | 6.0/6: 100% combo_points bloodlust, vanish, potion_of_the_old_war
0:04.628 vendetta Fluffy_Pillow 25.7/120: 21% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:04.628 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, potion_of_the_old_war
0:04.628 kingsbane Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:05.633 mutilate Fluffy_Pillow 109.3/120: 91% energy | 2.0/6: 33% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:06.637 Waiting 0.500 sec 78.5/120: 65% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:07.137 envenom Fluffy_Pillow 85.6/120: 71% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, elaborate_planning, potion_of_the_old_war
0:08.141 mutilate Fluffy_Pillow 85.7/120: 71% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:09.145 Waiting 0.500 sec 46.2/120: 39% energy | 2.0/6: 33% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:09.645 mutilate Fluffy_Pillow 63.9/120: 53% energy | 2.0/6: 33% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:10.649 Waiting 0.100 sec 34.4/120: 29% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:10.749 envenom Fluffy_Pillow 35.9/120: 30% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:11.756 Waiting 3.000 sec 26.5/120: 22% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:14.756 garrote Fluffy_Pillow 102.7/120: 86% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:16.004 mutilate Fluffy_Pillow 97.0/120: 81% energy | 1.0/6: 17% combo_points bloodlust, blood_fury, envenom, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:17.007 envenom Fluffy_Pillow 57.4/120: 48% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, envenom, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:18.011 mutilate Fluffy_Pillow 57.9/120: 48% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:19.016 Waiting 1.300 sec 17.9/120: 15% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, envenom, elaborate_planning, horrific_appendages, potion_of_the_old_war
0:20.316 mutilate Fluffy_Pillow 56.4/120: 47% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:21.321 Waiting 0.761 sec 15.6/120: 13% energy | 6.0/6: 100% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:22.082 envenom Fluffy_Pillow 46.4/120: 39% energy | 6.0/6: 100% combo_points bloodlust, envenom, horrific_appendages, potion_of_the_old_war
0:23.087 Waiting 1.000 sec 25.7/120: 21% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:24.087 mutilate Fluffy_Pillow 59.9/120: 50% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:25.093 Waiting 1.212 sec 19.1/120: 16% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:26.305 mutilate Fluffy_Pillow 56.3/120: 47% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages
0:27.311 Waiting 3.360 sec 15.6/120: 13% energy | 5.0/6: 83% combo_points bloodlust, envenom, horrific_appendages
0:30.671 garrote Fluffy_Pillow 103.3/120: 86% energy | 5.0/6: 83% combo_points bloodlust, horrific_appendages
0:31.675 rupture Fluffy_Pillow 82.6/120: 69% energy | 6.0/6: 100% combo_points bloodlust, horrific_appendages
0:32.681 mutilate Fluffy_Pillow 81.8/120: 68% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, horrific_appendages
0:33.686 Waiting 0.300 sec 51.1/120: 43% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:33.986 mutilate Fluffy_Pillow 55.4/120: 46% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:34.990 Waiting 0.700 sec 24.6/120: 20% energy | 6.0/6: 100% combo_points bloodlust, elaborate_planning
0:35.690 envenom Fluffy_Pillow 44.5/120: 37% energy | 6.0/6: 100% combo_points bloodlust, elaborate_planning
0:36.696 Waiting 1.000 sec 33.8/120: 28% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:37.696 mutilate Fluffy_Pillow 58.0/120: 48% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:38.701 Waiting 1.300 sec 27.3/120: 23% energy | 3.0/6: 50% combo_points bloodlust, envenom, elaborate_planning
0:40.001 mutilate Fluffy_Pillow 65.4/120: 54% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
0:41.005 Waiting 0.734 sec 21.3/120: 18% energy | 5.0/6: 83% combo_points envenom
0:41.739 envenom Fluffy_Pillow 39.4/120: 33% energy | 5.0/6: 83% combo_points envenom
0:42.745 Waiting 5.900 sec 25.3/120: 21% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:48.645 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, horrific_appendages
0:49.650 kingsbane Fluffy_Pillow 86.0/120: 72% energy | 1.0/6: 17% combo_points horrific_appendages
0:50.654 mutilate Fluffy_Pillow 81.9/120: 68% energy | 3.0/6: 50% combo_points horrific_appendages
0:51.659 rupture Fluffy_Pillow 37.9/120: 32% energy | 6.0/6: 100% combo_points horrific_appendages
0:52.662 Waiting 1.100 sec 43.9/120: 37% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages
0:53.762 mutilate Fluffy_Pillow 65.9/120: 55% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages
0:54.767 Waiting 1.300 sec 31.8/120: 27% energy | 3.0/6: 50% combo_points elaborate_planning, horrific_appendages
0:56.067 mutilate Fluffy_Pillow 66.0/120: 55% energy | 3.0/6: 50% combo_points elaborate_planning, horrific_appendages
0:57.071 Waiting 0.676 sec 22.0/120: 18% energy | 6.0/6: 100% combo_points horrific_appendages
0:57.747 envenom Fluffy_Pillow 39.4/120: 33% energy | 6.0/6: 100% combo_points horrific_appendages
0:58.753 Waiting 1.300 sec 25.3/120: 21% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
1:00.053 mutilate Fluffy_Pillow 59.5/120: 50% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
1:01.059 Waiting 5.568 sec 15.5/120: 13% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages
1:06.627 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points horrific_appendages
1:07.632 mutilate Fluffy_Pillow 86.0/120: 72% energy | 3.0/6: 50% combo_points horrific_appendages
1:08.636 envenom Fluffy_Pillow 61.9/120: 52% energy | 6.0/6: 100% combo_points horrific_appendages
1:09.642 vendetta Fluffy_Pillow 38.9/120: 32% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:09.642 potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:09.642 mutilate Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:10.645 mutilate Fluffy_Pillow 96.9/120: 81% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:11.651 Waiting 0.100 sec 53.8/120: 45% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:11.751 mutilate Fluffy_Pillow 65.0/120: 54% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:12.758 Waiting 0.300 sec 32.0/120: 27% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:13.058 envenom Fluffy_Pillow 35.5/120: 30% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:14.064 Waiting 1.700 sec 32.5/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:15.764 mutilate Fluffy_Pillow 62.6/120: 52% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:16.766 Waiting 1.300 sec 29.5/120: 25% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:18.066 mutilate Fluffy_Pillow 64.9/120: 54% energy | 2.0/6: 33% combo_points envenom, blood_frenzy, potion_of_the_old_war
1:19.070 Waiting 0.667 sec 21.8/120: 18% energy | 4.0/6: 67% combo_points envenom, blood_frenzy, potion_of_the_old_war
1:19.737 envenom Fluffy_Pillow 39.6/120: 33% energy | 4.0/6: 67% combo_points envenom, potion_of_the_old_war
1:20.742 Waiting 3.900 sec 25.6/120: 21% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:24.642 garrote Fluffy_Pillow 110.7/120: 92% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:25.646 mutilate Fluffy_Pillow 77.6/120: 65% energy | 1.0/6: 17% combo_points envenom, blood_frenzy, potion_of_the_old_war
1:26.650 Waiting 0.100 sec 54.5/120: 45% energy | 5.0/6: 83% combo_points blood_frenzy, potion_of_the_old_war
1:26.750 mutilate Fluffy_Pillow 55.7/120: 46% energy | 5.0/6: 83% combo_points blood_frenzy, potion_of_the_old_war
1:27.755 Waiting 0.298 sec 22.6/120: 19% energy | 6.0/6: 100% combo_points blood_frenzy, potion_of_the_old_war
1:28.053 rupture Fluffy_Pillow 36.2/120: 30% energy | 6.0/6: 100% combo_points blood_frenzy, potion_of_the_old_war
1:29.057 Waiting 1.061 sec 23.1/120: 19% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
1:30.118 mutilate Fluffy_Pillow 55.7/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
1:31.122 Waiting 1.047 sec 12.6/120: 10% energy | 4.0/6: 67% combo_points elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
1:32.169 envenom Fluffy_Pillow 44.8/120: 37% energy | 4.0/6: 67% combo_points elaborate_planning, horrific_appendages, potion_of_the_old_war
1:33.174 Waiting 1.286 sec 20.8/120: 17% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, potion_of_the_old_war
1:34.460 kingsbane Fluffy_Pillow 55.1/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy, potion_of_the_old_war
1:35.657 Waiting 0.400 sec 34.3/120: 29% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
1:36.057 mutilate Fluffy_Pillow 59.0/120: 49% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
1:37.061 Waiting 0.963 sec 15.9/120: 13% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
1:38.024 envenom Fluffy_Pillow 37.4/120: 31% energy | 4.0/6: 67% combo_points horrific_appendages, blood_frenzy
1:39.028 Waiting 3.600 sec 24.3/120: 20% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
1:42.628 garrote Fluffy_Pillow 107.0/120: 89% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
1:43.634 mutilate Fluffy_Pillow 73.9/120: 62% energy | 1.0/6: 17% combo_points horrific_appendages, blood_frenzy
1:44.638 Waiting 0.500 sec 50.4/120: 42% energy | 3.0/6: 50% combo_points horrific_appendages
1:45.138 mutilate Fluffy_Pillow 55.8/120: 47% energy | 3.0/6: 50% combo_points horrific_appendages
1:46.143 Waiting 0.300 sec 31.8/120: 27% energy | 5.0/6: 83% combo_points horrific_appendages
1:46.443 envenom Fluffy_Pillow 35.1/120: 29% energy | 5.0/6: 83% combo_points horrific_appendages
1:47.447 Waiting 2.278 sec 11.0/120: 9% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
1:49.725 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
1:50.728 Waiting 1.300 sec 31.9/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages
1:52.028 mutilate Fluffy_Pillow 56.1/120: 47% energy | 3.0/6: 50% combo_points envenom, horrific_appendages
1:53.032 Waiting 1.273 sec 22.0/120: 18% energy | 5.0/6: 83% combo_points
1:54.305 mutilate Fluffy_Pillow 55.9/120: 47% energy | 5.0/6: 83% combo_points
1:55.311 Waiting 1.200 sec 11.9/120: 10% energy | 6.0/6: 100% combo_points
1:56.511 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points
1:57.516 Waiting 3.100 sec 31.0/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning
2:00.616 garrote Fluffy_Pillow 104.8/120: 87% energy | 0.0/6: 0% combo_points elaborate_planning
2:01.620 mutilate Fluffy_Pillow 70.8/120: 59% energy | 1.0/6: 17% combo_points
2:02.623 Waiting 0.800 sec 46.7/120: 39% energy | 3.0/6: 50% combo_points
2:03.423 mutilate Fluffy_Pillow 55.4/120: 46% energy | 3.0/6: 50% combo_points
2:04.428 Waiting 1.628 sec 21.4/120: 18% energy | 5.0/6: 83% combo_points
2:06.056 mutilate Fluffy_Pillow 59.2/120: 49% energy | 5.0/6: 83% combo_points
2:07.060 vanish Fluffy_Pillow 25.1/120: 21% energy | 6.0/6: 100% combo_points
2:07.060 rupture Fluffy_Pillow 25.1/120: 21% energy | 6.0/6: 100% combo_points vanish
2:08.064 Waiting 1.356 sec 21.1/120: 18% energy | 0.0/6: 0% combo_points elaborate_planning
2:09.420 vendetta Fluffy_Pillow 45.9/120: 38% energy | 0.0/6: 0% combo_points elaborate_planning
2:09.642 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points elaborate_planning
2:09.642 mutilate Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points blood_fury, elaborate_planning
2:10.647 mutilate Fluffy_Pillow 96.0/120: 80% energy | 3.0/6: 50% combo_points blood_fury, elaborate_planning
2:11.652 envenom Fluffy_Pillow 51.9/120: 43% energy | 6.0/6: 100% combo_points blood_fury, elaborate_planning
2:12.658 Waiting 0.700 sec 47.9/120: 40% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
2:13.358 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
2:14.362 Waiting 4.318 sec 21.5/120: 18% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning
2:18.680 garrote Fluffy_Pillow 118.7/120: 99% energy | 3.0/6: 50% combo_points blood_fury
2:19.685 kingsbane Fluffy_Pillow 84.6/120: 71% energy | 4.0/6: 67% combo_points blood_fury
2:20.690 envenom Fluffy_Pillow 80.6/120: 67% energy | 5.0/6: 83% combo_points blood_fury
2:21.694 mutilate Fluffy_Pillow 56.6/120: 47% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
2:22.698 Waiting 1.400 sec 32.5/120: 27% energy | 4.0/6: 67% combo_points blood_fury, envenom, elaborate_planning
2:24.098 mutilate Fluffy_Pillow 57.8/120: 48% energy | 4.0/6: 67% combo_points blood_fury, envenom, elaborate_planning
2:25.104 Waiting 0.910 sec 23.8/120: 20% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:26.014 envenom Fluffy_Pillow 43.7/120: 36% energy | 6.0/6: 100% combo_points envenom
2:27.019 Waiting 1.400 sec 29.7/120: 25% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:28.419 mutilate Fluffy_Pillow 55.7/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:29.425 Waiting 1.099 sec 22.6/120: 19% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
2:30.524 mutilate Fluffy_Pillow 55.7/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
2:31.528 Waiting 1.047 sec 12.6/120: 10% energy | 5.0/6: 83% combo_points envenom, blood_frenzy
2:32.575 envenom Fluffy_Pillow 45.0/120: 37% energy | 5.0/6: 83% combo_points envenom, blood_frenzy
2:33.581 Waiting 3.059 sec 21.9/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:36.640 garrote Fluffy_Pillow 98.2/120: 82% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:37.646 mutilate Fluffy_Pillow 65.1/120: 54% energy | 1.0/6: 17% combo_points envenom, blood_frenzy
2:38.649 Waiting 1.200 sec 42.0/120: 35% energy | 5.0/6: 83% combo_points envenom, blood_frenzy
2:39.849 mutilate Fluffy_Pillow 55.6/120: 46% energy | 5.0/6: 83% combo_points
2:40.853 rupture Fluffy_Pillow 31.6/120: 26% energy | 6.0/6: 100% combo_points
2:41.857 Waiting 1.681 sec 17.6/120: 15% energy | 0.0/6: 0% combo_points elaborate_planning
2:43.538 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning
2:44.542 Waiting 1.500 sec 31.9/120: 27% energy | 3.0/6: 50% combo_points elaborate_planning
2:46.042 mutilate Fluffy_Pillow 58.2/120: 49% energy | 3.0/6: 50% combo_points
2:47.046 Waiting 1.000 sec 24.2/120: 20% energy | 6.0/6: 100% combo_points
2:48.046 envenom Fluffy_Pillow 45.1/120: 38% energy | 6.0/6: 100% combo_points
2:49.051 Waiting 5.600 sec 31.1/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:54.651 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom
2:55.655 mutilate Fluffy_Pillow 86.0/120: 72% energy | 1.0/6: 17% combo_points
2:56.660 envenom Fluffy_Pillow 61.9/120: 52% energy | 4.0/6: 67% combo_points
2:57.664 Waiting 0.700 sec 37.9/120: 32% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:58.364 mutilate Fluffy_Pillow 55.5/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:59.367 Waiting 1.322 sec 21.5/120: 18% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
3:00.689 mutilate Fluffy_Pillow 55.9/120: 47% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages
3:01.692 Waiting 1.203 sec 11.9/120: 10% energy | 6.0/6: 100% combo_points horrific_appendages
3:02.895 envenom Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points horrific_appendages
3:03.900 Waiting 1.369 sec 21.0/120: 17% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
3:05.269 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
3:06.274 Waiting 6.385 sec 21.9/120: 18% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages
3:12.659 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points blood_frenzy
3:13.663 mutilate Fluffy_Pillow 86.9/120: 72% energy | 3.0/6: 50% combo_points blood_frenzy
3:14.668 rupture Fluffy_Pillow 53.8/120: 45% energy | 6.0/6: 100% combo_points blood_frenzy
3:15.673 vendetta Fluffy_Pillow 40.7/120: 34% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:15.673 kingsbane Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:16.677 mutilate Fluffy_Pillow 116.9/120: 97% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy
3:17.681 mutilate Fluffy_Pillow 73.8/120: 62% energy | 5.0/6: 83% combo_points elaborate_planning, blood_frenzy
3:18.685 envenom Fluffy_Pillow 50.7/120: 42% energy | 6.0/6: 100% combo_points elaborate_planning, blood_frenzy
3:19.688 Waiting 1.000 sec 27.5/120: 23% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:20.688 mutilate Fluffy_Pillow 58.4/120: 49% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:21.693 Waiting 1.976 sec 14.3/120: 12% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:23.669 mutilate Fluffy_Pillow 55.9/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:24.672 Waiting 0.200 sec 32.8/120: 27% energy | 5.0/6: 83% combo_points envenom, blood_frenzy
3:24.872 envenom Fluffy_Pillow 35.2/120: 29% energy | 5.0/6: 83% combo_points envenom, blood_frenzy
3:25.877 Waiting 4.787 sec 12.1/120: 10% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:30.664 garrote Fluffy_Pillow 118.9/120: 99% energy | 0.0/6: 0% combo_points envenom, blood_frenzy
3:31.670 mutilate Fluffy_Pillow 95.8/120: 80% energy | 1.0/6: 17% combo_points envenom, blood_frenzy
3:32.673 envenom Fluffy_Pillow 72.7/120: 61% energy | 4.0/6: 67% combo_points blood_frenzy
3:33.676 Waiting 0.400 sec 49.6/120: 41% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:34.076 mutilate Fluffy_Pillow 64.4/120: 54% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:35.081 Waiting 1.200 sec 31.3/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:36.281 mutilate Fluffy_Pillow 55.5/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:37.286 Waiting 1.416 sec 22.4/120: 19% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:38.702 mutilate Fluffy_Pillow 59.2/120: 49% energy | 5.0/6: 83% combo_points horrific_appendages, blood_frenzy
3:39.706 Waiting 0.747 sec 16.1/120: 13% energy | 6.0/6: 100% combo_points horrific_appendages, blood_frenzy
3:40.453 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points horrific_appendages, blood_frenzy
3:41.458 Waiting 1.300 sec 31.6/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages
3:42.758 mutilate Fluffy_Pillow 65.7/120: 55% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages
3:43.763 Waiting 0.400 sec 21.7/120: 18% energy | 4.0/6: 67% combo_points elaborate_planning, horrific_appendages
3:44.163 envenom Fluffy_Pillow 36.1/120: 30% energy | 4.0/6: 67% combo_points elaborate_planning, horrific_appendages
3:45.168 Waiting 3.469 sec 22.1/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:48.637 garrote Fluffy_Pillow 89.9/120: 75% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:49.640 mutilate Fluffy_Pillow 65.9/120: 55% energy | 1.0/6: 17% combo_points
3:50.646 Waiting 0.100 sec 31.9/120: 27% energy | 5.0/6: 83% combo_points
3:50.746 envenom Fluffy_Pillow 43.0/120: 36% energy | 5.0/6: 83% combo_points
3:51.749 Waiting 1.558 sec 18.9/120: 16% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:53.307 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:54.311 Waiting 0.386 sec 21.9/120: 18% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
3:54.697 envenom Fluffy_Pillow 36.1/120: 30% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
3:55.702 Waiting 2.185 sec 12.1/120: 10% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:57.887 mutilate Fluffy_Pillow 55.9/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:58.890 Waiting 1.300 sec 31.9/120: 27% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:00.190 mutilate Fluffy_Pillow 56.0/120: 47% energy | 2.0/6: 33% combo_points envenom
4:02.216 kingsbane Fluffy_Pillow 43.2/120: 36% energy | 4.0/6: 67% combo_points
4:03.221 Waiting 3.400 sec 29.1/120: 24% energy | 5.0/6: 83% combo_points
4:06.621 garrote Fluffy_Pillow 96.3/120: 80% energy | 5.0/6: 83% combo_points horrific_appendages
4:07.624 vanish Fluffy_Pillow 72.5/120: 60% energy | 6.0/6: 100% combo_points horrific_appendages, blood_frenzy
4:07.624 rupture Fluffy_Pillow 72.5/120: 60% energy | 6.0/6: 100% combo_points vanish, horrific_appendages, blood_frenzy
4:08.628 mutilate Fluffy_Pillow 69.4/120: 58% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages, blood_frenzy
4:09.633 Waiting 0.800 sec 36.3/120: 30% energy | 2.0/6: 33% combo_points elaborate_planning, horrific_appendages, blood_frenzy
4:10.433 mutilate Fluffy_Pillow 55.8/120: 47% energy | 2.0/6: 33% combo_points elaborate_planning, horrific_appendages, blood_frenzy
4:11.439 Waiting 0.588 sec 22.8/120: 19% energy | 5.0/6: 83% combo_points elaborate_planning, horrific_appendages, blood_frenzy
4:12.027 envenom Fluffy_Pillow 39.7/120: 33% energy | 5.0/6: 83% combo_points elaborate_planning, horrific_appendages, blood_frenzy
4:13.030 Waiting 1.600 sec 26.6/120: 22% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:14.630 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:15.634 vendetta Fluffy_Pillow 22.5/120: 19% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:15.673 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:15.673 mutilate Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:16.678 envenom Fluffy_Pillow 96.9/120: 81% energy | 6.0/6: 100% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:17.683 mutilate Fluffy_Pillow 73.5/120: 61% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages
4:18.687 Waiting 0.600 sec 49.4/120: 41% energy | 2.0/6: 33% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages
4:19.287 mutilate Fluffy_Pillow 56.1/120: 47% energy | 2.0/6: 33% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:20.292 Waiting 0.465 sec 23.0/120: 19% energy | 5.0/6: 83% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:20.757 envenom Fluffy_Pillow 38.6/120: 32% energy | 5.0/6: 83% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:21.762 Waiting 2.903 sec 15.5/120: 13% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:24.665 garrote Fluffy_Pillow 79.9/120: 67% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:25.669 mutilate Fluffy_Pillow 56.8/120: 47% energy | 1.0/6: 17% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:26.674 Waiting 0.200 sec 33.7/120: 28% energy | 5.0/6: 83% combo_points blood_fury, envenom, horrific_appendages, blood_frenzy
4:26.874 envenom Fluffy_Pillow 36.1/120: 30% energy | 5.0/6: 83% combo_points blood_fury, envenom, horrific_appendages, blood_frenzy
4:27.877 Waiting 1.911 sec 13.0/120: 11% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:29.788 mutilate Fluffy_Pillow 55.1/120: 46% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:30.794 Waiting 1.300 sec 31.0/120: 26% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:32.094 mutilate Fluffy_Pillow 55.2/120: 46% energy | 2.0/6: 33% combo_points envenom
4:33.098 Waiting 1.648 sec 21.2/120: 18% energy | 5.0/6: 83% combo_points envenom
4:34.746 mutilate Fluffy_Pillow 59.2/120: 49% energy | 5.0/6: 83% combo_points
4:35.751 Waiting 0.901 sec 15.2/120: 13% energy | 6.0/6: 100% combo_points
4:36.652 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points
4:37.656 Waiting 5.000 sec 31.0/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning
4:42.656 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
4:43.661 mutilate Fluffy_Pillow 96.0/120: 80% energy | 1.0/6: 17% combo_points
4:44.665 mutilate Fluffy_Pillow 61.9/120: 52% energy | 3.0/6: 50% combo_points
4:45.669 Waiting 0.400 sec 27.9/120: 23% energy | 6.0/6: 100% combo_points
4:46.069 envenom Fluffy_Pillow 42.3/120: 35% energy | 6.0/6: 100% combo_points
4:47.843 kingsbane Fluffy_Pillow 36.6/120: 31% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:48.847 Waiting 1.200 sec 32.6/120: 27% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
4:50.047 mutilate Fluffy_Pillow 56.1/120: 47% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
4:51.052 Waiting 0.965 sec 23.0/120: 19% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, blood_frenzy
4:52.017 envenom Fluffy_Pillow 44.5/120: 37% energy | 5.0/6: 83% combo_points envenom, horrific_appendages, blood_frenzy
4:53.022 Waiting 1.200 sec 31.4/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
4:54.222 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8809 8484 0
Agility 27700 25994 15730 (12223)
Stamina 40654 40654 25013
Intellect 5322 4997 0
Spirit 2 2 0
Health 2439240 2439240 0
Energy 120 120 0
Combo Points 6 6 0
Crit 40.78% 40.78% 9023
Haste 9.17% 9.17% 2979
Damage / Heal Versatility 6.31% 5.38% 2151
Attack Power 27700 25994 0
Mastery 89.80% 89.80% 5057
Armor 2236 2236 2236
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 881.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Soultrapper's Pendant
ilevel: 860, stats: { +1201 Sta, +1144 Crit, +762 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +1012 Crit, +448 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Dragonspur Wristguards
ilevel: 880, stats: { 159 Armor, +1447 Sta, +965 AgiInt, +569 Crit, +252 Haste }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Ascended Glory
ilevel: 885, stats: { +1516 Sta, +1136 Haste, +957 Crit }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand The Kingslayers
ilevel: 894, weapon: { 3437 - 6384, 1.8 }, stats: { +838 Agi, +1257 Sta, +335 Crit, +321 Mastery }, relics: { +48 ilevels, +48 ilevels, +48 ilevels }
Local Off Hand The Kingslayers
ilevel: 894, weapon: { 3437 - 6384, 1.8 }, stats: { +838 Agi, +1257 Sta, +335 Crit, +321 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Assassination_T19M"
level=110
race=orc
role=attack
position=back
talents=2110111
artifact=43:0:0:0:0:323:3:324:3:325:3:326:3:327:3:328:3:329:3:330:3:331:3:332:1:333:1:334:1:335:1:337:1:346:1:347:1:1276:1
spec=assassination

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions+=/blood_fury,if=debuff.vendetta.up
actions+=/berserking,if=debuff.vendetta.up
actions+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions+=/call_action_list,name=cds
actions+=/rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
actions+=/pool_resource,for_next=1
actions+=/kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
actions+=/run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
actions+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions+=/call_action_list,name=exsang,if=dot.rupture.exsanguinated
actions+=/rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
actions+=/call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
actions+=/call_action_list,name=build_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=build_noex,if=!talent.exsanguinate.enabled

actions.build_ex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_ex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_ex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_ex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_ex+=/hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&((dot.rupture.exsanguinated&dot.rupture.remains<=2)|cooldown.exsanguinate.remains<=2))
actions.build_ex+=/mutilate,if=combo_points.deficit<=1&energy.deficit<=30
actions.build_ex+=/mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2

actions.build_noex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_noex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_noex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_noex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_noex+=/hemorrhage,if=combo_points.deficit>=1&refreshable
actions.build_noex+=/mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2

actions.cds=marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=target.time_to_die<20
actions.cds+=/vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
actions.cds+=/vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
actions.cds+=/vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25

actions.exsang=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die>6
actions.exsang+=/rupture,if=combo_points>=cp_max_spend&ticks_remain<2
actions.exsang+=/death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang+=/envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)

actions.exsang_combo=vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
actions.exsang_combo+=/rupture,if=combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)
actions.exsang_combo+=/exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
actions.exsang_combo+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions.exsang_combo+=/hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
actions.exsang_combo+=/call_action_list,name=build_ex

actions.finish_ex=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_ex+=/rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
actions.finish_ex+=/death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)

actions.finish_noex=variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_noex+=/rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_noex+=/rupture,if=combo_points>=cp_max_spend&((dot.rupture.refreshable|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
actions.finish_noex+=/death_from_above,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
actions.finish_noex+=/envenom,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)

actions.garrote=pool_resource,for_next=1
actions.garrote+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
actions.garrote+=/pool_resource,for_next=1
actions.garrote+=/garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=soultrappers_pendant,id=141506,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=grove_keepers_robe,id=139207,bonus_id=1806
wrists=dragonspur_wristguards,id=138219,bonus_id=1806
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=ring_of_ascended_glory,id=142520,bonus_id=3469,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=spontaneous_appendages,id=139325,bonus_id=1806
main_hand=the_kingslayers,id=128870,bonus_id=741,gem_id=137549/137543/136718,relic_id=1517:1727/1517:1727/1517:1727
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=880.81
# gear_agility=15730
# gear_stamina=25013
# gear_crit_rating=9023
# gear_haste_rating=2979
# gear_mastery_rating=5057
# gear_versatility_rating=2151
# gear_armor=2236

Rogue_Outlaw_T19M : 417157 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
417156.6 417156.6 623.3 / 0.149% 107160.5 / 25.7% 13327.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
31.3 31.3 Energy 10.85% 65.3 100.0% 100%
Talents
  • 15: Quick Draw (Outlaw Rogue)
  • 30: Hit and Run (Outlaw Rogue)
  • 45: Deeper Stratagem
  • 90: Alacrity
  • 100: Marked for Death
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Outlaw_T19M 417157
Ambush 3193 0.8% 5.3 52.86sec 180112 179333 Direct 5.3 124239 248479 180112 45.0% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.32 5.32 0.00 0.00 1.0045 0.0000 958178.75 1408613.52 31.98 179333.47 179333.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.93 55.03% 124239.34 124239 124239 119285.67 0 124239 363705 534681 30.70
crit 2.39 44.97% 248478.69 248479 248479 233369.17 0 248479 594473 873932 30.03
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=2} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
auto_attack_mh 25454 6.1% 204.0 1.48sec 37482 26014 Direct 204.0 29431 58863 37481 46.4% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.95 203.95 0.00 0.00 1.4408 0.0000 7644542.56 11238201.67 31.98 26013.97 26013.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.62 34.62% 29431.42 29431 29431 29431.42 29431 29431 2078359 3055384 31.98
crit 94.56 46.36% 58862.83 58863 58863 58862.83 58863 58863 5566184 8182817 31.98
miss 38.78 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 12485 3.0% 200.1 1.50sec 18742 12721 Direct 200.1 14716 29431 18741 46.4% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.06 200.06 0.00 0.00 1.4733 0.0000 3749387.41 5511954.65 31.98 12720.96 12720.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.30 34.64% 14715.71 14716 14716 14715.71 14716 14716 1019809 1499216 31.98
crit 92.74 46.36% 29431.42 29431 29431 29431.42 29431 29431 2729578 4012739 31.98
miss 38.01 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Darkstrikes 8722 2.1% 36.6 7.75sec 71368 0 Direct 36.6 48583 97166 71368 46.9% 0.0%  

Stats details: darkstrikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.58 36.58 0.00 0.00 0.0000 0.0000 2610576.99 2610576.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.42 53.10% 48582.77 48583 48583 48582.77 48583 48583 943655 943655 0.00
crit 17.16 46.90% 97165.53 97166 97166 97165.53 97166 97166 1666922 1666922 0.00
 
 

Action details: darkstrikes

Static Values
  • id:215659
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215659
  • name:Darkstrikes
  • school:shadow
  • tooltip:Absorbs up to $w2 damage.
  • description:{$@spelldesc215658=Empower yourself with dark energy, causing your attacks to have a chance to inflict {$215659s1=26007 to 28745} additional Shadow damage and grant you a shield for {$215659s2=30418}. Lasts {$d=15 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:43412.05
  • base_dd_max:47981.74
 
Greed 15091 (22639) 3.6% (5.4%) 32.0 9.22sec 212262 0 Direct 32.0 96631 193261 141490 46.4% 0.0%  

Stats details: greed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.02 32.02 0.00 0.00 0.0000 0.0000 4531252.28 6661370.06 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.16 53.57% 96630.60 96631 96631 96630.60 96631 96631 1657900 2437270 31.98
crit 14.87 46.43% 193261.20 193261 193261 193261.20 193261 193261 2873353 4224100 31.98
 
 

Action details: greed

Static Values
  • id:202822
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202822
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
    Greed (_oh) 7548 1.8% 32.0 9.22sec 70773 0 Direct 32.0 48315 96631 70773 46.5% 0.0%  

Stats details: greed_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.02 32.02 0.00 0.00 0.0000 0.0000 2266386.40 3331802.69 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.14 53.52% 48315.30 48315 48315 48315.30 48315 48315 828061 1217328 31.98
crit 14.88 46.48% 96630.60 96631 96631 96630.60 96631 96631 1438326 2114475 31.98
 
 

Action details: greed_oh

Static Values
  • id:202823
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202823
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Main Gauche 31416 7.5% 171.0 1.76sec 55181 0 Direct 171.0 37688 75376 55180 46.4% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 170.97 170.97 0.00 0.00 0.0000 0.0000 9434164.53 13869115.48 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.61 53.58% 37687.91 37688 37688 37687.91 37688 37688 3452638 5075704 31.98
crit 79.36 46.42% 75375.82 75376 75376 75375.82 75376 75376 5981527 8793411 31.98
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Mark of the Hidden Satyr 5227 1.3% 20.4 14.55sec 77085 0 Direct 20.4 52626 105252 77083 46.5% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.37 20.37 0.00 0.00 0.0000 0.0000 1570075.77 1570075.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.90 53.52% 52625.92 52626 52626 52625.93 52626 52626 573713 573713 0.00
crit 9.47 46.48% 105251.85 105252 105252 105251.85 105252 105252 996363 996363 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Pistol Shot 12092 (30838) 2.9% (7.4%) 28.1 9.92sec 330581 218013 Direct 28.1 78945 157889 129664 64.2% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.06 28.06 0.00 0.00 1.5164 0.0000 3637712.63 5347782.14 31.98 218013.49 218013.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.03 35.75% 78944.54 78945 78945 78934.01 0 78945 791898 1164165 31.97
crit 18.02 64.25% 157889.08 157889 157889 157889.08 157889 157889 2845814 4183617 31.98
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&(energy.time_to_max>2-talent.quick_draw.enabled|(buff.blunderbuss.up&buff.greenskins_waterlogged_wristcuffs.up))
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$s1=0} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
    Blunderbuss 18747 4.5% 17.0 16.36sec 332419 0 Direct 67.8 50619 101353 83121 64.1% 0.0%  

Stats details: blunderbuss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.96 67.81 0.00 0.00 0.0000 0.0000 5636799.16 8286628.69 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.37 35.93% 50619.27 28946 57893 50628.35 34736 57893 1233514 1813382 31.98
crit 43.44 64.07% 101353.46 57893 115785 101337.36 84208 111926 4403286 6473247 31.98
 
 

Action details: blunderbuss

Static Values
  • id:202895
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202895
  • name:Blunderbuss
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draws a concealed blunderbuss and fires a quick shot at the target, dealing ${$m1*7} damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Potion of the Old War 17025 4.0% 27.9 4.12sec 180598 0 Direct 27.9 122869 245738 180598 47.0% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.86 27.86 0.00 0.00 0.0000 0.0000 5031061.97 7396137.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.77 53.02% 122869.08 122869 122869 122869.08 122869 122869 1814674 2667743 31.98
crit 13.09 46.98% 245738.16 245738 245738 245738.16 245738 245738 3216388 4728395 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Run Through 168082 40.3% 91.4 3.27sec 552295 603462 Direct 91.4 377293 754524 552298 46.4% 0.0%  

Stats details: run_through

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.40 91.40 0.00 0.00 0.9152 0.0000 50479571.64 74209751.86 31.98 603461.71 603461.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.00 53.61% 377293.10 323848 388618 377396.22 357158 388618 18486442 27176821 31.98
crit 42.40 46.39% 754523.61 647696 777235 754993.54 712466 777235 31993130 47032931 31.98
 
 

Action details: run_through

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Run Through
  • school:physical
  • tooltip:Rooted.
  • description:Lunging finishing move that causes damage per combo point and has increased range: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
 
Saber Slash 92075 22.1% 197.0 1.53sec 140348 219705 Direct 197.0 95885 191770 140346 46.4% 0.0%  

Stats details: saber_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 197.01 197.01 0.00 0.00 0.6388 0.0000 27650371.31 40648664.94 31.98 219705.46 219705.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.66 53.63% 95885.16 95885 95885 95885.16 95885 95885 10130915 14893405 31.98
crit 91.36 46.37% 191770.33 191770 191770 191770.33 191770 191770 17519456 25755260 31.98
 
 

Action details: saber_slash

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.ss_useable
Spelldata
  • id:193315
  • name:Saber Slash
  • school:physical
  • tooltip:
  • description:Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.02
 
Simple Action Stats Execute Interval
Rogue_Outlaw_T19M
Adrenaline Rush 6.5 46.51sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:155.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.adrenaline_rush.up&energy.deficit>0
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:false
  • if_expr:
 
Curse of the Dreadblades 3.9 86.98sec

Stats details: curse_of_the_dreadblades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: curse_of_the_dreadblades

Static Values
  • id:202665
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
Spelldata
  • id:202665
  • name:Curse of the Dreadblades
  • school:shadow
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
 
Darkstrikes (_absorb) 36.6 7.75sec

Stats details: darkstrikes_absorb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 36.58 36.58 0.00 0.00 0.0000 0.0000 0.00 1974476.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.58 100.00% 0.00 0 0 0.00 0 0 0 1974477 100.00
 
 

Action details: darkstrikes_absorb

Static Values
  • id:215659
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:true
  • if_expr:
Spelldata
  • id:215659
  • name:Darkstrikes
  • school:shadow
  • tooltip:Absorbs up to $w2 damage.
  • description:{$@spelldesc215658=Empower yourself with dark energy, causing your attacks to have a chance to inflict {$215659s1=26007 to 28745} additional Shadow damage and grant you a shield for {$215659s2=30418}. Lasts {$d=15 seconds}.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:50774.29
  • base_dd_max:50774.29
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:false
  • if_expr:
 
Marked for Death 15.0 18.86sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.02 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:raid_event.adds.in>40
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=5} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 12.2 25.11sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.21 0.00 0.00 0.00 0.8704 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.slice_and_dice.enabled
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Shadowmeld 2.4 139.48sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.stealth_condition
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Vanish 5.3 52.86sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:variable.stealth_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 6.5 0.0 47.0sec 47.0sec 31.79% 30.05% 0.0(0.0) 6.2

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:31.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 102.6 0.0sec 2.9sec 100.00% 100.00% 86.4(100.1) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_alacrity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • alacrity_1:0.34%
  • alacrity_2:0.44%
  • alacrity_3:0.46%
  • alacrity_4:0.45%
  • alacrity_5:0.42%
  • alacrity_6:0.41%
  • alacrity_7:0.43%
  • alacrity_8:0.45%
  • alacrity_9:0.48%
  • alacrity_10:0.59%
  • alacrity_11:0.75%
  • alacrity_12:0.90%
  • alacrity_13:0.97%
  • alacrity_14:0.95%
  • alacrity_15:0.94%
  • alacrity_16:0.93%
  • alacrity_17:0.96%
  • alacrity_18:0.99%
  • alacrity_19:0.99%
  • alacrity_20:87.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=1}% for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blood Frenzy 10.7 6.6 28.4sec 17.0sec 45.14% 45.14% 6.6(6.6) 10.2

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 21.21% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blunderbuss 17.6 2.3 16.5sec 14.5sec 13.67% 37.77% 2.3(2.3) 0.5

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_blunderbuss
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:33.00%
  • default_value:-0.00

Stack Uptimes

  • blunderbuss_1:13.67%

Trigger Attempt Success

  • trigger_pct:32.92%

Spelldata details

  • id:202848
  • name:Blunderbuss
  • tooltip:
  • description:{$@spelldesc202897=When Saber Slash strikes an additional time, there is a {$s2=33}% chance that your next Pistol Shot will be replaced with Blunderbuss. |Tinterface\icons\inv_weapon_rifle_07.blp:24|t |cFFFFFFFFBlunderbuss|r {$@spelldesc202895=Draws a concealed blunderbuss and fires a quick shot at the target, dealing ${$m1*7} damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Blurred Time 6.5 0.0 47.0sec 47.0sec 31.79% 30.17% 0.0(0.0) 6.2

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_blurred_time
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • blurred_time_1:31.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202776
  • name:Blurred Time
  • tooltip:Ability cooldowns are recovering {$s1=15}% faster.
  • description:{$@spelldesc202769=During Adrenaline Rush, your ability cooldowns recover {$202776s1=15}% faster.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Broadsides 3.1 0.0 66.6sec 65.1sec 28.46% 25.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_broadsides
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • broadsides_1:28.46%

Trigger Attempt Success

  • trigger_pct:96.21%

Spelldata details

  • id:193356
  • name:Broadsides
  • tooltip:Your attacks generate {$s1=1} additional combo point.
  • description:Your combo-generating abilities generate {$s1=1} additional combo point for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 3.1 0.0 67.1sec 65.6sec 28.35% 26.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • buried_treasure_1:28.35%

Trigger Attempt Success

  • trigger_pct:96.28%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by {$s1=25}%.
  • description:Your base Energy regeneration is increased by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Curse of the Dreadblades 3.9 0.0 86.8sec 87.0sec 15.43% 13.72% 0.0(0.0) 3.8

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_curse_of_the_dreadblades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • curse_of_the_dreadblades_1:15.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202665
  • name:Curse of the Dreadblades
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:101.00%
Darkstrikes 4.5 0.0 76.1sec 76.1sec 21.98% 21.98% 0.0(0.0) 4.3

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_darkstrikes
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • darkstrikes_1:21.98%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:215658
  • name:Darkstrikes
  • tooltip:Your attacks have a chance to deal {$215659s1=26007 to 28745} additional Shadow damage and grant you an absorption shield for {$215659s2=30418}.
  • description:Empower yourself with dark energy, causing your attacks to have a chance to inflict {$215659s1=26007 to 28745} additional Shadow damage and grant you a shield for {$215659s2=30418}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:75.00
  • default_chance:101.00%
Darkstrikes (_absorb) 4.5 32.1 76.1sec 7.7sec 33.31% 33.31% 32.1(32.1) 4.1

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_darkstrikes_absorb
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:30418.02

Stack Uptimes

  • darkstrikes_absorb_1:33.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215659
  • name:Darkstrikes
  • tooltip:Absorbs up to $w2 damage.
  • description:{$@spelldesc215658=Empower yourself with dark energy, causing your attacks to have a chance to inflict {$215659s1=26007 to 28745} additional Shadow damage and grant you a shield for {$215659s2=30418}. Lasts {$d=15 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Grand Melee 3.1 0.0 67.4sec 65.9sec 28.50% 27.29% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.67

Stack Uptimes

  • grand_melee_1:28.50%

Trigger Attempt Success

  • trigger_pct:96.55%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=50}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=50}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hidden Blade 5.3 0.0 53.2sec 53.2sec 2.76% 4.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_hidden_blade
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hidden_blade_1:2.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202754
  • name:Hidden Blade
  • tooltip:Your next Saber Slash has 100% chance to strike a second time.
  • description:{$@spelldesc202753=Successfully using Ambush guarantees your next Saber Slash will strike an additional time.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Jolly Roger 3.1 0.0 67.4sec 65.7sec 28.41% 27.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_jolly_roger
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • jolly_roger_1:28.41%

Trigger Attempt Success

  • trigger_pct:96.35%

Spelldata details

  • id:199603
  • name:Jolly Roger
  • tooltip:Saber Slash has an additional {$s1=25}% chance of striking an additional time.
  • description:Causes Saber Slash to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Opportunity 45.4 11.7 6.6sec 5.2sec 35.81% 100.00% 11.7(11.7) 0.1

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • opportunity_1:35.81%

Trigger Attempt Success

  • trigger_pct:41.92%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot is free.
  • description:{$@spelldesc193315=Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 85.7sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Roll the Bones 2.1 10.1 124.7sec 25.0sec 99.60% 99.60% 10.1(10.1) 1.1

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roll_the_bones_1:99.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 2.4 0.0 139.5sec 139.5sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Shark Infested Waters 3.1 0.0 69.7sec 67.7sec 30.52% 45.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_shark_infested_waters
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shark_infested_waters_1:30.52%

Trigger Attempt Success

  • trigger_pct:97.03%

Spelldata details

  • id:193357
  • name:Shark Infested Waters
  • tooltip:Critical Strike chance increased by {$s1=25}%.
  • description:Increases Critical Strike chance by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
True Bearing 3.1 0.0 76.3sec 75.6sec 43.89% 46.65% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • true_bearing_1:43.89%

Trigger Attempt Success

  • trigger_pct:98.16%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishers reduce the remaining cooldown on many of your abilities by {$s1=2} sec per combo point.
  • description:For the duration of Roll the Bones, each time you use a finishing move, you reduce the remaining cooldown on Adrenaline Rush, Sprint, Between the Eyes, Vanish, Blind, Cloak of Shadows, Riposte, Grappling Hook, Cannonball Barrage, Killing Spree, Marked for Death, and Death from Above by {$s1=2} sec per combo point spent.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 5.3 0.0 53.2sec 53.2sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Outlaw_T19M
ambush Energy 5.3 319.2 60.0 60.0 3001.7
roll_the_bones Energy 12.2 145.7 11.9 11.9 0.0
roll_the_bones Combo Points 12.2 68.1 5.6 5.6 0.0
run_through Energy 91.4 2102.2 23.0 23.0 24012.5
run_through Combo Points 91.4 532.4 5.8 5.8 94814.6
saber_slash Energy 197.0 6827.2 34.7 34.7 4050.0
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 15.03 72.58 (12.02%) 4.83 2.55 3.40%
pistol_shot Combo Points 28.05 28.05 (4.65%) 1.00 0.00 0.00%
blunderbuss Combo Points 16.96 16.96 (2.81%) 1.00 0.00 0.00%
saber_slash Combo Points 197.02 179.69 (29.77%) 0.91 17.32 8.79%
adrenaline_rush Energy 313.31 1524.03 (16.33%) 4.86 223.75 12.80%
ambush Combo Points 5.32 10.64 (1.76%) 2.00 0.00 0.00%
energy_regen Energy 1050.37 5311.21 (56.90%) 5.06 174.17 3.18%
combat_potency Energy 141.53 2499.79 (26.78%) 17.66 47.72 1.87%
Quick Draw Combo Points 45.01 38.34 (6.35%) 0.85 6.68 14.83%
Broadsides Combo Points 63.19 54.12 (8.96%) 0.86 9.08 14.36%
Ruthlessness Combo Points 103.61 120.16 (19.90%) 1.16 0.00 0.00%
Curse of the Dreadblades Combo Points 24.82 83.12 (13.77%) 3.35 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 31.06 31.26
Combo Points 2.01 2.00
Combat End Resource Mean Min Max
Energy 40.66 0.00 100.00
Combo Points 3.13 1.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.5%

Procs

Count Interval
Roll the Bones: 1 buff 7.2 35.9sec
Roll the Bones: 2 buffs 4.4 62.1sec
Roll the Bones: 3 buffs 0.5 111.3sec
Roll the Bones: 6 buffs 0.2 112.9sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Outlaw_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Rogue_Outlaw_T19M Damage Per Second
Count 7499
Mean 417156.61
Minimum 330021.82
Maximum 559863.25
Spread ( max - min ) 229841.43
Range [ ( max - min ) / 2 * 100% ] 27.55%
Standard Deviation 27537.8286
5th Percentile 377637.27
95th Percentile 467149.23
( 95th Percentile - 5th Percentile ) 89511.96
Mean Distribution
Standard Deviation 318.0007
95.00% Confidence Intervall ( 416533.34 - 417779.88 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 167
0.1% Error 16740
0.1 Scale Factor Error with Delta=300 6473558
0.05 Scale Factor Error with Delta=300 25894232
0.01 Scale Factor Error with Delta=300 647355813
Priority Target DPS
Sample Data Rogue_Outlaw_T19M Priority Target Damage Per Second
Count 7499
Mean 417156.61
Minimum 330021.82
Maximum 559863.25
Spread ( max - min ) 229841.43
Range [ ( max - min ) / 2 * 100% ] 27.55%
Standard Deviation 27537.8286
5th Percentile 377637.27
95th Percentile 467149.23
( 95th Percentile - 5th Percentile ) 89511.96
Mean Distribution
Standard Deviation 318.0007
95.00% Confidence Intervall ( 416533.34 - 417779.88 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 167
0.1% Error 16740
0.1 Scale Factor Error with Delta=300 6473558
0.05 Scale Factor Error with Delta=300 25894232
0.01 Scale Factor Error with Delta=300 647355813
DPS(e)
Sample Data Rogue_Outlaw_T19M Damage Per Second (Effective)
Count 7499
Mean 417156.61
Minimum 330021.82
Maximum 559863.25
Spread ( max - min ) 229841.43
Range [ ( max - min ) / 2 * 100% ] 27.55%
Damage
Sample Data Rogue_Outlaw_T19M Damage
Count 7499
Mean 125200081.40
Minimum 83779821.10
Maximum 180726754.09
Spread ( max - min ) 96946933.00
Range [ ( max - min ) / 2 * 100% ] 38.72%
DTPS
Sample Data Rogue_Outlaw_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Outlaw_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Outlaw_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Outlaw_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Outlaw_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Outlaw_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Outlaw_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Outlaw_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 roll_the_bones,if=!talent.slice_and_dice.enabled
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
0.00 variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
0.00 variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
8 0.00 call_action_list,name=bf
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
0.00 death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
0.00 slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
B 11.21 roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
0.00 killing_spree,if=energy.time_to_max>5|energy<15
C 0.00 call_action_list,name=build
D 0.00 call_action_list,name=finish,if=!variable.ss_useable
0.00 gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1
actions.build
# count action,conditions
0.00 ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
E 45.01 pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&(energy.time_to_max>2-talent.quick_draw.enabled|(buff.blunderbuss.up&buff.greenskins_waterlogged_wristcuffs.up))
F 136.54 saber_slash,if=variable.ss_useable
actions.cds
# count action,conditions
G 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
H 4.46 use_item,slot=trinket2,if=buff.bloodlust.react|target.time_to_die<=20|combo_points.deficit<=2
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=energy.deficit>40
0.00 cannonball_barrage,if=spell_targets.cannonball_barrage>=1
I 6.47 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
J 14.03 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
0.00 sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
K 3.94 curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
actions.finish
# count action,conditions
0.00 between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&!buff.greenskins_waterlogged_wristcuffs.up
L 91.40 run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5
actions.stealth
# count action,conditions
0.00 variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
M 5.32 ambush
N 5.32 vanish,if=variable.stealth_condition
O 2.38 shadowmeld,if=variable.stealth_condition

Sample Sequence

0124567KFHILFLELFLJLFLFLFLJLFFELFIELFFLJLFFELFFLFELJLFFLEFFBEFLEFFLFELFELFELFFELFJLFELFIGELFFELFFEHBNMFLOFFLEFLKFLFLFLELFLFFLFFLFFLEFLFFLFFBJLFLEFLFFLEFLJLEIFLNMELFLJLFLFEHLFFLJBFFLEFLEFLFFLEFLKFLFLFLFLFFLNMFLEFLEFBIFFELOFFFFFLFFFFFLJLEFFFLFFHFFLFFFEBFEFLFEFLFEFLFEFLFFELKFLFLFLFLFLFLFFFFFLJBFELFELFFFELFE

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Outlaw_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Outlaw_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Outlaw_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
Pre marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points stealth, potion_of_the_old_war
Pre roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:00.000 curse_of_the_dreadblades Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:00.000 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, alacrity, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:01.004 use_item_tirathons_betrayal Fluffy_Pillow 69.0/100: 69% energy | 6.0/6: 100% combo_points bloodlust, alacrity, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:01.004 adrenaline_rush Fluffy_Pillow 69.0/100: 69% energy | 6.0/6: 100% combo_points bloodlust, alacrity, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:01.004 run_through Fluffy_Pillow 69.0/100: 69% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:01.809 saber_slash Fluffy_Pillow 76.8/100: 77% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, alacrity(2), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:02.614 run_through Fluffy_Pillow 57.7/100: 58% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(2), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:03.419 pistol_shot Fluffy_Pillow 65.8/100: 66% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(3), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:04.224 run_through Fluffy_Pillow 96.9/100: 97% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity(3), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:05.028 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, alacrity(4), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:05.833 run_through Fluffy_Pillow 81.4/100: 81% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(4), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:06.637 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(6), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:06.637 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(6), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:07.442 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), roll_the_bones, curse_of_the_dreadblades, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:08.248 run_through Fluffy_Pillow 82.4/100: 82% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:09.054 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:09.858 run_through Fluffy_Pillow 82.6/100: 83% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:10.664 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:11.467 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:12.273 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(11), roll_the_bones, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:12.273 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(11), roll_the_bones, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:13.080 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(13), roll_the_bones, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:13.885 saber_slash Fluffy_Pillow 84.1/100: 84% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(13), roll_the_bones, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:14.689 pistol_shot Fluffy_Pillow 68.2/100: 68% energy | 3.0/6: 50% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(13), roll_the_bones, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:15.494 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, alacrity(13), roll_the_bones, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:16.300 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, alacrity(14), roll_the_bones, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:17.304 adrenaline_rush Fluffy_Pillow 71.5/100: 71% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(14), roll_the_bones, blunderbuss, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:17.304 pistol_shot Fluffy_Pillow 71.5/100: 71% energy | 3.0/6: 50% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(14), roll_the_bones, blurred_time, blunderbuss, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
0:18.107 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, alacrity(14), roll_the_bones, blurred_time, potion_of_the_old_war, darkstrikes_absorb
0:18.913 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, alacrity(15), roll_the_bones, blurred_time, potion_of_the_old_war, darkstrikes_absorb
0:19.717 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(15), roll_the_bones, blurred_time, potion_of_the_old_war, darkstrikes_absorb
0:20.521 run_through Fluffy_Pillow 82.0/100: 82% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(15), roll_the_bones, blurred_time, potion_of_the_old_war, darkstrikes_absorb
0:21.327 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(16), roll_the_bones, blurred_time, potion_of_the_old_war, darkstrikes_absorb
0:21.467 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(16), roll_the_bones, blurred_time, potion_of_the_old_war, darkstrikes_absorb
0:22.271 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(17), roll_the_bones, blurred_time, potion_of_the_old_war, darkstrikes_absorb
0:23.074 saber_slash Fluffy_Pillow 82.5/100: 82% energy | 3.0/6: 50% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(17), roll_the_bones, blurred_time, darkstrikes_absorb
0:23.877 pistol_shot Fluffy_Pillow 65.0/100: 65% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(17), roll_the_bones, blurred_time, blunderbuss, darkstrikes_absorb
0:24.684 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity(17), roll_the_bones, blurred_time, darkstrikes_absorb
0:25.489 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, alacrity(18), roll_the_bones, blurred_time
0:26.293 saber_slash Fluffy_Pillow 82.8/100: 83% energy | 3.0/6: 50% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(18), roll_the_bones, blurred_time
0:27.097 run_through Fluffy_Pillow 83.6/100: 84% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(18), roll_the_bones, blurred_time
0:27.902 saber_slash Fluffy_Pillow 93.8/100: 94% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(19), roll_the_bones, blurred_time
0:28.706 pistol_shot Fluffy_Pillow 76.8/100: 77% energy | 3.0/6: 50% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(19), roll_the_bones, blurred_time, blunderbuss
0:29.509 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, alacrity(19), roll_the_bones, blurred_time
0:30.314 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, alacrity(20), roll_the_bones, blurred_time
0:30.314 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity(20), roll_the_bones, blurred_time
0:31.116 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, alacrity(20), roll_the_bones, blurred_time
0:31.919 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(20), roll_the_bones, blurred_time
0:32.724 run_through Fluffy_Pillow 74.7/100: 75% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(20), roll_the_bones, blunderbuss
0:33.731 pistol_shot Fluffy_Pillow 72.6/100: 73% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(20), roll_the_bones, blunderbuss
0:34.736 saber_slash Fluffy_Pillow 93.4/100: 93% energy | 3.0/6: 50% combo_points bloodlust, alacrity(20), roll_the_bones
0:35.741 saber_slash Fluffy_Pillow 82.3/100: 82% energy | 4.0/6: 67% combo_points bloodlust, alacrity(20), roll_the_bones
0:36.744 roll_the_bones Fluffy_Pillow 71.1/100: 71% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(20)
0:37.748 pistol_shot Fluffy_Pillow 78.9/100: 79% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:38.754 saber_slash Fluffy_Pillow 99.8/100: 100% energy | 3.0/6: 50% combo_points bloodlust, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:39.758 run_through Fluffy_Pillow 88.7/100: 89% energy | 5.0/6: 83% combo_points bloodlust, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blunderbuss
0:40.764 pistol_shot Fluffy_Pillow 82.4/100: 82% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blunderbuss
0:41.768 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:42.772 saber_slash Fluffy_Pillow 66.0/100: 66% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:43.775 run_through Fluffy_Pillow 50.0/100: 50% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:44.780 Waiting 0.500 sec 43.1/100: 43% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:45.280 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:46.284 pistol_shot Fluffy_Pillow 17.1/100: 17% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:47.289 run_through Fluffy_Pillow 33.1/100: 33% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:48.293 Waiting 1.500 sec 26.2/100: 26% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:49.793 saber_slash Fluffy_Pillow 50.1/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:50.799 pistol_shot Fluffy_Pillow 34.2/100: 34% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blunderbuss
0:51.803 run_through Fluffy_Pillow 50.2/100: 50% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:52.808 Waiting 0.500 sec 43.2/100: 43% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:53.308 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:54.313 pistol_shot Fluffy_Pillow 17.2/100: 17% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:55.316 run_through Fluffy_Pillow 51.3/100: 51% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
0:56.319 Waiting 0.300 sec 45.6/100: 46% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
0:56.619 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
0:57.624 Waiting 1.890 sec 18.2/100: 18% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
0:59.514 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:00.517 pistol_shot Fluffy_Pillow 36.3/100: 36% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:01.520 run_through Fluffy_Pillow 53.7/100: 54% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:02.526 saber_slash Fluffy_Pillow 66.1/100: 66% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:03.531 Waiting 0.100 sec 33.6/100: 34% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:03.631 marked_for_death Fluffy_Pillow 53.3/100: 53% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:03.845 run_through Fluffy_Pillow 57.0/100: 57% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:04.850 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:05.854 pistol_shot Fluffy_Pillow 54.1/100: 54% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:06.858 run_through Fluffy_Pillow 88.1/100: 88% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:07.861 saber_slash Fluffy_Pillow 81.1/100: 81% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:08.865 adrenaline_rush Fluffy_Pillow 47.1/100: 47% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:08.865 potion Fluffy_Pillow 47.1/100: 47% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time
1:08.865 pistol_shot Fluffy_Pillow 47.1/100: 47% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
1:09.669 run_through Fluffy_Pillow 90.8/100: 91% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
1:10.475 saber_slash Fluffy_Pillow 93.5/100: 94% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
1:11.280 saber_slash Fluffy_Pillow 87.2/100: 87% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
1:12.085 pistol_shot Fluffy_Pillow 62.9/100: 63% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
1:12.888 run_through Fluffy_Pillow 88.5/100: 89% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
1:13.691 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
1:14.496 saber_slash Fluffy_Pillow 93.7/100: 94% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:15.300 pistol_shot Fluffy_Pillow 69.4/100: 69% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:16.103 use_item_tirathons_betrayal Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
1:16.103 roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
1:16.908 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
1:16.908 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, vanish, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, potion_of_the_old_war, darkstrikes_absorb
1:17.913 saber_slash Fluffy_Pillow 72.6/100: 73% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, hidden_blade, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:18.717 run_through Fluffy_Pillow 68.5/100: 68% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:19.521 shadowmeld Fluffy_Pillow 73.3/100: 73% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:19.521 saber_slash Fluffy_Pillow 73.3/100: 73% energy | 2.0/6: 33% combo_points shadowmeld, adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:20.326 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:21.131 run_through Fluffy_Pillow 29.1/100: 29% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:21.936 pistol_shot Fluffy_Pillow 34.0/100: 34% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, blunderbuss, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:22.741 saber_slash Fluffy_Pillow 61.9/100: 62% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:23.546 run_through Fluffy_Pillow 57.8/100: 58% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:24.350 curse_of_the_dreadblades Fluffy_Pillow 54.2/100: 54% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:24.350 saber_slash Fluffy_Pillow 54.2/100: 54% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:25.356 run_through Fluffy_Pillow 39.6/100: 40% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:26.361 saber_slash Fluffy_Pillow 52.0/100: 52% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:27.366 Waiting 0.320 sec 19.4/100: 19% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:27.686 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:28.690 Waiting 0.800 sec 37.4/100: 37% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:29.490 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:30.495 run_through Fluffy_Pillow 36.7/100: 37% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:31.499 pistol_shot Fluffy_Pillow 31.0/100: 31% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:32.502 run_through Fluffy_Pillow 48.4/100: 48% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:33.507 saber_slash Fluffy_Pillow 60.8/100: 61% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war, darkstrikes_absorb
1:34.512 run_through Fluffy_Pillow 28.2/100: 28% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, darkstrikes_absorb
1:35.517 Waiting 1.636 sec 22.6/100: 23% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, darkstrikes_absorb
1:37.153 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, darkstrikes_absorb
1:38.158 Waiting 0.800 sec 36.4/100: 36% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, darkstrikes_absorb
1:38.958 saber_slash Fluffy_Pillow 50.2/100: 50% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, darkstrikes_absorb
1:39.962 run_through Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:40.969 Waiting 1.100 sec 30.1/100: 30% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:42.069 saber_slash Fluffy_Pillow 67.1/100: 67% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:43.073 saber_slash Fluffy_Pillow 52.5/100: 53% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:44.077 run_through Fluffy_Pillow 37.9/100: 38% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:45.083 Waiting 1.100 sec 32.3/100: 32% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:46.183 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:47.189 Waiting 0.800 sec 36.8/100: 37% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:47.989 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:48.993 run_through Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blunderbuss, blood_frenzy
1:49.997 pistol_shot Fluffy_Pillow 30.5/100: 30% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blunderbuss, blood_frenzy
1:51.001 saber_slash Fluffy_Pillow 65.9/100: 66% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:52.004 run_through Fluffy_Pillow 51.2/100: 51% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:53.009 Waiting 0.300 sec 45.6/100: 46% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:53.309 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:54.314 Waiting 1.889 sec 18.2/100: 18% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:56.203 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:57.206 run_through Fluffy_Pillow 36.3/100: 36% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:58.209 Waiting 0.100 sec 30.7/100: 31% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:58.309 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:59.313 Waiting 0.952 sec 17.8/100: 18% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
2:00.265 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
2:01.271 roll_the_bones Fluffy_Pillow 35.0/100: 35% energy | 5.0/6: 83% combo_points alacrity(20)
2:02.276 marked_for_death Fluffy_Pillow 38.1/100: 38% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
2:02.276 run_through Fluffy_Pillow 38.1/100: 38% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
2:03.281 Waiting 0.100 sec 49.1/100: 49% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
2:03.381 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
2:04.385 Waiting 0.517 sec 16.7/100: 17% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blunderbuss
2:04.902 run_through Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blunderbuss
2:05.907 pistol_shot Fluffy_Pillow 36.0/100: 36% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blunderbuss
2:06.912 saber_slash Fluffy_Pillow 52.1/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
2:07.916 Waiting 0.432 sec 18.1/100: 18% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
2:08.348 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
2:09.352 Waiting 1.424 sec 19.4/100: 19% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:10.776 saber_slash Fluffy_Pillow 62.0/100: 62% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:11.781 Waiting 1.200 sec 29.5/100: 29% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:12.981 saber_slash Fluffy_Pillow 50.2/100: 50% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:13.986 Waiting 0.424 sec 17.7/100: 18% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:14.410 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:15.414 pistol_shot Fluffy_Pillow 19.4/100: 19% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:16.419 Waiting 0.800 sec 36.8/100: 37% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:17.219 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:18.224 run_through Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blood_frenzy
2:19.228 marked_for_death Fluffy_Pillow 29.3/100: 29% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones
2:19.228 run_through Fluffy_Pillow 29.3/100: 29% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones
2:20.232 pistol_shot Fluffy_Pillow 40.3/100: 40% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones
2:21.235 adrenaline_rush Fluffy_Pillow 56.3/100: 56% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
2:21.235 saber_slash Fluffy_Pillow 56.3/100: 56% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:22.039 run_through Fluffy_Pillow 50.0/100: 50% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:22.842 vanish Fluffy_Pillow 70.6/100: 71% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:22.842 ambush Fluffy_Pillow 70.6/100: 71% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, vanish, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:23.846 pistol_shot Fluffy_Pillow 60.6/100: 61% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time
2:24.650 run_through Fluffy_Pillow 86.3/100: 86% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time
2:25.454 saber_slash Fluffy_Pillow 89.0/100: 89% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade, blurred_time
2:26.258 run_through Fluffy_Pillow 64.6/100: 65% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:27.064 marked_for_death Fluffy_Pillow 67.4/100: 67% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:27.064 run_through Fluffy_Pillow 67.4/100: 67% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:27.868 saber_slash Fluffy_Pillow 70.0/100: 70% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:28.672 run_through Fluffy_Pillow 63.7/100: 64% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:29.477 saber_slash Fluffy_Pillow 84.4/100: 84% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:30.281 pistol_shot Fluffy_Pillow 78.1/100: 78% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:31.087 use_item_tirathons_betrayal Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:31.103 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time
2:31.908 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:32.712 saber_slash Fluffy_Pillow 75.7/100: 76% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:33.518 run_through Fluffy_Pillow 69.4/100: 69% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:34.321 marked_for_death Fluffy_Pillow 72.0/100: 72% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:34.321 roll_the_bones Fluffy_Pillow 72.0/100: 72% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:35.126 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, darkstrikes_absorb
2:35.930 saber_slash Fluffy_Pillow 93.8/100: 94% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blurred_time, darkstrikes, blood_frenzy, darkstrikes_absorb
2:36.733 run_through Fluffy_Pillow 63.0/100: 63% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:37.738 pistol_shot Fluffy_Pillow 57.4/100: 57% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:38.741 saber_slash Fluffy_Pillow 74.8/100: 75% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:39.747 run_through Fluffy_Pillow 42.2/100: 42% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:40.752 pistol_shot Fluffy_Pillow 36.7/100: 37% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:41.756 saber_slash Fluffy_Pillow 54.0/100: 54% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:42.760 run_through Fluffy_Pillow 39.4/100: 39% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:43.764 saber_slash Fluffy_Pillow 51.8/100: 52% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:44.769 Waiting 0.800 sec 37.2/100: 37% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:45.569 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
2:46.575 run_through Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes_absorb
2:47.579 pistol_shot Fluffy_Pillow 28.6/100: 29% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes_absorb
2:48.582 saber_slash Fluffy_Pillow 62.6/100: 63% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes_absorb
2:49.589 run_through Fluffy_Pillow 28.7/100: 29% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes_absorb
2:50.592 Waiting 0.908 sec 21.7/100: 22% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes_absorb
2:51.500 curse_of_the_dreadblades Fluffy_Pillow 36.2/100: 36% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, darkstrikes_absorb
2:51.702 saber_slash Fluffy_Pillow 57.4/100: 57% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes_absorb
2:52.707 run_through Fluffy_Pillow 23.4/100: 23% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes_absorb
2:53.711 Waiting 1.000 sec 34.5/100: 34% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes_absorb
2:54.711 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, darkstrikes_absorb
2:55.715 run_through Fluffy_Pillow 34.4/100: 34% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
2:56.720 Waiting 1.500 sec 27.5/100: 27% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
2:58.220 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
2:59.224 Waiting 0.472 sec 17.5/100: 17% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
2:59.696 run_through Fluffy_Pillow 43.0/100: 43% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
3:00.701 Waiting 0.900 sec 36.0/100: 36% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
3:01.601 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
3:02.604 run_through Fluffy_Pillow 35.8/100: 36% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:03.608 Waiting 1.200 sec 30.2/100: 30% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:04.808 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:05.811 saber_slash Fluffy_Pillow 54.3/100: 54% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:06.815 run_through Fluffy_Pillow 39.7/100: 40% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:07.820 Waiting 0.800 sec 34.1/100: 34% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:08.620 vanish Fluffy_Pillow 66.0/100: 66% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:08.620 ambush Fluffy_Pillow 66.0/100: 66% energy | 1.0/6: 17% combo_points vanish, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:09.624 Waiting 1.600 sec 23.4/100: 23% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, hidden_blade, blood_frenzy
3:11.224 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, hidden_blade, blood_frenzy
3:12.228 run_through Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blunderbuss
3:13.230 pistol_shot Fluffy_Pillow 30.0/100: 30% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blunderbuss, blood_frenzy
3:14.236 Waiting 0.200 sec 47.4/100: 47% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:14.436 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:15.440 run_through Fluffy_Pillow 36.3/100: 36% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blunderbuss, blood_frenzy
3:16.444 pistol_shot Fluffy_Pillow 30.7/100: 31% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blunderbuss, blood_frenzy
3:17.449 Waiting 0.200 sec 48.1/100: 48% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:17.649 saber_slash Fluffy_Pillow 51.5/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:18.652 roll_the_bones Fluffy_Pillow 18.9/100: 19% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:19.658 adrenaline_rush Fluffy_Pillow 23.3/100: 23% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
3:19.658 Waiting 0.800 sec 23.3/100: 23% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time, blood_frenzy
3:20.458 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time, blood_frenzy
3:21.262 Waiting 0.100 sec 46.9/100: 47% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time, blood_frenzy
3:21.362 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time, blood_frenzy
3:22.165 pistol_shot Fluffy_Pillow 28.2/100: 28% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time, blood_frenzy
3:22.969 run_through Fluffy_Pillow 74.0/100: 74% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time, blood_frenzy
3:23.773 shadowmeld Fluffy_Pillow 78.9/100: 79% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time, blood_frenzy
3:23.773 saber_slash Fluffy_Pillow 78.9/100: 79% energy | 1.0/6: 17% combo_points shadowmeld, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time, blood_frenzy
3:24.578 saber_slash Fluffy_Pillow 73.4/100: 73% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:25.383 Waiting 0.100 sec 49.1/100: 49% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:25.483 saber_slash Fluffy_Pillow 52.3/100: 52% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:26.286 Waiting 0.700 sec 27.9/100: 28% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:26.986 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:27.792 Waiting 0.800 sec 26.0/100: 26% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:28.592 saber_slash Fluffy_Pillow 51.5/100: 52% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:29.396 run_through Fluffy_Pillow 63.2/100: 63% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:30.201 saber_slash Fluffy_Pillow 83.9/100: 84% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:31.006 saber_slash Fluffy_Pillow 59.6/100: 60% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:31.811 Waiting 0.100 sec 35.3/100: 35% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:31.911 saber_slash Fluffy_Pillow 56.5/100: 56% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:32.716 Waiting 0.600 sec 32.2/100: 32% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:33.316 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:34.119 Waiting 0.200 sec 45.0/100: 45% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:34.319 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blurred_time
3:35.126 Waiting 0.334 sec 19.7/100: 20% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blunderbuss
3:35.460 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blunderbuss
3:36.463 marked_for_death Fluffy_Pillow 18.0/100: 18% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blunderbuss
3:36.463 Waiting 0.438 sec 18.0/100: 18% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blunderbuss
3:36.901 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blunderbuss
3:37.905 pistol_shot Fluffy_Pillow 18.0/100: 18% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blunderbuss
3:38.910 Waiting 0.300 sec 34.1/100: 34% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:39.210 saber_slash Fluffy_Pillow 56.8/100: 57% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:40.214 Waiting 0.633 sec 22.9/100: 23% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:40.847 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:41.851 Waiting 0.600 sec 35.0/100: 35% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:42.451 saber_slash Fluffy_Pillow 62.6/100: 63% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:43.456 run_through Fluffy_Pillow 46.6/100: 47% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:44.461 Waiting 0.600 sec 39.7/100: 40% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:45.061 saber_slash Fluffy_Pillow 67.2/100: 67% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:46.066 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:47.070 use_item_tirathons_betrayal Fluffy_Pillow 17.3/100: 17% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:47.070 Waiting 1.882 sec 17.3/100: 17% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
3:48.952 saber_slash Fluffy_Pillow 66.3/100: 66% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:49.957 Waiting 0.800 sec 33.7/100: 34% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:50.757 saber_slash Fluffy_Pillow 65.5/100: 66% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:51.763 run_through Fluffy_Pillow 33.0/100: 33% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:52.767 Waiting 0.300 sec 45.4/100: 45% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:53.067 saber_slash Fluffy_Pillow 50.6/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:54.071 Waiting 0.906 sec 18.0/100: 18% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:54.977 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:55.979 Waiting 0.800 sec 37.0/100: 37% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:56.779 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:57.784 pistol_shot Fluffy_Pillow 18.3/100: 18% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blunderbuss, darkstrikes, blood_frenzy, darkstrikes_absorb
3:58.788 roll_the_bones Fluffy_Pillow 53.7/100: 54% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
3:59.792 saber_slash Fluffy_Pillow 80.4/100: 80% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
4:00.795 pistol_shot Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
4:01.802 saber_slash Fluffy_Pillow 73.9/100: 74% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, darkstrikes, blood_frenzy, darkstrikes_absorb
4:02.807 run_through Fluffy_Pillow 81.7/100: 82% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy, darkstrikes_absorb
4:03.811 saber_slash Fluffy_Pillow 80.4/100: 80% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy, darkstrikes_absorb
4:04.816 pistol_shot Fluffy_Pillow 52.2/100: 52% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy, darkstrikes_absorb
4:05.819 saber_slash Fluffy_Pillow 91.9/100: 92% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy, darkstrikes_absorb
4:06.822 run_through Fluffy_Pillow 81.6/100: 82% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy, darkstrikes_absorb
4:07.827 saber_slash Fluffy_Pillow 98.4/100: 98% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy, darkstrikes_absorb
4:08.832 pistol_shot Fluffy_Pillow 70.1/100: 70% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy, darkstrikes_absorb
4:09.837 saber_slash Fluffy_Pillow 91.9/100: 92% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy, darkstrikes_absorb
4:10.842 run_through Fluffy_Pillow 81.7/100: 82% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy, darkstrikes_absorb
4:11.846 saber_slash Fluffy_Pillow 98.4/100: 98% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy, darkstrikes_absorb
4:12.849 pistol_shot Fluffy_Pillow 70.1/100: 70% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:13.853 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:14.857 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:15.862 saber_slash Fluffy_Pillow 98.8/100: 99% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:16.868 saber_slash Fluffy_Pillow 88.5/100: 89% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:17.873 pistol_shot Fluffy_Pillow 60.3/100: 60% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:18.879 run_through Fluffy_Pillow 82.1/100: 82% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:19.883 curse_of_the_dreadblades Fluffy_Pillow 98.8/100: 99% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:19.883 saber_slash Fluffy_Pillow 98.8/100: 99% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:20.885 run_through Fluffy_Pillow 70.5/100: 71% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:21.889 saber_slash Fluffy_Pillow 69.3/100: 69% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:22.894 run_through Fluffy_Pillow 59.0/100: 59% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:23.899 saber_slash Fluffy_Pillow 57.8/100: 58% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:24.905 run_through Fluffy_Pillow 29.6/100: 30% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:25.909 Waiting 0.200 sec 46.3/100: 46% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:26.109 saber_slash Fluffy_Pillow 68.6/100: 69% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:27.113 run_through Fluffy_Pillow 58.4/100: 58% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:28.117 saber_slash Fluffy_Pillow 75.1/100: 75% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:29.120 run_through Fluffy_Pillow 46.8/100: 47% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:30.125 Waiting 0.200 sec 45.6/100: 46% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:30.325 saber_slash Fluffy_Pillow 67.9/100: 68% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:31.329 run_through Fluffy_Pillow 57.7/100: 58% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:32.334 saber_slash Fluffy_Pillow 56.4/100: 56% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:33.340 Waiting 0.200 sec 46.2/100: 46% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:33.540 saber_slash Fluffy_Pillow 50.5/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:34.545 Waiting 1.459 sec 21.8/100: 22% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones
4:36.004 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones
4:37.007 Waiting 0.600 sec 38.9/100: 39% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones
4:37.607 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones
4:38.613 saber_slash Fluffy_Pillow 58.7/100: 59% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:39.618 run_through Fluffy_Pillow 66.4/100: 66% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:40.621 marked_for_death Fluffy_Pillow 65.2/100: 65% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:40.621 roll_the_bones Fluffy_Pillow 65.2/100: 65% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:41.627 saber_slash Fluffy_Pillow 69.6/100: 70% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:42.631 pistol_shot Fluffy_Pillow 55.0/100: 55% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, roll_the_bones, blunderbuss, blood_frenzy
4:43.634 run_through Fluffy_Pillow 90.4/100: 90% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:44.639 saber_slash Fluffy_Pillow 84.8/100: 85% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:45.643 pistol_shot Fluffy_Pillow 52.2/100: 52% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, roll_the_bones, blunderbuss, blood_frenzy
4:46.646 run_through Fluffy_Pillow 69.5/100: 70% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:47.649 saber_slash Fluffy_Pillow 81.8/100: 82% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, roll_the_bones
4:48.653 Waiting 0.200 sec 47.9/100: 48% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, roll_the_bones
4:48.853 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, roll_the_bones
4:49.857 Waiting 1.000 sec 35.1/100: 35% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, roll_the_bones
4:50.857 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, roll_the_bones
4:51.862 pistol_shot Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, roll_the_bones, blunderbuss
4:52.867 run_through Fluffy_Pillow 51.1/100: 51% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, roll_the_bones
4:53.870 saber_slash Fluffy_Pillow 62.1/100: 62% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, roll_the_bones
4:54.875 pistol_shot Fluffy_Pillow 64.2/100: 64% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, roll_the_bones

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8802 8477 0
Agility 29404 27698 17346 (12223)
Stamina 41359 41359 25556
Intellect 5325 5000 0
Spirit 0 0 0
Health 2481540 2481540 0
Energy 100 100 0
Combo Points 6 6 0
Crit 38.86% 38.86% 8001
Haste 10.85% 10.85% 3525
Damage / Heal Versatility 6.31% 5.38% 2151
Attack Power 44106 41547 0
Mastery 47.15% 47.15% 4701
Armor 2236 2236 2236
Run Speed 9 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Scarred Ragefang Chestpiece
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +918 Mastery, +542 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Wristwraps of Broken Trust
ilevel: 880, stats: { 159 Armor, +1447 Sta, +965 AgiInt, +499 Mastery, +323 Crit }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Ascended Glory
ilevel: 885, stats: { +1516 Sta, +1136 Haste, +957 Crit }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Tirathon's Betrayal
ilevel: 865, stats: { +1418 Agi }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand The Dreadblades
ilevel: 906, weapon: { 5552 - 10313, 2.6 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand The Dreadblades
ilevel: 906, weapon: { 5552 - 10313, 2.6 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }

Talents

Level
15 Ghostly Strike (Outlaw Rogue) Swordmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue)
30 Grappling Hook (Outlaw Rogue) Acrobatic Strikes (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Deeper Stratagem Anticipation Vigor
60 Iron Stomach (Outlaw Rogue) Elusiveness Cheat Death
75 Parley (Outlaw Rogue) Prey on the Weak Dirty Tricks (Outlaw Rogue)
90 Cannonball Barrage (Outlaw Rogue) Alacrity Killing Spree (Outlaw Rogue)
100 Slice and Dice (Outlaw Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Outlaw_T19M"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3310022
artifact=44:0:0:0:0:1052:1:1053:1:1054:1:1055:1:1056:1:1057:1:1058:1:1059:3:1060:3:1061:3:1062:3:1063:3:1064:3:1065:3:1066:3:1067:3:1348:1
spec=outlaw

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,if=!talent.slice_and_dice.enabled

# Executed every time the actor is available.
actions=variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
actions+=/variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
actions+=/variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
actions+=/call_action_list,name=bf
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
actions+=/death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
actions+=/slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions+=/roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
actions+=/killing_spree,if=energy.time_to_max>5|energy<15
actions+=/call_action_list,name=build
actions+=/call_action_list,name=finish,if=!variable.ss_useable
actions+=/gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1

actions.bf=cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
actions.bf+=/blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up

actions.build=ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
actions.build+=/pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&(energy.time_to_max>2-talent.quick_draw.enabled|(buff.blunderbuss.up&buff.greenskins_waterlogged_wristcuffs.up))
actions.build+=/saber_slash,if=variable.ss_useable

actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
actions.cds+=/use_item,slot=trinket2,if=buff.bloodlust.react|target.time_to_die<=20|combo_points.deficit<=2
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/arcane_torrent,if=energy.deficit>40
actions.cds+=/cannonball_barrage,if=spell_targets.cannonball_barrage>=1
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.cds+=/sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
actions.cds+=/curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)

actions.finish=between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&!buff.greenskins_waterlogged_wristcuffs.up
actions.finish+=/run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5

actions.stealth=variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
actions.stealth+=/ambush
actions.stealth+=/vanish,if=variable.stealth_condition
actions.stealth+=/shadowmeld,if=variable.stealth_condition

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1806
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1806
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=ring_of_ascended_glory,id=142520,bonus_id=3469,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=tirathons_betrayal,id=137537,bonus_id=1517
main_hand=the_dreadblades,id=128872,bonus_id=742,gem_id=139260/139261/139262,relic_id=1806/1806/1806
off_hand=the_dreadblades,id=134552

# Gear Summary
# gear_ilvl=882.63
# gear_agility=17346
# gear_stamina=25556
# gear_crit_rating=8001
# gear_haste_rating=3525
# gear_mastery_rating=4701
# gear_versatility_rating=2151
# gear_armor=2236

Rogue_Subtlety_T19M : 418004 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
418004.1 418004.1 395.0 / 0.094% 68107.1 / 16.3% 15557.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
26.8 26.8 Energy 27.15% 52.0 100.0% 100%
Talents
  • 15: Weaponmaster (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Subtlety_T19M 418004
auto_attack_mh 11334 2.7% 162.3 1.86sec 21047 14090 Direct 162.3 18153 36307 21047 35.0% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.31 162.31 0.00 0.00 1.4938 0.0000 3416052.01 5021920.03 31.98 14089.60 14089.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.60 45.96% 18153.46 15138 18166 18153.56 17903 18166 1354329 1990992 31.98
crit 56.79 34.99% 36307.08 30277 36332 36307.37 35714 36332 2061723 3030928 31.98
miss 30.92 19.05% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5582 1.3% 159.7 1.88sec 10538 6940 Direct 159.7 9077 18153 10538 35.0% 18.9%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.68 159.68 0.00 0.00 1.5186 0.0000 1682786.92 2473856.16 31.98 6939.53 6939.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.51 46.03% 9076.63 7569 9083 9076.68 8934 9083 667194 980839 31.98
crit 55.95 35.04% 18152.75 15138 18166 18152.86 17863 18166 1015593 1493017 31.98
miss 30.23 18.93% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 19250 4.6% 44.1 6.14sec 131666 131078 Direct 46.7 92179 184362 124345 34.9% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.11 46.71 0.00 0.00 1.0045 0.0000 5807952.64 8538240.52 31.98 131078.40 131078.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.41 65.11% 92179.36 76883 92259 92180.72 89546 92259 2803167 4120920 31.98
crit 16.30 34.89% 184361.90 153766 184519 184365.07 176830 184519 3004786 4417320 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Eviscerate 123668 29.6% 52.5 5.69sec 706418 703256 Direct 55.5 445488 890848 667865 49.9% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.46 55.49 0.00 0.00 1.0045 0.0000 37059504.05 54480981.33 31.98 703256.43 703256.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.78 50.07% 445487.86 306283 546899 445716.24 408252 491278 12376862 18195159 31.98
crit 27.71 49.93% 890848.33 612567 1093799 891301.69 813338 976774 24682642 36285822 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (7995) 0.0% (1.9%) 4.9 63.70sec 493324 491203

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.87 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 491203.26 491203.26
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.shadow_dance.up&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 5390 1.3% 4.9 63.70sec 333085 0 Direct 5.2 237618 455827 314697 35.3% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.87 5.15 0.00 0.00 0.0000 0.0000 1621452.23 1621452.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.33 64.68% 237617.89 106809 2050727 218895.38 0 2050727 791760 791760 0.00
crit 1.82 35.32% 455826.53 213617 4101453 385366.40 0 4101453 829692 829692 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
    Goremaw's Bite (_oh) 2605 0.6% 4.9 63.70sec 160239 0 Direct 5.1 112526 226430 152086 34.7% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.87 5.13 0.00 0.00 0.0000 0.0000 780040.51 780040.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.35 65.27% 112525.76 53407 1025417 104666.39 0 1025417 376673 376673 0.00
crit 1.78 34.73% 226430.28 106814 2050834 185362.35 0 2050834 403367 403367 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Horrific Slam 14349 3.4% 118.5 2.19sec 36357 0 Direct 118.5 26916 53833 36357 35.1% 0.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.50 118.50 0.00 0.00 0.0000 0.0000 4308430.36 4308430.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.94 64.92% 26915.78 22443 26932 26915.88 26191 26932 2070817 2070817 0.00
crit 41.57 35.08% 53833.37 44886 53863 53833.80 52006 53863 2237613 2237613 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Mark of the Hidden Satyr 4882 1.2% 17.0 17.64sec 86416 0 Direct 17.0 64007 128012 86414 35.0% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.96 16.96 0.00 0.00 0.0000 0.0000 1465315.37 1465315.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.02 64.99% 64007.44 53367 64041 64006.81 60483 64041 705354 705354 0.00
crit 5.94 35.01% 128011.73 106734 128081 127718.70 0 128081 759962 759962 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Nightblade 84834 (89796) 20.3% (21.5%) 17.3 17.26sec 1560192 1553294 Periodic 144.1 130972 262068 176941 35.1% 0.0% 95.9%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.30 0.00 144.11 144.11 1.0045 2.0000 25499371.08 25499371.08 0.00 88323.25 1553293.72
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.6 64.93% 130972.24 97104 144495 130974.60 126386 136557 12256094 12256094 0.00
crit 50.5 35.07% 262068.17 194209 288990 262071.61 249869 274121 13243277 13243277 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=50}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Weaponmaster 4962 1.2% 8.4 30.67sec 177289 0 Direct 8.4 177290 0 177290 0.0% 0.0%  

Stats details: weaponmaster

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.42 8.42 0.00 0.00 0.0000 0.0000 1492213.94 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.42 100.00% 177290.19 97104 288990 177279.24 0 288990 1492214 0 0.00
 
 

Action details: weaponmaster

Static Values
  • id:193536
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193536
  • name:Weaponmaster
  • school:shadow
  • tooltip:
  • description:Deals Shadow damage to an enemy.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:139833.94
  • base_dd_max:139833.94
 
Potion of the Old War 17155 4.0% 24.1 9.28sec 209972 0 Direct 24.1 155498 310999 209973 35.0% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.15 24.15 0.00 0.00 0.0000 0.0000 5070361.77 7453912.09 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.69 64.97% 155497.63 129584 155500 155497.35 151513 155500 2439503 3586300 31.98
crit 8.46 35.03% 310998.53 259167 311001 310999.02 300634 311001 2630859 3867612 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (6873) 0.0% (1.6%) 2.0 180.92sec 996917 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(stealthed|buff.shadowmeld.up)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 4584 1.1% 35.5 6.09sec 38159 29216 Direct 37.6 26705 53411 36081 35.1% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.51 37.56 0.00 0.00 1.3061 0.0000 1355106.48 1355106.48 0.00 29216.21 29216.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.37 64.90% 26705.41 22255 26706 26705.39 26099 26706 650926 650926 0.00
crit 13.18 35.10% 53411.11 44510 53412 53411.13 52042 53412 704180 704180 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 2289 0.5% 35.6 6.07sec 19029 14567 Direct 37.5 13353 26706 18026 35.0% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.56 37.54 0.00 0.00 1.3064 0.0000 676747.50 676747.50 0.00 14566.55 14566.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.40 65.00% 13352.76 11127 13353 13352.77 13130 13353 325865 325865 0.00
crit 13.14 35.00% 26705.51 22255 26706 26705.45 25717 26706 350882 350882 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 7894 1.9% 29.4 10.24sec 80442 0 Direct 31.1 56334 112668 76052 35.0% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.40 31.09 0.00 0.00 0.0000 0.0000 2364804.35 2364804.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.21 65.00% 56333.87 46950 56339 56333.59 55166 56339 1138569 1138569 0.00
crit 10.88 35.00% 112668.32 93899 112679 112668.18 107984 112679 1226235 1226235 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 87321 (109227) 20.9% (26.1%) 99.1 3.05sec 330178 328701 Direct 104.9 177822 355648 249422 40.3% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.10 104.87 0.00 0.00 1.0045 0.0000 26157113.77 38453434.91 31.98 328701.21 328701.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.65 59.74% 177821.97 148207 177848 177821.81 175915 177848 11140348 16377367 31.98
crit 42.22 40.26% 355648.39 296414 355697 355647.90 350756 355697 15016765 22076068 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 21907 5.2% 103.6 3.02sec 63347 0 Direct 103.6 46951 93901 63347 34.9% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.62 103.62 0.00 0.00 0.0000 0.0000 6563776.41 6563776.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.43 65.08% 46950.66 46951 46951 46950.66 46951 46951 3165986 3165986 0.00
crit 36.18 34.92% 93901.32 93901 93901 93901.32 93901 93901 3397790 3397790 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After you use Cheap Shot or Shadowstrike, Akaari's Soul appears $m1 sec later and Soul Rips the target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Rogue_Subtlety_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T19M
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 25.9 11.63sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.65
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=50}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for $31666d after deal {$31223s1=10}% more damage. ][]
 
Shadowmeld 2.6 122.64sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.62 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=40-variable.ssw_er&energy.deficit>10
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Symbols of Death 9.0 35.51sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.9 122.57sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 10.6 6.6 28.4sec 17.1sec 45.03% 45.03% 6.6(6.6) 10.2

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 9.0 0.0 34.3sec 35.5sec 3.38% 8.64% 0.0(0.0) 0.4

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:3.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Finality: Eviscerate 28.0 0.0 10.7sec 10.7sec 49.24% 49.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_finality_eviscerate
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:27.56%
  • finality_eviscerate_6:21.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.9 0.0 34.7sec 34.7sec 42.60% 39.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:23.94%
  • finality_nightblade_6:18.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.9 0.0 63.7sec 63.7sec 9.62% 9.62% 28.9(28.9) 4.8

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Horrific Appendages 6.2 2.2 47.1sec 33.7sec 30.25% 30.25% 120.7(120.7) 5.9

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:30.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 184.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 2.0 0.0 180.9sec 180.9sec 16.95% 19.04% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:16.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 25.9 0.0 11.6sec 11.6sec 42.97% 42.97% 0.0(0.0) 25.6

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:42.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=50}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for $31666d after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Shadowmeld 2.6 0.0 122.7sec 122.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowmeld_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Stealth 3.8 0.0 83.8sec 122.6sec 1.22% 1.22% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 3.9 0.0 83.1sec 122.6sec 3.87% 3.87% 0.0(0.0) 3.8

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:3.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=100}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.3 7.6 185.0sec 35.5sec 99.65% 98.49% 7.6(7.6) 0.5

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Vanish 2.9 0.0 122.6sec 122.6sec 2.85% 2.85% 0.0(0.0) 2.8

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:2.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Subtlety_T19M
backstab Energy 44.1 1543.9 35.0 35.0 3762.0
eviscerate Energy 52.5 1836.1 35.0 35.0 20183.5
eviscerate Combo Points 52.5 286.9 5.5 5.5 129153.8
nightblade Energy 17.3 432.5 25.0 25.0 62408.0
nightblade Combo Points 17.3 94.2 5.4 5.4 286577.9
shadowstrike Energy 99.1 3964.0 40.0 40.0 8254.5
symbols_of_death Energy 9.0 278.7 31.1 31.1 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 46.71 46.63 (12.14%) 1.00 0.08 0.17%
goremaws_bite Combo Points 4.87 14.35 (3.74%) 2.95 0.26 1.75%
shadowstrike Combo Points 104.87 207.08 (53.93%) 1.97 2.66 1.27%
energy_regen Energy 1567.96 3448.27 (43.11%) 2.20 79.57 2.26%
Shadow Techniques Combo Points 95.63 94.85 (24.70%) 0.99 15.10 13.73%
Master of Shadows Energy 28.77 641.69 (8.02%) 22.31 221.26 25.64%
Shadow Blades Combo Points 28.41 21.05 (5.48%) 0.74 7.36 25.92%
Energetic Stabbing Energy 26.22 654.79 (8.19%) 24.97 0.79 0.12%
Goremaw's Bite Energy 28.87 136.87 (1.71%) 4.74 7.48 5.18%
Relentless Strikes Energy 72.79 3116.58 (38.97%) 42.82 63.16 1.99%
Resource RPS-Gain RPS-Loss
Energy 26.61 26.80
Combo Points 1.28 1.27
Combat End Resource Mean Min Max
Energy 42.97 0.21 100.00
Combo Points 2.86 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.6%

Procs

Count Interval
Weaponmaster 26.1 11.2sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Subtlety_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Rogue_Subtlety_T19M Damage Per Second
Count 7499
Mean 418004.13
Minimum 364419.06
Maximum 486967.81
Spread ( max - min ) 122548.74
Range [ ( max - min ) / 2 * 100% ] 14.66%
Standard Deviation 17450.5595
5th Percentile 390575.49
95th Percentile 448238.35
( 95th Percentile - 5th Percentile ) 57662.87
Mean Distribution
Standard Deviation 201.5151
95.00% Confidence Intervall ( 417609.17 - 418399.09 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6695
0.1 Scale Factor Error with Delta=300 2599575
0.05 Scale Factor Error with Delta=300 10398300
0.01 Scale Factor Error with Delta=300 259957516
Priority Target DPS
Sample Data Rogue_Subtlety_T19M Priority Target Damage Per Second
Count 7499
Mean 418004.13
Minimum 364419.06
Maximum 486967.81
Spread ( max - min ) 122548.74
Range [ ( max - min ) / 2 * 100% ] 14.66%
Standard Deviation 17450.5595
5th Percentile 390575.49
95th Percentile 448238.35
( 95th Percentile - 5th Percentile ) 57662.87
Mean Distribution
Standard Deviation 201.5151
95.00% Confidence Intervall ( 417609.17 - 418399.09 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 66
0.1% Error 6695
0.1 Scale Factor Error with Delta=300 2599575
0.05 Scale Factor Error with Delta=300 10398300
0.01 Scale Factor Error with Delta=300 259957516
DPS(e)
Sample Data Rogue_Subtlety_T19M Damage Per Second (Effective)
Count 7499
Mean 418004.13
Minimum 364419.06
Maximum 486967.81
Spread ( max - min ) 122548.74
Range [ ( max - min ) / 2 * 100% ] 14.66%
Damage
Sample Data Rogue_Subtlety_T19M Damage
Count 7499
Mean 125321029.38
Minimum 89766865.87
Maximum 163276218.29
Spread ( max - min ) 73509352.42
Range [ ( max - min ) / 2 * 100% ] 29.33%
DTPS
Sample Data Rogue_Subtlety_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Subtlety_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Subtlety_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Subtlety_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Subtlety_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Subtlety_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Subtlety_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Subtlety_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=ssw_er,value=equipped.shadow_satyrs_walk*(10-floor(target.distance*0.5))
0.00 variable,name=ed_threshold,value=energy.deficit<=(20+talent.vigor.enabled*35+talent.master_of_shadows.enabled*25+variable.ssw_er)
8 0.00 call_action_list,name=cds
9 0.00 run_action_list,name=stealthed,if=stealthed|buff.shadowmeld.up
A 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
B 0.00 call_action_list,name=stealth_cds,if=combo_points.deficit>=2+talent.premeditation.enabled&(variable.ed_threshold|(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)|target.time_to_die<12)
C 0.00 call_action_list,name=build,if=variable.ed_threshold
actions.build
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
D 44.11 backstab
actions.cds
# count action,conditions
E 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
0.00 blood_fury,if=stealthed
0.00 berserking,if=stealthed
0.00 arcane_torrent,if=stealthed&energy.deficit>70
F 2.04 shadow_blades,if=!(stealthed|buff.shadowmeld.up)
G 4.87 goremaws_bite,if=!buff.shadow_dance.up&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
H 17.30 nightblade,target_if=max:target.time_to_die,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
I 52.46 eviscerate
actions.stealth_cds
# count action,conditions
J 2.04 shadow_dance,if=charges_fractional>=2.65
K 2.86 vanish
L 3.98 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40-variable.ssw_er
M 2.62 shadowmeld,if=energy>=40-variable.ssw_er&energy.deficit>10
N 19.92 shadow_dance,if=combo_points<=1
actions.stealthed
# count action,conditions
O 7.96 symbols_of_death,if=buff.shadowmeld.down&((buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|(equipped.shadow_satyrs_walk&energy.time_to_max<0.25))
P 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Q 99.10 shadowstrike

Sample Sequence

012457QQHFJQQIQQIKQQIJQHQQILQQIQILQIOQQIGDILQQHQINQQIQQINQQQHQIMQDINQQQIDDDHNOQQQIDDHNQQIQDIGDDINOQQHDDDIDDINQHQQQINQQIQQIKOQDHNQQIQQIDDDINQQHQDIGDINQQIQODHMQDINQIQQIDFEDHNQQIQIDDINOQIQIQDHNQQIQQIDDINQQQHQIGDINQQIQQIDDIDDHDDINOQQHKQQINQQIQQINQQIQQIDDDHGDINOQQIQ

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Subtlety_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Subtlety_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Subtlety_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
Pre symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, stealth, symbols_of_death, death, potion_of_the_old_war
0:01.005 shadowstrike Fluffy_Pillow 75.4/100: 75% energy | 2.0/6: 33% combo_points bloodlust, stealth, subterfuge, symbols_of_death, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:02.010 nightblade Fluffy_Pillow 50.9/100: 51% energy | 5.0/6: 83% combo_points bloodlust, stealth, subterfuge, symbols_of_death, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:03.013 shadow_blades Fluffy_Pillow 81.3/100: 81% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:03.013 shadow_dance Fluffy_Pillow 81.3/100: 81% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:03.013 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:04.017 shadowstrike Fluffy_Pillow 75.4/100: 75% energy | 3.0/6: 50% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:05.021 eviscerate Fluffy_Pillow 50.8/100: 51% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:06.027 shadowstrike Fluffy_Pillow 71.3/100: 71% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:07.032 shadowstrike Fluffy_Pillow 46.7/100: 47% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:08.036 eviscerate Fluffy_Pillow 47.1/100: 47% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:09.040 vanish Fluffy_Pillow 67.6/100: 68% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:09.040 shadowstrike Fluffy_Pillow 67.6/100: 68% energy | 0.0/6: 0% combo_points bloodlust, vanish, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:10.047 shadowstrike Fluffy_Pillow 43.0/100: 43% energy | 3.0/6: 50% combo_points bloodlust, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, potion_of_the_old_war
0:11.051 Waiting 1.056 sec 17.1/100: 17% energy | 6.0/6: 100% combo_points bloodlust, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, potion_of_the_old_war
0:12.107 eviscerate Fluffy_Pillow 62.1/100: 62% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, potion_of_the_old_war
0:13.113 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, potion_of_the_old_war
0:13.113 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, potion_of_the_old_war
0:14.116 nightblade Fluffy_Pillow 74.2/100: 74% energy | 5.0/6: 83% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, potion_of_the_old_war
0:15.119 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
0:16.124 shadowstrike Fluffy_Pillow 74.2/100: 74% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
0:17.128 eviscerate Fluffy_Pillow 48.4/100: 48% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
0:18.134 shadow_dance Fluffy_Pillow 67.6/100: 68% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:18.134 shadowstrike Fluffy_Pillow 97.6/100: 98% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:19.138 shadowstrike Fluffy_Pillow 96.8/100: 97% energy | 3.0/6: 50% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:20.141 eviscerate Fluffy_Pillow 71.0/100: 71% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:21.144 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
0:22.147 eviscerate Fluffy_Pillow 74.7/100: 75% energy | 5.0/6: 83% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
0:23.149 shadow_dance Fluffy_Pillow 95.1/100: 95% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(5), blood_frenzy
0:23.149 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), blood_frenzy
0:24.155 eviscerate Fluffy_Pillow 75.4/100: 75% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), blood_frenzy
0:25.159 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, blood_frenzy
0:25.159 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, death, blood_frenzy
0:26.164 shadowstrike Fluffy_Pillow 65.4/100: 65% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, blood_frenzy
0:27.170 eviscerate Fluffy_Pillow 40.9/100: 41% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, blood_frenzy
0:28.174 goremaws_bite Fluffy_Pillow 61.3/100: 61% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, finality_eviscerate(6), blood_frenzy
0:29.178 backstab Fluffy_Pillow 81.7/100: 82% energy | 4.0/6: 67% combo_points bloodlust, symbols_of_death, goremaws_bite, finality_eviscerate(6), blood_frenzy
0:30.182 eviscerate Fluffy_Pillow 67.1/100: 67% energy | 5.0/6: 83% combo_points bloodlust, symbols_of_death, goremaws_bite, finality_eviscerate(6), blood_frenzy
0:31.187 shadow_dance Fluffy_Pillow 92.6/100: 93% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, goremaws_bite, blood_frenzy
0:31.187 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, goremaws_bite, blood_frenzy
0:32.192 shadowstrike Fluffy_Pillow 79.8/100: 80% energy | 3.0/6: 50% combo_points bloodlust, shadow_dance, symbols_of_death, goremaws_bite
0:33.197 nightblade Fluffy_Pillow 84.0/100: 84% energy | 5.0/6: 83% combo_points bloodlust, shadow_dance, symbols_of_death, goremaws_bite
0:34.200 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, finality_nightblade(5)
0:35.204 eviscerate Fluffy_Pillow 74.2/100: 74% energy | 5.0/6: 83% combo_points bloodlust, shadow_dance, symbols_of_death, finality_nightblade(5)
0:36.210 shadow_dance Fluffy_Pillow 93.4/100: 93% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
0:36.210 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
0:37.213 shadowstrike Fluffy_Pillow 74.2/100: 74% energy | 3.0/6: 50% combo_points bloodlust, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
0:38.217 eviscerate Fluffy_Pillow 48.4/100: 48% energy | 5.0/6: 83% combo_points bloodlust, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
0:39.222 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
0:40.224 shadowstrike Fluffy_Pillow 73.2/100: 73% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
0:41.231 eviscerate Fluffy_Pillow 44.2/100: 44% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
0:42.238 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
0:42.238 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
0:43.241 shadowstrike Fluffy_Pillow 70.9/100: 71% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
0:44.246 shadowstrike Fluffy_Pillow 41.8/100: 42% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
0:45.252 nightblade Fluffy_Pillow 37.8/100: 38% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
0:46.256 shadowstrike Fluffy_Pillow 63.7/100: 64% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death
0:47.259 Waiting 1.000 sec 34.6/100: 35% energy | 4.0/6: 67% combo_points symbols_of_death
0:48.259 eviscerate Fluffy_Pillow 45.4/100: 45% energy | 5.0/6: 83% combo_points symbols_of_death
0:49.262 shadowmeld Fluffy_Pillow 61.3/100: 61% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5)
0:49.262 shadowstrike Fluffy_Pillow 61.3/100: 61% energy | 0.0/6: 0% combo_points shadowmeld, symbols_of_death, finality_eviscerate(5)
0:50.267 Waiting 2.100 sec 32.3/100: 32% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5)
0:52.367 backstab Fluffy_Pillow 55.1/100: 55% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5)
0:53.371 Waiting 1.700 sec 31.0/100: 31% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5)
0:55.071 eviscerate Fluffy_Pillow 49.5/100: 49% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
0:56.074 shadow_dance Fluffy_Pillow 65.4/100: 65% energy | 0.0/6: 0% combo_points symbols_of_death
0:56.074 shadowstrike Fluffy_Pillow 95.4/100: 95% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death
0:57.081 shadowstrike Fluffy_Pillow 66.3/100: 66% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death
0:58.086 Waiting 0.200 sec 38.2/100: 38% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, blood_frenzy
0:58.286 shadowstrike Fluffy_Pillow 40.5/100: 41% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, blood_frenzy
0:59.291 Waiting 1.964 sec 12.4/100: 12% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, blood_frenzy
1:01.255 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, blood_frenzy
1:02.259 Waiting 0.300 sec 52.5/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:02.559 backstab Fluffy_Pillow 56.0/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:03.564 Waiting 1.900 sec 32.9/100: 33% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:05.464 backstab Fluffy_Pillow 55.3/100: 55% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:06.470 Waiting 2.100 sec 32.2/100: 32% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:08.570 backstab Fluffy_Pillow 55.6/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6)
1:09.574 nightblade Fluffy_Pillow 31.5/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6)
1:10.580 shadow_dance Fluffy_Pillow 57.5/100: 57% energy | 0.0/6: 0% combo_points finality_eviscerate(6), finality_nightblade(5)
1:10.580 symbols_of_death Fluffy_Pillow 87.5/100: 87% energy | 0.0/6: 0% combo_points shadow_dance, finality_eviscerate(6), finality_nightblade(5)
1:10.580 shadowstrike Fluffy_Pillow 52.5/100: 52% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(6), finality_nightblade(5)
1:11.585 shadowstrike Fluffy_Pillow 48.4/100: 48% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:12.590 shadowstrike Fluffy_Pillow 44.3/100: 44% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:13.594 Waiting 1.799 sec 15.2/100: 15% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5)
1:15.393 eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), blood_frenzy
1:16.398 Waiting 0.200 sec 52.9/100: 53% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
1:16.598 backstab Fluffy_Pillow 55.3/100: 55% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
1:17.602 Waiting 2.000 sec 32.1/100: 32% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
1:19.602 backstab Fluffy_Pillow 55.8/100: 56% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
1:20.607 Waiting 1.900 sec 32.6/100: 33% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
1:22.507 nightblade Fluffy_Pillow 55.1/100: 55% energy | 6.0/6: 100% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
1:23.512 shadow_dance Fluffy_Pillow 81.9/100: 82% energy | 0.0/6: 0% combo_points symbols_of_death, blood_frenzy
1:23.512 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, blood_frenzy
1:24.517 shadowstrike Fluffy_Pillow 71.4/100: 71% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, horrific_appendages
1:25.522 eviscerate Fluffy_Pillow 42.4/100: 42% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, horrific_appendages
1:26.525 shadowstrike Fluffy_Pillow 58.3/100: 58% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages
1:27.528 Waiting 2.400 sec 29.2/100: 29% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages
1:29.928 backstab Fluffy_Pillow 55.2/100: 55% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
1:30.931 Waiting 1.300 sec 31.1/100: 31% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
1:32.231 eviscerate Fluffy_Pillow 45.3/100: 45% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
1:33.235 goremaws_bite Fluffy_Pillow 61.2/100: 61% energy | 0.0/6: 0% combo_points symbols_of_death, horrific_appendages
1:34.239 backstab Fluffy_Pillow 77.1/100: 77% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, horrific_appendages
1:35.244 backstab Fluffy_Pillow 58.0/100: 58% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, horrific_appendages
1:36.247 eviscerate Fluffy_Pillow 38.9/100: 39% energy | 6.0/6: 100% combo_points symbols_of_death, goremaws_bite, horrific_appendages
1:37.253 shadow_dance Fluffy_Pillow 59.9/100: 60% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), horrific_appendages
1:37.253 symbols_of_death Fluffy_Pillow 89.9/100: 90% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), horrific_appendages
1:37.253 shadowstrike Fluffy_Pillow 54.9/100: 55% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(6), horrific_appendages
1:38.257 Waiting 0.900 sec 30.8/100: 31% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), horrific_appendages
1:39.157 shadowstrike Fluffy_Pillow 40.5/100: 41% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(6), horrific_appendages
1:40.161 Waiting 1.486 sec 16.5/100: 16% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), horrific_appendages
1:41.647 nightblade Fluffy_Pillow 32.6/100: 33% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), horrific_appendages
1:42.650 backstab Fluffy_Pillow 58.5/100: 59% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:43.656 Waiting 1.900 sec 34.4/100: 34% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:45.556 backstab Fluffy_Pillow 55.1/100: 55% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:46.560 Waiting 2.200 sec 31.0/100: 31% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:48.760 backstab Fluffy_Pillow 55.7/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy
1:49.766 Waiting 0.300 sec 32.6/100: 33% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy
1:50.066 eviscerate Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy
1:51.070 Waiting 0.200 sec 53.0/100: 53% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages, blood_frenzy
1:51.270 backstab Fluffy_Pillow 55.3/100: 55% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages, blood_frenzy
1:52.275 Waiting 2.000 sec 32.2/100: 32% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages, blood_frenzy
1:54.275 backstab Fluffy_Pillow 55.8/100: 56% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages, blood_frenzy
1:55.282 Waiting 0.200 sec 32.7/100: 33% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
1:55.482 eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
1:56.487 Waiting 0.300 sec 51.9/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy
1:56.787 shadow_dance Fluffy_Pillow 55.5/100: 55% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy
1:56.787 shadowstrike Fluffy_Pillow 85.5/100: 85% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy
1:57.791 nightblade Fluffy_Pillow 57.3/100: 57% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy
1:58.795 shadowstrike Fluffy_Pillow 84.2/100: 84% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
1:59.797 shadowstrike Fluffy_Pillow 81.0/100: 81% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:00.803 shadowstrike Fluffy_Pillow 52.9/100: 53% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:01.807 Waiting 0.900 sec 24.8/100: 25% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:02.707 eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:03.713 Waiting 0.300 sec 52.3/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, horrific_appendages, blood_frenzy
2:04.013 shadow_dance Fluffy_Pillow 55.8/100: 56% energy | 1.0/6: 17% combo_points symbols_of_death, horrific_appendages, blood_frenzy
2:04.114 shadowstrike Fluffy_Pillow 87.0/100: 87% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
2:05.118 shadowstrike Fluffy_Pillow 58.9/100: 59% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
2:06.123 eviscerate Fluffy_Pillow 55.8/100: 56% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
2:07.129 shadowstrike Fluffy_Pillow 72.7/100: 73% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:08.135 shadowstrike Fluffy_Pillow 44.5/100: 45% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:09.137 Waiting 1.630 sec 16.4/100: 16% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:10.767 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:11.771 Waiting 0.300 sec 52.5/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, horrific_appendages, blood_frenzy
2:12.071 vanish Fluffy_Pillow 56.0/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, horrific_appendages, blood_frenzy
2:12.071 symbols_of_death Fluffy_Pillow 56.0/100: 56% energy | 0.0/6: 0% combo_points vanish, symbols_of_death, horrific_appendages, blood_frenzy
2:12.071 Waiting 1.736 sec 21.0/100: 21% energy | 0.0/6: 0% combo_points vanish, symbols_of_death, death, horrific_appendages, blood_frenzy
2:13.807 shadowstrike Fluffy_Pillow 41.0/100: 41% energy | 2.0/6: 33% combo_points vanish, subterfuge, symbols_of_death, death, horrific_appendages
2:14.813 Waiting 1.306 sec 11.9/100: 12% energy | 4.0/6: 67% combo_points vanish, subterfuge, symbols_of_death, horrific_appendages
2:16.119 backstab Fluffy_Pillow 56.1/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, horrific_appendages
2:17.124 nightblade Fluffy_Pillow 32.0/100: 32% energy | 6.0/6: 100% combo_points symbols_of_death, horrific_appendages
2:18.128 shadow_dance Fluffy_Pillow 57.9/100: 58% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages
2:18.128 shadowstrike Fluffy_Pillow 87.9/100: 88% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), horrific_appendages
2:19.134 shadowstrike Fluffy_Pillow 83.8/100: 84% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), horrific_appendages
2:20.137 eviscerate Fluffy_Pillow 55.7/100: 56% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), blood_frenzy
2:21.142 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
2:22.148 shadowstrike Fluffy_Pillow 71.9/100: 72% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
2:23.153 eviscerate Fluffy_Pillow 68.8/100: 69% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
2:24.157 backstab Fluffy_Pillow 85.6/100: 86% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
2:25.160 backstab Fluffy_Pillow 62.5/100: 62% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
2:26.165 Waiting 1.400 sec 39.3/100: 39% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
2:27.565 backstab Fluffy_Pillow 55.9/100: 56% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
2:28.569 Waiting 0.200 sec 32.7/100: 33% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
2:28.769 eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
2:29.773 Waiting 0.300 sec 52.0/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
2:30.073 shadow_dance Fluffy_Pillow 55.5/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
2:30.073 shadowstrike Fluffy_Pillow 85.5/100: 85% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
2:31.077 shadowstrike Fluffy_Pillow 57.4/100: 57% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
2:32.081 nightblade Fluffy_Pillow 29.2/100: 29% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
2:33.085 shadowstrike Fluffy_Pillow 56.1/100: 56% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
2:34.090 Waiting 2.300 sec 27.9/100: 28% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
2:36.390 backstab Fluffy_Pillow 55.1/100: 55% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
2:37.392 Waiting 0.300 sec 32.0/100: 32% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
2:37.692 eviscerate Fluffy_Pillow 35.5/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
2:38.695 goremaws_bite Fluffy_Pillow 52.3/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, blood_frenzy
2:39.699 backstab Fluffy_Pillow 68.9/100: 69% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite
2:40.704 eviscerate Fluffy_Pillow 49.8/100: 50% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite
2:41.708 shadow_dance Fluffy_Pillow 71.7/100: 72% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), blood_frenzy
2:41.708 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), blood_frenzy
2:42.714 shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), blood_frenzy
2:43.718 eviscerate Fluffy_Pillow 53.7/100: 54% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), blood_frenzy
2:44.722 shadowstrike Fluffy_Pillow 75.6/100: 76% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, blood_frenzy
2:45.728 symbols_of_death Fluffy_Pillow 47.5/100: 47% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, blood_frenzy
2:45.728 Waiting 3.659 sec 12.5/100: 12% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, death, blood_frenzy
2:49.387 backstab Fluffy_Pillow 55.7/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, death, blood_frenzy
2:50.391 nightblade Fluffy_Pillow 32.6/100: 33% energy | 5.0/6: 83% combo_points symbols_of_death, death, blood_frenzy
2:51.395 shadowmeld Fluffy_Pillow 58.8/100: 59% energy | 1.0/6: 17% combo_points symbols_of_death, death, finality_nightblade(5)
2:51.395 shadowstrike Fluffy_Pillow 58.8/100: 59% energy | 1.0/6: 17% combo_points shadowmeld, symbols_of_death, death, finality_nightblade(5)
2:52.399 Waiting 2.400 sec 29.7/100: 30% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(5)
2:54.799 backstab Fluffy_Pillow 55.9/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
2:55.803 Waiting 0.200 sec 32.7/100: 33% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
2:56.003 eviscerate Fluffy_Pillow 35.1/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
2:57.008 Waiting 0.300 sec 52.0/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
2:57.308 shadow_dance Fluffy_Pillow 55.5/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
2:57.308 shadowstrike Fluffy_Pillow 85.5/100: 85% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
2:58.313 eviscerate Fluffy_Pillow 82.4/100: 82% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
2:59.317 shadowstrike Fluffy_Pillow 99.2/100: 99% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
3:00.320 shadowstrike Fluffy_Pillow 71.1/100: 71% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
3:01.323 eviscerate Fluffy_Pillow 42.9/100: 43% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), blood_frenzy
3:02.326 backstab Fluffy_Pillow 59.8/100: 60% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
3:03.331 shadow_blades Fluffy_Pillow 36.6/100: 37% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
3:03.331 potion Fluffy_Pillow 36.6/100: 37% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
3:03.331 Waiting 1.600 sec 36.6/100: 37% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), blood_frenzy, potion_of_the_old_war
3:04.931 backstab Fluffy_Pillow 55.3/100: 55% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:05.934 nightblade Fluffy_Pillow 31.2/100: 31% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(5), potion_of_the_old_war
3:06.940 shadow_dance Fluffy_Pillow 57.2/100: 57% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:06.940 shadowstrike Fluffy_Pillow 87.2/100: 87% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:07.944 shadowstrike Fluffy_Pillow 58.1/100: 58% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:08.948 Waiting 0.600 sec 29.0/100: 29% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:09.548 eviscerate Fluffy_Pillow 35.5/100: 36% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:10.551 shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:11.555 Waiting 1.346 sec 22.3/100: 22% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:12.901 eviscerate Fluffy_Pillow 36.9/100: 37% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:13.907 Waiting 0.200 sec 52.9/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:14.107 backstab Fluffy_Pillow 55.1/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:15.111 Waiting 2.300 sec 31.0/100: 31% energy | 2.0/6: 33% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:17.411 backstab Fluffy_Pillow 56.0/100: 56% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:18.417 Waiting 0.300 sec 31.9/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:18.717 eviscerate Fluffy_Pillow 35.2/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), potion_of_the_old_war
3:19.722 Waiting 0.400 sec 51.1/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:20.122 shadow_dance Fluffy_Pillow 55.4/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, potion_of_the_old_war
3:20.122 symbols_of_death Fluffy_Pillow 85.4/100: 85% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:20.122 shadowstrike Fluffy_Pillow 50.4/100: 50% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, shadow_blades, death, potion_of_the_old_war
3:21.126 eviscerate Fluffy_Pillow 46.3/100: 46% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:22.132 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, potion_of_the_old_war
3:23.137 eviscerate Fluffy_Pillow 70.9/100: 71% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, potion_of_the_old_war
3:24.140 shadowstrike Fluffy_Pillow 86.8/100: 87% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
3:25.143 backstab Fluffy_Pillow 82.7/100: 83% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
3:26.147 nightblade Fluffy_Pillow 58.6/100: 59% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
3:27.152 shadow_dance Fluffy_Pillow 84.6/100: 85% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, potion_of_the_old_war
3:27.152 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, potion_of_the_old_war
3:28.157 shadowstrike Fluffy_Pillow 70.9/100: 71% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), horrific_appendages, potion_of_the_old_war
3:29.160 eviscerate Fluffy_Pillow 41.8/100: 42% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), horrific_appendages
3:30.166 shadowstrike Fluffy_Pillow 97.8/100: 98% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
3:31.170 shadowstrike Fluffy_Pillow 93.7/100: 94% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy
3:32.176 eviscerate Fluffy_Pillow 65.6/100: 66% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy
3:33.178 backstab Fluffy_Pillow 82.5/100: 82% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages, blood_frenzy
3:34.183 backstab Fluffy_Pillow 59.3/100: 59% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
3:35.187 Waiting 1.300 sec 36.2/100: 36% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
3:36.487 eviscerate Fluffy_Pillow 51.6/100: 52% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
3:37.491 shadow_dance Fluffy_Pillow 68.4/100: 68% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
3:37.491 shadowstrike Fluffy_Pillow 98.4/100: 98% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
3:38.496 shadowstrike Fluffy_Pillow 95.3/100: 95% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
3:39.501 shadowstrike Fluffy_Pillow 67.2/100: 67% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
3:40.507 nightblade Fluffy_Pillow 39.0/100: 39% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
3:41.512 shadowstrike Fluffy_Pillow 65.9/100: 66% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
3:42.516 eviscerate Fluffy_Pillow 37.8/100: 38% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
3:43.520 goremaws_bite Fluffy_Pillow 54.6/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, blood_frenzy
3:44.523 backstab Fluffy_Pillow 71.5/100: 71% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, blood_frenzy
3:45.525 eviscerate Fluffy_Pillow 53.3/100: 53% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, blood_frenzy
3:46.529 shadow_dance Fluffy_Pillow 75.2/100: 75% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), blood_frenzy
3:46.529 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), blood_frenzy
3:47.534 shadowstrike Fluffy_Pillow 76.9/100: 77% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), blood_frenzy
3:48.539 eviscerate Fluffy_Pillow 53.7/100: 54% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages, blood_frenzy
3:49.544 shadowstrike Fluffy_Pillow 75.6/100: 76% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
3:50.548 shadowstrike Fluffy_Pillow 47.5/100: 47% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
3:51.554 Waiting 1.377 sec 19.4/100: 19% energy | 6.0/6: 100% combo_points symbols_of_death, horrific_appendages, blood_frenzy
3:52.931 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, horrific_appendages, blood_frenzy
3:53.937 Waiting 0.300 sec 52.5/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages, blood_frenzy
3:54.237 backstab Fluffy_Pillow 56.1/100: 56% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages, blood_frenzy
3:55.241 Waiting 1.900 sec 32.9/100: 33% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages, blood_frenzy
3:57.141 backstab Fluffy_Pillow 55.4/100: 55% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages, blood_frenzy
3:58.145 Waiting 0.300 sec 32.2/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages, blood_frenzy
3:58.445 eviscerate Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages, blood_frenzy
3:59.450 Waiting 0.300 sec 52.6/100: 53% energy | 2.0/6: 33% combo_points symbols_of_death, horrific_appendages, blood_frenzy
3:59.750 backstab Fluffy_Pillow 56.2/100: 56% energy | 2.0/6: 33% combo_points symbols_of_death, blood_frenzy
4:00.755 Waiting 1.900 sec 33.0/100: 33% energy | 3.0/6: 50% combo_points symbols_of_death, blood_frenzy
4:02.655 backstab Fluffy_Pillow 55.5/100: 55% energy | 4.0/6: 67% combo_points symbols_of_death, blood_frenzy
4:03.659 nightblade Fluffy_Pillow 32.4/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, blood_frenzy
4:04.662 backstab Fluffy_Pillow 59.2/100: 59% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
4:05.667 Waiting 1.700 sec 36.1/100: 36% energy | 3.0/6: 50% combo_points finality_nightblade(5), blood_frenzy
4:07.367 backstab Fluffy_Pillow 56.2/100: 56% energy | 4.0/6: 67% combo_points finality_nightblade(5), blood_frenzy
4:08.371 Waiting 0.200 sec 33.0/100: 33% energy | 5.0/6: 83% combo_points finality_nightblade(5), blood_frenzy
4:08.571 eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points finality_nightblade(5), blood_frenzy
4:09.576 Waiting 0.300 sec 52.2/100: 52% energy | 1.0/6: 17% combo_points finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:09.876 shadow_dance Fluffy_Pillow 55.8/100: 56% energy | 1.0/6: 17% combo_points finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:09.876 symbols_of_death Fluffy_Pillow 85.8/100: 86% energy | 1.0/6: 17% combo_points shadow_dance, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:09.876 shadowstrike Fluffy_Pillow 50.8/100: 51% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:10.879 Waiting 1.500 sec 22.6/100: 23% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:12.379 shadowstrike Fluffy_Pillow 40.4/100: 40% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:13.384 Waiting 1.181 sec 12.2/100: 12% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:14.565 nightblade Fluffy_Pillow 26.2/100: 26% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), blood_frenzy
4:15.570 Waiting 0.200 sec 53.1/100: 53% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
4:15.770 vanish Fluffy_Pillow 55.4/100: 55% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
4:15.770 shadowstrike Fluffy_Pillow 55.4/100: 55% energy | 1.0/6: 17% combo_points vanish, symbols_of_death, finality_eviscerate(5), blood_frenzy
4:16.773 Waiting 1.100 sec 27.3/100: 27% energy | 3.0/6: 50% combo_points vanish, subterfuge, symbols_of_death, finality_eviscerate(5), blood_frenzy
4:17.873 shadowstrike Fluffy_Pillow 40.3/100: 40% energy | 3.0/6: 50% combo_points vanish, subterfuge, symbols_of_death, finality_eviscerate(5), blood_frenzy
4:18.877 eviscerate Fluffy_Pillow 67.1/100: 67% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
4:19.880 shadow_dance Fluffy_Pillow 84.0/100: 84% energy | 1.0/6: 17% combo_points symbols_of_death, blood_frenzy
4:19.880 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, blood_frenzy
4:20.884 shadowstrike Fluffy_Pillow 71.9/100: 72% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, blood_frenzy
4:21.889 eviscerate Fluffy_Pillow 43.7/100: 44% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, blood_frenzy
4:22.895 shadowstrike Fluffy_Pillow 60.0/100: 60% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
4:23.901 Waiting 0.900 sec 30.9/100: 31% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
4:24.801 shadowstrike Fluffy_Pillow 40.7/100: 41% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
4:25.805 eviscerate Fluffy_Pillow 37.5/100: 38% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
4:26.810 shadow_dance Fluffy_Pillow 94.4/100: 94% energy | 0.0/6: 0% combo_points symbols_of_death, blood_frenzy
4:26.810 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, blood_frenzy
4:27.814 shadowstrike Fluffy_Pillow 71.9/100: 72% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, blood_frenzy
4:28.817 eviscerate Fluffy_Pillow 43.7/100: 44% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, blood_frenzy
4:29.822 shadowstrike Fluffy_Pillow 60.6/100: 61% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), blood_frenzy
4:30.827 Waiting 0.700 sec 32.5/100: 32% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), blood_frenzy
4:31.527 shadowstrike Fluffy_Pillow 40.7/100: 41% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), blood_frenzy
4:32.531 Waiting 1.951 sec 12.6/100: 13% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
4:34.482 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages, blood_frenzy
4:35.486 Waiting 0.300 sec 51.8/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, horrific_appendages
4:35.786 backstab Fluffy_Pillow 55.1/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, horrific_appendages
4:36.791 Waiting 2.300 sec 31.0/100: 31% energy | 1.0/6: 17% combo_points symbols_of_death, horrific_appendages
4:39.091 backstab Fluffy_Pillow 56.0/100: 56% energy | 2.0/6: 33% combo_points symbols_of_death, horrific_appendages
4:40.096 Waiting 2.200 sec 31.9/100: 32% energy | 3.0/6: 50% combo_points symbols_of_death, horrific_appendages
4:42.296 backstab Fluffy_Pillow 55.9/100: 56% energy | 4.0/6: 67% combo_points symbols_of_death, horrific_appendages
4:43.300 nightblade Fluffy_Pillow 31.8/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, horrific_appendages
4:44.304 goremaws_bite Fluffy_Pillow 57.7/100: 58% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
4:45.309 backstab Fluffy_Pillow 73.6/100: 74% energy | 3.0/6: 50% combo_points goremaws_bite, finality_nightblade(5)
4:46.313 eviscerate Fluffy_Pillow 54.5/100: 55% energy | 5.0/6: 83% combo_points goremaws_bite, finality_nightblade(5)
4:47.318 shadow_dance Fluffy_Pillow 75.4/100: 75% energy | 0.0/6: 0% combo_points goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
4:47.318 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
4:47.318 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(5), finality_nightblade(5)
4:48.322 shadowstrike Fluffy_Pillow 40.9/100: 41% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
4:49.326 Waiting 1.252 sec 16.8/100: 17% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(5)
4:50.578 eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
4:51.583 shadowstrike Fluffy_Pillow 51.4/100: 51% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
4:53.352 Waiting 1.600 sec 30.6/100: 31% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(5)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8802 8477 0
Agility 27915 26209 15928 (12223)
Stamina 41038 41038 25309
Intellect 5325 5000 0
Spirit 0 0 0
Health 2462280 2462280 0
Energy 100 100 0
Combo Points 6 6 0
Crit 35.00% 35.00% 6651
Haste 8.68% 8.68% 2821
Damage / Heal Versatility 7.81% 6.88% 2750
Attack Power 27915 26209 0
Mastery 77.69% 77.69% 7051
Armor 2236 2236 2236
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Krakentooth Necklace
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Scarred Ragefang Chestpiece
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +918 Mastery, +542 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Wristwraps of Broken Trust
ilevel: 880, stats: { 159 Armor, +1447 Sta, +965 AgiInt, +499 Mastery, +323 Crit }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Ascended Glory
ilevel: 885, stats: { +1516 Sta, +1136 Haste, +957 Crit }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Subtlety_T19M"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=2210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1
spec=subtlety

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=variable,name=ssw_er,value=equipped.shadow_satyrs_walk*(10-floor(target.distance*0.5))
actions+=/variable,name=ed_threshold,value=energy.deficit<=(20+talent.vigor.enabled*35+talent.master_of_shadows.enabled*25+variable.ssw_er)
actions+=/call_action_list,name=cds
actions+=/run_action_list,name=stealthed,if=stealthed|buff.shadowmeld.up
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_cds,if=combo_points.deficit>=2+talent.premeditation.enabled&(variable.ed_threshold|(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)|target.time_to_die<12)
actions+=/call_action_list,name=build,if=variable.ed_threshold

actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/blood_fury,if=stealthed
actions.cds+=/berserking,if=stealthed
actions.cds+=/arcane_torrent,if=stealthed&energy.deficit>70
actions.cds+=/shadow_blades,if=!(stealthed|buff.shadowmeld.up)
actions.cds+=/goremaws_bite,if=!buff.shadow_dance.up&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,target_if=max:target.time_to_die,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

actions.stealth_cds=shadow_dance,if=charges_fractional>=2.65
actions.stealth_cds+=/vanish
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40-variable.ssw_er
actions.stealth_cds+=/shadowmeld,if=energy>=40-variable.ssw_er&energy.deficit>10
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

actions.stealthed=symbols_of_death,if=buff.shadowmeld.down&((buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|(equipped.shadow_satyrs_walk&energy.time_to_max<0.25))
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=krakentooth_necklace,id=141473,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1806
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1806
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=ring_of_ascended_glory,id=142520,bonus_id=3469,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=spontaneous_appendages,id=139325,bonus_id=1806
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/138226/139267,relic_id=1806/1806/1806
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=882.31
# gear_agility=15928
# gear_stamina=25309
# gear_crit_rating=6651
# gear_haste_rating=2821
# gear_mastery_rating=7051
# gear_versatility_rating=2750
# gear_armor=2236

Shaman_Elemental_T19M : 419074 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
419074.0 419074.0 336.2 / 0.080% 57346.9 / 13.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Elemental Mastery (Elemental Shaman)
  • 100: Lightning Rod (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Shaman_Elemental_T19M 419074
Deadly Grace 12557 2.9% 35.0 8.76sec 105858 0 Direct 34.5 80915 161830 107427 32.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.03 34.52 0.00 0.00 0.0000 0.0000 3708615.06 3708615.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.21 67.23% 80914.81 80915 80915 80914.81 80915 80915 1878100 1878100 0.00
crit 11.31 32.77% 161829.61 161830 161830 161829.61 161830 161830 1830515 1830515 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Earth Shock 55242 13.2% 26.2 11.41sec 633932 597401 Direct 26.2 425097 1062458 633911 32.8%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.17 26.17 0.00 0.00 1.0612 0.0000 16592203.96 16592203.96 0.00 597400.59 597400.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.60 67.23% 425097.29 365157 467061 425105.90 399437 450656 7480761 7480761 0.00
crit 8.58 32.77% 1062458.35 912893 1167654 1062302.93 0 1167654 9111443 9111443 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:90.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (26672) 0.0% (6.4%) 12.2 23.53sec 657450 618852

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.18 0.00 0.00 0.00 1.0624 0.0000 0.00 0.00 0.00 618852.23 618852.23
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing ${$SPN*0.3*10*(1+{$170374m3=0}/100)} Physical damage over {$d=10 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 26672 6.4% 180.3 1.51sec 44409 0 Direct 180.3 29785 74472 44409 32.7%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 180.29 180.29 0.00 0.00 0.0000 0.0000 8006710.15 8006710.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.29 67.27% 29784.71 27607 30368 29784.87 27898 30368 3612584 3612584 0.00
crit 59.00 32.73% 74471.83 69018 75920 74467.17 70054 75920 4394126 4394126 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing ${$SPN*0.3*10*(1+{$170374m3=0}/100)} Physical damage over {$d=10 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Flame Shock 33466 8.0% 20.4 15.00sec 491460 460538 Direct 20.4 48871 122168 72715 32.5%  
Periodic 215.7 26651 66634 39706 32.7% 98.6%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.45 20.45 215.65 215.65 1.0672 1.3748 10049862.40 10049862.40 0.00 31574.35 460538.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.80 67.47% 48871.47 44810 49290 48867.23 47299 49290 674235 674235 0.00
crit 6.65 32.53% 122167.81 112024 123226 122077.96 0 123226 812768 812768 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 145.2 67.35% 26651.00 196 27111 26648.73 25793 27041 3870706 3870706 0.00
crit 70.4 32.65% 66634.28 490 67777 66630.73 63022 67777 4692154 4692154 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning=3&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 38834 (51901) 9.3% (12.4%) 41.2 7.31sec 378336 306323 Direct 41.1 0 283752 283752 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.20 41.10 0.00 0.00 1.2351 0.0000 11663552.35 11663552.35 0.00 306322.65 306322.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 41.10 100.00% 283751.78 264191 290611 283742.58 275199 289933 11663552 11663552 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lava_surge.up&spell_targets.chain_lightning=3
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 13067 3.1% 16.9 17.21sec 232249 0 Direct 16.8 0 233028 233028 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.90 16.84 0.00 0.00 0.0000 0.0000 3924288.12 3924288.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 16.84 100.00% 233027.59 216952 238648 233013.55 221292 238648 3924288 3924288 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lightning Bolt 67150 (103728) 16.0% (24.7%) 132.5 2.25sec 234987 174485 Direct 132.5 102101 255298 152108 32.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.48 132.48 0.00 0.00 1.3468 0.0000 20151285.92 20151285.92 0.00 174484.59 174484.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.24 67.36% 102101.35 75823 250215 102134.17 87255 116553 9111259 9111259 0.00
crit 43.24 32.64% 255298.47 189557 625539 255319.24 203964 331199 11040027 11040027 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 36579 8.7% 84.9 3.91sec 129297 0 Direct 84.9 86879 217030 129297 32.6%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.92 84.92 0.00 0.00 0.0000 0.0000 10979906.52 10979906.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.24 67.41% 86878.84 63691 210181 86882.61 68973 122750 4973283 4973283 0.00
crit 27.68 32.59% 217029.95 159228 525453 216988.26 170252 322437 6006624 6006624 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lightning Rod 33037 7.9% 175.4 1.75sec 56530 0 Direct 175.4 56530 0 56530 0.0%  

Stats details: lightning_rod

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.38 175.38 0.00 0.00 0.0000 0.0000 9914254.71 9914254.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 175.38 100.00% 56529.65 25476 250215 56522.65 44255 69245 9914255 9914255 0.00
 
 

Action details: lightning_rod

Static Values
  • id:197568
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197568
  • name:Lightning Rod
  • school:nature
  • tooltip:
  • description:{$@spelldesc210689=Your Lightning Bolt and Chain Lightning have a {$s1=30}% chance to make the primary target a Lightning Rod for {$197209d=10 seconds}. Lightning Rods take {$s2=40}% of all damage you deal with Lightning Bolt and Chain Lightning.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:33362.07
  • base_dd_max:33362.07
 
Mark of the Hidden Satyr 8384 2.0% 20.9 14.38sec 120324 0 Direct 20.9 90596 181192 120322 32.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.91 20.91 0.00 0.00 0.0000 0.0000 2516107.73 2516107.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.05 67.19% 90596.21 90596 90596 90596.21 90596 90596 1272841 1272841 0.00
crit 6.86 32.81% 181192.42 181192 181192 180999.13 0 181192 1243267 1243267 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Pepper Breath 4668 1.1% 16.7 17.94sec 84021 0 Periodic 82.5 16968 0 16968 0.0% 6.9%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.67 0.00 83.00 82.55 0.0000 0.2497 1400659.38 1400659.38 0.00 67592.87 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.5 100.00% 16968.25 68 16990 16969.50 16448 16990 1400659 1400659 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Plague Swarm 14295 3.4% 16.7 18.00sec 257803 0 Periodic 71.7 45087 90185 59865 32.8% 46.7%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.65 0.00 71.71 71.71 0.0000 1.9589 4292749.84 4292749.84 0.00 30560.12 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.2 67.23% 45086.92 23 46002 45105.40 41865 46002 2173573 2173573 0.00
crit 23.5 32.77% 90184.97 46 92005 90222.29 77597 92005 2119177 2119177 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Tormenting Cyclone 5887 1.4% 12.4 23.92sec 143077 0 Direct 85.0 15689 31377 20805 32.6%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.36 85.00 0.00 0.00 0.0000 0.0000 1768490.74 1768490.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.28 67.39% 15688.72 15689 15689 15688.72 15689 15689 898676 898676 0.00
crit 27.72 32.61% 31377.44 31377 31377 31377.44 31377 31377 869815 869815 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Volcanic Inferno 3249 0.8% 30.6 8.51sec 31881 0 Direct 30.6 24009 48019 31881 32.8%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.60 30.60 0.00 0.00 0.0000 0.0000 975495.85 975495.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.57 67.22% 24009.44 24009 24009 24009.44 24009 24009 493796 493796 0.00
crit 10.03 32.78% 48018.87 48019 48019 47980.45 0 48019 481700 481700 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
pet - primal_fire_elemental 145665 / 50853
Fire Blast 126302 10.6% 51.5 5.38sec 257998 139352 Direct 51.5 194435 388870 257997 32.7%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.51 51.51 0.00 0.00 1.8514 0.0000 13288581.71 13288581.71 0.00 139351.74 139351.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.67 67.31% 194435.05 194435 194435 194435.05 194435 194435 6740795 6740795 0.00
crit 16.84 32.69% 388870.10 388870 388870 388870.10 388870 388870 6547786 6547786 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 19363 1.6% 5.4 60.42sec 378283 277898 Direct 5.4 57610 115221 76407 32.6%  
Periodic 60.2 20369 40756 27029 32.7% 35.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 5.39 60.19 60.19 1.3614 1.7919 2038660.57 2038660.57 0.00 17698.40 277898.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.63 67.37% 57610.39 57610 57610 57372.23 0 57610 209161 209161 0.00
crit 1.76 32.63% 115220.77 115221 115221 100962.22 0 115221 202631 202631 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.5 67.33% 20369.09 520 21604 20379.73 18735 21604 825473 825473 0.00
crit 19.7 32.67% 40756.16 1040 43208 40777.98 31237 43208 801395 801395 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 107903 / 15135
Lightning Blast 107903 3.6% 42.7 6.57sec 106104 113080 Direct 42.7 80014 160029 106104 32.6%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.75 42.75 0.00 0.00 0.9383 0.0000 4535544.91 4535544.91 0.00 113080.48 113080.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.81 67.39% 80014.42 80014 80014 80014.42 80014 80014 2305085 2305085 0.00
crit 13.94 32.61% 160028.85 160029 160029 160028.85 160029 160029 2230459 2230459 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Shaman_Elemental_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shaman_Elemental_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.47sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Elemental Mastery 3.0 120.48sec

Stats details: elemental_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:16166
  • name:Elemental Mastery
  • school:nature
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
 
Fire Elemental 2.0 236.02sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.98 0.00 0.00 0.00 1.0106 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shaman_Elemental_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.3 62.00sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 0.00 0.00 0.8356 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 111.66sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.24 0.00 0.00 0.00 0.5289 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.1 0.0 180.5sec 180.5sec 6.84% 6.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 21.08% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Echoes of the Great Sundering 12.2 0.0 23.5sec 23.5sec 5.67% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_echoes_of_the_great_sundering
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • echoes_of_the_great_sundering_1:5.67%

Trigger Attempt Success

  • trigger_pct:46.86%

Spelldata details

  • id:208723
  • name:Echoes of the Great Sundering
  • tooltip:Your next Earthquake Totem is free and deals {$s2=100}% increased damage.
  • description:{$@spelldesc208722=Earth Shock has up to a {$s1=50}% chance, based on Maelstrom spent, to cause your next Earthquake Totem to be free and deal {$208723s2=100}% increased damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Elemental Focus 64.7 82.8 4.6sec 2.0sec 82.34% 79.17% 82.8(112.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:20.73%
  • elemental_focus_2:61.60%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Elemental Mastery 3.0 0.0 120.5sec 120.5sec 19.32% 26.85% 0.0(0.0) 2.8

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_elemental_mastery
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.83

Stack Uptimes

  • elemental_mastery_1:19.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:16166
  • name:Elemental Mastery
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Ember Totem 1.0 2.2 0.0sec 111.7sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.7 0.9 14.0sec 13.4sec 8.83% 54.36% 0.9(0.9) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.83%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 272.8sec 0.0sec 18.77% 18.77% 0.0(0.0) 1.2

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:18.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power of the Maelstrom 5.8 0.3 44.0sec 41.2sec 12.72% 13.30% 0.3(0.6) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:3.77%
  • power_of_the_maelstrom_2:3.70%
  • power_of_the_maelstrom_3:5.24%

Trigger Attempt Success

  • trigger_pct:14.96%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 111.7sec 100.00% 100.00% 301.3(301.3) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 111.7sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.3 0.0 62.1sec 62.0sec 6.25% 6.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:2.48%
  • stormkeeper_2:2.40%
  • stormkeeper_3:1.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 111.7sec 100.00% 95.99% 2.2(2.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper1.2570.0018.3254.7590.00017.130
Fire Elemental0.5040.0011.1500.0970.0001.150
Elemental Mastery0.5930.0012.4200.9630.0003.745
Lava Burst0.9270.0016.65135.44314.11462.965

Resources

Resource Usage Type Count Total Average RPE APR
Shaman_Elemental_T19M
earth_shock Maelstrom 26.2 2451.1 93.6 93.6 6769.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 41.20 487.54 (19.57%) 11.83 6.87 1.39%
Lava Burst Overload Maelstrom 16.90 143.59 (5.76%) 8.50 8.48 5.57%
Lightning Bolt Maelstrom 132.48 1057.84 (42.46%) 7.98 2.00 0.19%
Lightning Bolt Overload Maelstrom 84.92 505.26 (20.28%) 5.95 4.26 0.84%
Resonance Totem Maelstrom 299.03 297.15 (11.93%) 0.99 1.88 0.63%
Resource RPS-Gain RPS-Loss
Maelstrom 8.29 8.16
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 39.75 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Lava Surge 21.6 13.4sec
Lava Surge: Wasted 0.9 87.5sec
Lava Surge: During Lava Burst 2.1 77.6sec

Statistics & Data Analysis

Fight Length
Sample Data Shaman_Elemental_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Shaman_Elemental_T19M Damage Per Second
Count 7499
Mean 419073.97
Minimum 371117.66
Maximum 482255.76
Spread ( max - min ) 111138.10
Range [ ( max - min ) / 2 * 100% ] 13.26%
Standard Deviation 14852.1436
5th Percentile 395427.47
95th Percentile 444174.89
( 95th Percentile - 5th Percentile ) 48747.42
Mean Distribution
Standard Deviation 171.5092
95.00% Confidence Intervall ( 418737.81 - 419410.12 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4824
0.1 Scale Factor Error with Delta=300 1883050
0.05 Scale Factor Error with Delta=300 7532201
0.01 Scale Factor Error with Delta=300 188305041
Priority Target DPS
Sample Data Shaman_Elemental_T19M Priority Target Damage Per Second
Count 7499
Mean 419073.97
Minimum 371117.66
Maximum 482255.76
Spread ( max - min ) 111138.10
Range [ ( max - min ) / 2 * 100% ] 13.26%
Standard Deviation 14852.1436
5th Percentile 395427.47
95th Percentile 444174.89
( 95th Percentile - 5th Percentile ) 48747.42
Mean Distribution
Standard Deviation 171.5092
95.00% Confidence Intervall ( 418737.81 - 419410.12 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4824
0.1 Scale Factor Error with Delta=300 1883050
0.05 Scale Factor Error with Delta=300 7532201
0.01 Scale Factor Error with Delta=300 188305041
DPS(e)
Sample Data Shaman_Elemental_T19M Damage Per Second (Effective)
Count 7499
Mean 419073.97
Minimum 371117.66
Maximum 482255.76
Spread ( max - min ) 111138.10
Range [ ( max - min ) / 2 * 100% ] 13.26%
Damage
Sample Data Shaman_Elemental_T19M Damage
Count 7499
Mean 105944182.72
Minimum 75335579.62
Maximum 139574576.69
Spread ( max - min ) 64238997.07
Range [ ( max - min ) / 2 * 100% ] 30.32%
DTPS
Sample Data Shaman_Elemental_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaman_Elemental_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shaman_Elemental_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaman_Elemental_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaman_Elemental_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaman_Elemental_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Shaman_Elemental_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Shaman_Elemental_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,name=fishbrul_special
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 stormkeeper
6 0.00 totem_mastery
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
7 1.00 potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
8 0.00 totem_mastery,if=buff.resonance_totem.remains<2
9 1.98 fire_elemental
0.00 storm_elemental
A 3.00 elemental_mastery
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
B 2.06 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
C 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
D 0.00 run_action_list,name=single
actions.single
# count action,conditions
0.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
E 5.04 flame_shock,if=!ticking
0.00 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
F 16.86 earth_shock,if=maelstrom>=92
0.00 icefury,if=raid_event.movement.in<5
G 41.30 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
0.00 elemental_blast
H 12.18 earthquake,if=buff.echoes_of_the_great_sundering.up
I 15.41 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
0.00 frost_shock,moving=1,if=buff.icefury.up
J 9.31 earth_shock,if=maelstrom>=86
0.00 icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 4.34 stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
L 2.24 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
M 4.55 lightning_bolt,if=buff.power_of_the_maelstrom.up,target_if=!debuff.lightning_rod.up
N 13.10 lightning_bolt,if=buff.power_of_the_maelstrom.up
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
O 24.80 lightning_bolt,target_if=!debuff.lightning_rod.up
P 90.56 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1

Sample Sequence

024569ABEGOOOOOOOJOOGINNNJPPPPGGFHNNNIOPGFPPPPPPPFGHNENNPGJHPIPPGKPPFPPPGIPGFHNNMGOIJHGOPPGJHPPIPGPPPFHGLPIPPAPGJHGKPPPPIPJGHGNNNPJPGIPPPPGFHOOOIGPPFHPPGOIOPBFGPPPPKPGFHPGIPPOPGFNNINPGOFPPPIGPLOOFOGPPPIP9AFGHOOOOKOGJHOEOOPPGJN7NINPGFHPPPPOGIOFHOOGO

Sample Sequence Table

time name target resources buffs
Pre flask Shaman_Elemental_T19M 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre augmentation Shaman_Elemental_T19M 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom potion_of_deadly_grace
Pre stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), potion_of_deadly_grace
Pre totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.000 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.884 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.884 berserking Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:00.884 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, berserking, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:01.639 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, berserking, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:02.492 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom bloodlust, berserking, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:03.246 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/100: 29% maelstrom bloodlust, berserking, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:04.001 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/100: 38% maelstrom bloodlust, berserking, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:04.754 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom bloodlust, berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:05.608 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom bloodlust, berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:06.462 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom bloodlust, berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:07.314 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom bloodlust, berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:08.166 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom bloodlust, berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:08.921 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, berserking, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:09.775 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/100: 9% maelstrom bloodlust, berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:10.629 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/100: 18% maelstrom bloodlust, berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:11.481 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:12.236 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/100: 38% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:13.217 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/100: 47% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:14.198 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:15.178 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:15.932 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:16.914 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:17.896 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:18.876 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:19.856 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:20.837 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:21.818 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:22.699 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering, potion_of_deadly_grace
0:23.583 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:24.758 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:25.933 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:27.108 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:27.990 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:29.165 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:30.342 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:31.517 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:32.398 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:33.573 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/100: 19% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:34.749 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:35.926 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:37.101 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:38.277 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:39.451 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/100: 77% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:40.626 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:41.772 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
0:43.299 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
0:44.446 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:45.973 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:47.120 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:48.646 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:50.175 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:51.702 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:53.230 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/100: 87% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:54.378 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
0:55.525 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:57.051 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:58.196 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/100: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.723 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.251 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.778 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.924 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/100: 67% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.069 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.216 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.364 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.512 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.038 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.566 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.094 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.240 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.768 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.914 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.061 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:19.206 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/100: 3% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.733 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.261 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.790 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.319 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.847 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.994 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/100: 91% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.140 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:30.286 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/100: 3% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.432 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.958 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.486 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.015 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:37.162 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.308 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:39.455 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:40.983 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:42.511 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:43.658 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/100: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:45.185 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/100: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.713 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/100: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:48.240 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/100: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.769 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/100: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:51.296 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/100: 98% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.442 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:53.589 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.735 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.500 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.027 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:58.174 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/100: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.699 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.227 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:01.227 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:02.500 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:03.776 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:04.731 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/100: 9% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering
2:05.687 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:06.645 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:07.598 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:08.556 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:09.512 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:10.469 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/100: 63% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:11.742 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:12.699 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:13.973 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:14.930 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering
2:15.887 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering
2:16.842 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:17.798 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/100: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:19.073 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:20.346 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:21.620 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/100: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.148 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.294 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.823 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.970 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.117 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.644 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.170 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.697 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.224 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.753 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.898 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
2:38.044 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.571 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.099 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.626 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.773 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.301 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.828 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.355 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.502 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
2:50.650 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.178 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/100: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.705 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.231 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/100: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.759 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.905 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.432 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/100: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.960 berserking Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.960 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom berserking, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.958 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom berserking, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.956 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom berserking, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.284 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.611 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/100: 38% maelstrom berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.939 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.268 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/100: 63% maelstrom berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.266 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom berserking, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.265 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom berserking, lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.308 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.454 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
3:13.600 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.747 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/100: 18% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.893 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.039 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.185 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.713 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.242 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.769 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/100: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.296 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.444 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.970 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.498 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.644 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.173 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.701 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.228 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.755 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.901 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.428 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.955 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.481 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.628 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.155 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.684 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.449 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.977 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.504 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/100: 99% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.650 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.178 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.705 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.234 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.763 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.290 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.439 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.967 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.112 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.112 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:03.068 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering
4:04.024 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering
4:04.980 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:06.254 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:07.529 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:08.802 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:10.076 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:11.031 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:11.987 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:13.262 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/100: 87% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:14.218 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering
4:15.176 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:16.130 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:17.086 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:18.042 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:19.316 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/100: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:20.589 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:21.864 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:23.136 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.281 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.810 potion Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.810 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/100: 20% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:27.338 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:28.486 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:30.015 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:31.545 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:33.073 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/100: 99% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:34.220 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering, potion_of_deadly_grace
4:35.366 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:36.893 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:38.421 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:39.949 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:41.478 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:43.004 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:44.150 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:45.296 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:46.825 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:47.972 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering, potion_of_deadly_grace
4:49.118 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:50.646 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:52.175 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:53.702 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 9357 9032 0
Stamina 42217 42217 26216
Intellect 39146 37440 28334 (14046)
Spirit 1 1 0
Health 2533020 2533020 0
Mana 220000 220000 0
Maelstrom 100 100 0
Spell Power 39146 37440 0
Crit 32.67% 32.67% 9685
Haste 28.70% 28.70% 5524
Damage / Heal Versatility 2.20% 2.20% 880
Attack Power 9357 9032 0
Mastery 40.95% 40.95% 3570
Armor 2774 2774 2774
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 884.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Echoes of the Great Sundering
ilevel: 895, stats: { 357 Armor, +2219 Sta, +1479 AgiInt, +496 Haste, +662 Mastery }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist Laughing Sister's Pouch-Chain
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 AgiInt, +783 Crit, +312 Haste }
Local Legs Disjointed Linkage Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +886 Haste, +574 Crit }
Local Feet Scored Ironclaw Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +689 Crit, +406 Haste }
Local Wrists Manacles of the Nightmare Colossus
ilevel: 880, stats: { 199 Armor, +1447 Sta, +965 AgiInt, +481 Haste, +340 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Crit }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Crit }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 906, weapon: { 2776 - 5157, 2.6 }, stats: { +937 Int, +1405 Sta, +350 Crit, +337 Mastery, +11921 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 906, stats: { +1230 Int, +1844 Sta, +460 Crit, +442 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Elemental Blast (Elemental Shaman) Ancestral Swiftness Echo of the Elements
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Icefury (Elemental Shaman)
90 Elemental Mastery (Elemental Shaman) Storm Elemental (Elemental Shaman) Aftershock (Elemental Shaman)
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Liquid Magma Totem (Elemental Shaman)

Profile

shaman="Shaman_Elemental_T19M"
level=110
race=troll
role=spell
position=ranged_back
talents=3112212
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:3:299:3:300:3:301:3:302:3:303:3:304:3:305:3:306:3:1350:1
spec=elemental

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,name=fishbrul_special
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/stormkeeper
actions.precombat+=/totem_mastery

# Executed every time the actor is available.
actions=bloodlust,if=target.health.pct<25|time>0.500
actions+=/potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning=3&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=buff.lava_surge.up&spell_targets.chain_lightning=3
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=!debuff.lightning_rod.up
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single+=/flame_shock,if=!ticking
actions.single+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
actions.single+=/earth_shock,if=maelstrom>=92
actions.single+=/icefury,if=raid_event.movement.in<5
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single+=/elemental_blast
actions.single+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single+=/frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
actions.single+=/frost_shock,moving=1,if=buff.icefury.up
actions.single+=/earth_shock,if=maelstrom>=86
actions.single+=/icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
actions.single+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single+=/stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
actions.single+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single+=/lightning_bolt,if=buff.power_of_the_maelstrom.up,target_if=!debuff.lightning_rod.up
actions.single+=/lightning_bolt,if=buff.power_of_the_maelstrom.up
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single+=/lightning_bolt,target_if=!debuff.lightning_rod.up
actions.single+=/lightning_bolt
actions.single+=/flame_shock,moving=1,target_if=refreshable
actions.single+=/earth_shock,moving=1

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=echoes_of_the_great_sundering,id=137074
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=binding_of_intellect
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=manacles_of_the_nightmare_colossus,id=139222,bonus_id=1806
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1806
waist=laughing_sisters_pouchchain,id=139211,bonus_id=1806
legs=disjointed_linkage_leggings,id=139216,bonus_id=1806
feet=scored_ironclaw_sabatons,id=139220,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant_id=5427
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant_id=5427
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=139264/139259/139264,relic_id=1806/1806/1806
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=884.19
# gear_stamina=26216
# gear_intellect=28334
# gear_crit_rating=9685
# gear_haste_rating=5524
# gear_mastery_rating=3570
# gear_versatility_rating=880
# gear_armor=2774

Warrior_Arms_T19M : 509627 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
509627.0 509627.0 581.8 / 0.114% 100809.3 / 19.8% 40925.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.4 12.4 Rage 2.22% 91.4 100.0% 100%
Talents
  • 15: Dauntless (Arms Warrior)
  • 30: Double Time
  • 45: Avatar
  • 60: Bounding Stride
  • 75: Focused Rage (Arms Warrior)
  • 90: Deadly Calm (Arms Warrior)
  • 100: Anger Management
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Warrior_Arms_T19M 509627
auto_attack_mh 28633 5.6% 99.3 3.05sec 86585 28793 Direct 99.3 64437 129233 86585 34.2%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.28 99.28 0.00 0.00 3.0071 0.0000 8596382.99 12637497.26 31.98 28793.30 28793.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.35 65.82% 64437.25 33019 77788 64450.09 54051 68982 4210831 6190320 31.98
crit 33.94 34.18% 129233.07 66039 155577 129288.47 105688 141056 4385552 6447177 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bladestorm 0 (2914) 0.0% (0.6%) 2.0 122.72sec 433812 223017

Stats details: bladestorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.02 0.00 6.10 0.00 1.9457 0.5610 0.00 0.00 0.00 223017.28 223017.28
 
 

Action details: bladestorm

Static Values
  • id:227847
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:227847
  • name:Bladestorm
  • school:physical
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Bladestorm (_mh) 2914 0.6% 0.0 0.00sec 0 0 Direct 6.1 120926 242861 143556 18.6%  

Stats details: bladestorm_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.10 0.00 0.00 0.0000 0.0000 876011.87 1287820.42 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.97 81.45% 120925.88 73415 172953 119058.00 0 172953 601016 883551 31.34
crit 1.13 18.55% 242861.20 146829 345907 167425.82 0 345907 274995 404269 21.98
 
 

Action details: bladestorm_mh

Static Values
  • id:50622
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50622
  • name:Bladestorm
  • school:physical
  • tooltip:
  • description:You become a whirling storm of destructive force, striking all nearby targets with your main hand weapon for $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.35
 
Colossus Smash 63525 12.5% 54.2 5.60sec 351796 277531 Direct 54.2 275228 542027 351795 28.7%  

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.18 54.18 0.00 0.00 1.2676 0.0000 19060275.00 28020409.69 31.98 277531.01 277531.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.63 71.30% 275228.49 142728 336245 274704.38 229740 300090 10632455 15630715 31.98
crit 15.55 28.70% 542026.60 285457 672490 541085.33 383451 627657 8427820 12389694 31.98
 
 

Action details: colossus_smash

Static Values
  • id:167105
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:167105
  • name:Colossus Smash
  • school:physical
  • tooltip:
  • description:Smashes the enemy's armor, dealing $sw1 Physical damage, and increasing damage you deal to them by {$208086s3=15}% for {$208086d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.52
 
Corrupted Blood of Zakajz 42184 8.3% 0.0 0.00sec 0 0 Periodic 60.7 208273 0 208273 0.0% 40.4%

Stats details: corrupted_blood_of_zakajz

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 60.74 60.74 0.0000 2.0000 12651297.92 12651297.92 0.00 104138.77 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.7 100.00% 208273.05 16205 404023 208682.11 124821 270265 12651298 12651298 0.00
 
 

Action details: corrupted_blood_of_zakajz

Static Values
  • id:209569
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209569
  • name:Corrupted Blood of Zakajz
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t sec.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:50.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Execute 62123 12.2% 26.6 2.11sec 700437 529638 Direct 26.6 428676 913922 700414 56.0%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.64 26.64 0.00 0.00 1.3225 0.0000 18659135.50 27430696.63 31.98 529637.68 529637.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.72 44.00% 428675.99 50502 618666 428987.14 242666 556976 5024648 7386708 31.98
crit 14.92 56.00% 913921.95 101004 1237333 912952.96 533730 1079920 13634488 20043989 31.98
 
 

Action details: execute

Static Values
  • id:163201
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stone_heart.react
Spelldata
  • id:163201
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempts to finish off a foe, causing $sw2 Physical damage, and consuming up to $m4 additional Rage to deal up to ${$sw2*$m4/10} additional damage. Only usable on enemies that have less than 20% health.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.62
 
Horrific Slam 23727 4.7% 119.6 2.18sec 59545 0 Direct 119.6 44474 89121 59545 33.8%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.65 119.65 0.00 0.00 0.0000 0.0000 7124362.91 7124362.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.26 66.25% 44474.13 22636 53327 44493.14 32116 53327 3525064 3525064 0.00
crit 40.39 33.75% 89121.34 45273 106655 89097.86 54963 106655 3599299 3599299 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Mortal Strike 174769 34.3% 64.3 4.61sec 816028 645520 Direct 64.3 492573 1061711 816021 56.8%  

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.28 64.28 0.00 0.00 1.2642 0.0000 52456286.13 77115709.41 31.98 645520.49 645520.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.75 43.17% 492572.53 117230 682151 492887.81 369305 584084 13668819 20094459 31.98
crit 36.53 56.83% 1061710.60 234460 1364302 1062162.46 908737 1176631 38787467 57021251 31.98
 
 

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals ${$sw3*$<mult>} Physical damage and reduces the effectiveness of healing on the target for {$115804d=10 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
Potion of the Old War 29574 5.7% 23.4 12.93sec 373512 0 Direct 23.4 270300 558214 373511 35.8%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.42 23.42 0.00 0.00 0.0000 0.0000 8747866.77 12860192.77 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.03 64.15% 270300.16 130700 307909 270096.83 186795 307909 4061359 5970582 31.98
crit 8.40 35.85% 558214.03 261400 615817 558450.49 362433 615817 4686508 6889611 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Wave 19785 3.9% 13.1 19.64sec 452379 0 Direct 13.1 332389 674116 452390 35.1%  

Stats details: shadow_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.13 13.13 0.00 0.00 0.0000 0.0000 5941552.46 5941552.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.52 64.89% 332388.99 170539 401763 331745.98 0 401763 2832612 2832612 0.00
crit 4.61 35.11% 674116.28 341078 803525 661618.95 0 803525 3108940 3108940 0.00
 
 

Action details: shadow_wave

Static Values
  • id:215047
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215047
  • name:Shadow Wave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc215089=Your melee attacks have a chance to unleash 4 Shadow Waves that deal {$s1=78543} Shadow damage to enemies in their path. The waves travel 15 yards away from you, and then return.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:150798.04
  • base_dd_max:150798.04
 
Slam 56523 11.1% 78.6 3.07sec 216032 171292 Direct 78.6 158956 313586 216031 36.9%  

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.56 78.56 0.00 0.00 1.2612 0.0000 16971973.72 24950409.00 31.98 171292.20 171292.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.56 63.09% 158955.66 81023 190878 159104.12 130179 172699 7878572 11582247 31.98
crit 29.00 36.91% 313586.47 162046 381755 314141.01 253781 353124 9093402 13368162 31.98
 
 

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Warbreaker 5869 1.2% 4.4 70.34sec 403318 321606 Direct 4.4 302766 623643 403333 31.3%  

Stats details: warbreaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.36 4.36 0.00 0.00 1.2542 0.0000 1759829.11 1759829.11 0.00 321606.20 321606.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.00 68.66% 302766.03 160400 377878 301072.31 0 377878 907091 907091 0.00
crit 1.37 31.34% 623642.86 320801 755756 510373.95 0 755756 852738 852738 0.00
 
 

Action details: warbreaker

Static Values
  • id:209577
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:209577
  • name:Warbreaker
  • school:shadow
  • tooltip:
  • description:Stomp the ground, causing a ring of corrupted spikes to erupt upwards, dealing $sw1 Shadow damage and applying the Colossus Smash effect to all nearby enemies.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Simple Action Stats Execute Interval
Warrior_Arms_T19M
Arcane Torrent 3.7 91.26sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:69179
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.down&rage.deficit>40
Spelldata
  • id:69179
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and increase your Rage by {$/10;s2=15}. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T19M
  • harmful:false
  • if_expr:
 
Avatar 3.8 90.02sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 11.3 27.65sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:17.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T19M
  • harmful:false
  • if_expr:
 
Focused Rage 196.0 1.49sec

Stats details: focused_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: focused_rage

Static Values
  • id:207982
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
Spelldata
  • id:207982
  • name:Focused Rage
  • school:physical
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T19M
  • harmful:false
  • if_expr:
 
Heroic Leap 10.2 30.96sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.17 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 3.8 0.0 90.0sec 90.0sec 24.44% 24.44% 0.0(0.0) 3.6

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:24.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 11.3 0.0 27.6sec 27.6sec 18.69% 18.69% 0.0(0.0) 11.1

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:18.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bladestorm 2.0 0.0 122.9sec 122.9sec 1.14% 1.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_bladestorm
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladestorm_1:1.14%

Trigger Attempt Success

  • trigger_pct:98.13%

Spelldata details

  • id:227847
  • name:Bladestorm
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
  • max_stacks:0
  • duration:6.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupted Blood of Zakajz 11.3 0.0 27.6sec 27.6sec 18.69% 19.86% 0.0(0.0) 11.1

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_corrupted_blood_of_zakajz
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • corrupted_blood_of_zakajz_1:18.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209567
  • name:Corrupted Blood of Zakajz
  • tooltip:An additional {$s1=20}% of all damage dealt will be done to your enemies over {$209569d=6 seconds}.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Rage 63.3 132.6 4.6sec 1.5sec 73.53% 97.45% 29.8(29.8) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_focused_rage
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • focused_rage_1:32.82%
  • focused_rage_2:21.81%
  • focused_rage_3:18.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207982
  • name:Focused Rage
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
  • max_stacks:3
  • duration:30.00
  • cooldown:1.50
  • default_chance:100.00%
Horrific Appendages 6.2 2.2 47.2sec 33.5sec 30.51% 30.51% 121.9(121.9) 5.9

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:30.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 256.0sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Precise Strikes 58.5 0.0 5.2sec 5.2sec 30.17% 30.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_precise_strikes
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.60

Stack Uptimes

  • precise_strikes_1:30.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209493
  • name:Precise Strikes
  • tooltip:
  • description:{$@spelldesc209492=Colossus Smash reduces the Rage cost of your next Mortal Strike or Execute by {$s1=15}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shattered Defenses 58.5 0.0 5.2sec 5.2sec 30.17% 64.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_shattered_defenses
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • shattered_defenses_1:30.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209706
  • name:Shattered Defenses
  • tooltip:Damage and critical strike chance of your next Mortal Strike or Execute increased by {$s1=30}%.
  • description:{$@spelldesc209574=After using Colossus Smash, your next Mortal Strike or Execute gains {$209706s1=30}% increased critical strike chance and deals {$209706s2=30}% additional damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Battle Cry1.4610.0019.2658.4190.00026.761
Avatar0.7750.0012.4440.0370.0002.976
Heroic Leap1.0960.00123.9118.8261.50546.442
Focused Rage4.0610.00138.71644.30917.07085.025
Colossus Smash1.0730.0016.72556.70821.230108.073
Warbreaker11.0860.001119.39234.7760.000151.363
Mortal Strike1.4560.00114.54891.81344.344152.347
Bladestorm34.3490.004252.26134.1810.000252.261

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Arms_T19M
execute Rage 26.6 510.3 19.2 19.2 36568.3
focused_rage Rage 196.0 1843.4 9.4 9.4 0.0
mortal_strike Rage 64.3 408.3 6.4 6.4 128482.3
slam Rage 78.6 972.8 12.4 12.4 17446.4
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 20.00 (0.53%) 20.00 0.00 0.00%
arcane_torrent Rage 3.72 55.86 (1.47%) 15.00 0.00 0.00%
archavons_heavy_hand Rage 64.28 941.76 (24.75%) 14.65 22.48 2.33%
melee_crit Rage 33.94 1178.71 (30.97%) 34.73 73.58 5.88%
melee_main_hand Rage 65.35 1609.43 (42.29%) 24.63 37.32 2.27%
Resource RPS-Gain RPS-Loss
Rage 12.66 12.43
Combat End Resource Mean Min Max
Rage 71.02 0.00 130.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 3.1%

Procs

Count Interval
tactician 61.7 4.9sec

Statistics & Data Analysis

Fight Length
Sample Data Warrior_Arms_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Warrior_Arms_T19M Damage Per Second
Count 7499
Mean 509627.05
Minimum 413960.72
Maximum 612180.13
Spread ( max - min ) 198219.41
Range [ ( max - min ) / 2 * 100% ] 19.45%
Standard Deviation 25704.3667
5th Percentile 466264.94
95th Percentile 551808.22
( 95th Percentile - 5th Percentile ) 85543.27
Mean Distribution
Standard Deviation 296.8283
95.00% Confidence Intervall ( 509045.27 - 510208.82 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 97
0.1% Error 9772
0.1 Scale Factor Error with Delta=300 5640238
0.05 Scale Factor Error with Delta=300 22560954
0.01 Scale Factor Error with Delta=300 564023873
Priority Target DPS
Sample Data Warrior_Arms_T19M Priority Target Damage Per Second
Count 7499
Mean 509627.05
Minimum 413960.72
Maximum 612180.13
Spread ( max - min ) 198219.41
Range [ ( max - min ) / 2 * 100% ] 19.45%
Standard Deviation 25704.3667
5th Percentile 466264.94
95th Percentile 551808.22
( 95th Percentile - 5th Percentile ) 85543.27
Mean Distribution
Standard Deviation 296.8283
95.00% Confidence Intervall ( 509045.27 - 510208.82 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 97
0.1% Error 9772
0.1 Scale Factor Error with Delta=300 5640238
0.05 Scale Factor Error with Delta=300 22560954
0.01 Scale Factor Error with Delta=300 564023873
DPS(e)
Sample Data Warrior_Arms_T19M Damage Per Second (Effective)
Count 7499
Mean 509627.05
Minimum 413960.72
Maximum 612180.13
Spread ( max - min ) 198219.41
Range [ ( max - min ) / 2 * 100% ] 19.45%
Damage
Sample Data Warrior_Arms_T19M Damage
Count 7499
Mean 152844974.37
Minimum 102476521.74
Maximum 201940051.89
Spread ( max - min ) 99463530.14
Range [ ( max - min ) / 2 * 100% ] 32.54%
DTPS
Sample Data Warrior_Arms_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Warrior_Arms_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Warrior_Arms_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Warrior_Arms_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Warrior_Arms_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Warrior_Arms_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Warrior_Arms_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Warrior_Arms_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
0.00 blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
0.00 berserking,if=buff.battle_cry.up|target.time_to_die<=11
8 3.72 arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
9 11.30 battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
A 3.80 avatar,if=(buff.bloodlust.up|time>=1)
B 10.17 heroic_leap,if=debuff.colossus_smash.up
0.00 rend,if=remains<gcd
C 39.08 focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
D 7.86 colossus_smash,if=debuff.colossus_smash.down
E 0.79 warbreaker,if=debuff.colossus_smash.down
0.00 ravager
0.00 overpower,if=buff.overpower.react
F 0.00 run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
G 0.00 run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
H 0.00 run_action_list,name=execute,if=target.health.pct<=20
I 0.00 run_action_list,name=single,if=target.health.pct>20
actions.execute
# count action,conditions
J 1.89 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
K 4.82 execute,if=buff.battle_cry_deadly_calm.up
L 8.58 colossus_smash,if=buff.shattered_defenses.down
M 0.27 warbreaker,if=buff.shattered_defenses.down&rage<=30
N 9.26 execute,if=buff.shattered_defenses.up&rage>22
O 3.24 mortal_strike,if=equipped.archavons_heavy_hand&rage<60
P 12.55 execute,if=buff.shattered_defenses.down
Q 0.14 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single
# count action,conditions
R 4.52 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
S 37.74 colossus_smash,if=buff.shattered_defenses.down
T 3.30 warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
U 66.57 focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
V 54.64 mortal_strike
0.00 execute,if=buff.stone_heart.react
W 78.56 slam
0.00 execute,if=equipped.archavons_heavy_hand
X 90.29 focused_rage,if=equipped.archavons_heavy_hand
Y 1.88 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

Sample Sequence

0124568ADUX9BVCSCVCWCWUTXVXSUVUWUWXSXVUWUWXWXSXVXSXVXWXSXVXSX9VCSCWCVCSCWUBWXVUWXSUVUWUWXWXVXWXWXYVXXDXVXSX9VCWCSCRXSUVUWUWUBWXVUWXWXEXVXSXWXXVXSXVX9WCWCWCRUWUWUWXVXWXWAX8DXBVXWXSXVXWSXVXWXWXSX9VCSCVCWUWUWXVXWXWWXVXXWXEXBVXSXVXWY9CSCVCWCWUWXVUWUWXDXVUWUWXWXVXWXXDBVXXSX9VCSCVCRXSUVXSUVXSUVUWUWUWXVUWAX8WXDXVUSUVXWXBSX9VCSCVCRXSUWUWXVUWUWUTXVUWUWXWXVXSXVXW9CSCVCSCBRXSUWUWXVXSUVUWUWXSXVUWXSXVUWPP97CKCJCDCKPLBNPLNLNPLNLNPLNLAN8LNPL9CKCKCJCBKLNPPLNPLNL

Sample Sequence Table

time name target resources buffs
Pre flask Warrior_Arms_T19M 0.0/130: 0% rage
Pre food Warrior_Arms_T19M 0.0/130: 0% rage
Pre augmentation Warrior_Arms_T19M 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 charge Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 20.0/130: 15% rage bloodlust, potion_of_the_old_war
0:00.000 arcane_torrent Fluffy_Pillow 45.2/130: 35% rage bloodlust, potion_of_the_old_war
0:00.000 avatar Fluffy_Pillow 60.2/130: 46% rage bloodlust, potion_of_the_old_war
0:00.000 colossus_smash Fluffy_Pillow 60.2/130: 46% rage bloodlust, avatar, potion_of_the_old_war
0:00.000 focused_rage Fluffy_Pillow 48.2/130: 37% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.014 focused_rage Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.018 battle_cry Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:01.018 heroic_leap Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:01.018 mortal_strike Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:02.028 focused_rage Fluffy_Pillow 51.2/130: 39% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:02.037 colossus_smash Fluffy_Pillow 51.2/130: 39% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:03.042 focused_rage Fluffy_Pillow 88.8/130: 68% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:03.056 mortal_strike Fluffy_Pillow 88.8/130: 68% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
0:04.056 focused_rage Fluffy_Pillow 103.8/130: 80% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:04.074 slam Fluffy_Pillow 103.8/130: 80% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
0:05.070 focused_rage Fluffy_Pillow 130.0/130: 100% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
0:05.092 slam Fluffy_Pillow 130.0/130: 100% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
0:06.084 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:06.110 warbreaker Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage(3), potion_of_the_old_war
0:07.098 focused_rage Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:07.129 mortal_strike Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:08.112 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:08.148 colossus_smash Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:09.126 focused_rage Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:09.167 mortal_strike Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:10.140 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:10.186 slam Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:11.154 focused_rage Fluffy_Pillow 90.0/130: 69% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:11.205 slam Fluffy_Pillow 90.0/130: 69% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:12.168 focused_rage Fluffy_Pillow 62.0/130: 48% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:12.223 colossus_smash Fluffy_Pillow 87.2/130: 67% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:13.182 focused_rage Fluffy_Pillow 75.2/130: 58% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:13.240 mortal_strike Fluffy_Pillow 75.2/130: 58% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:14.196 focused_rage Fluffy_Pillow 71.8/130: 55% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:14.258 slam Fluffy_Pillow 71.8/130: 55% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:15.210 focused_rage Fluffy_Pillow 69.0/130: 53% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:15.277 slam Fluffy_Pillow 69.0/130: 53% rage bloodlust, avatar, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:16.224 focused_rage Fluffy_Pillow 41.0/130: 32% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:16.295 slam Fluffy_Pillow 41.0/130: 32% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:17.238 focused_rage Fluffy_Pillow 38.2/130: 29% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:17.313 colossus_smash Fluffy_Pillow 38.2/130: 29% rage bloodlust, avatar, focused_rage(3), horrific_appendages, potion_of_the_old_war
0:18.252 focused_rage Fluffy_Pillow 26.2/130: 20% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:18.331 mortal_strike Fluffy_Pillow 26.2/130: 20% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:19.266 focused_rage Fluffy_Pillow 22.8/130: 18% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:19.349 colossus_smash Fluffy_Pillow 22.8/130: 18% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:20.280 focused_rage Fluffy_Pillow 36.0/130: 28% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:20.367 mortal_strike Fluffy_Pillow 36.0/130: 28% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:21.294 focused_rage Fluffy_Pillow 32.6/130: 25% rage bloodlust, focused_rage, horrific_appendages, potion_of_the_old_war
0:21.385 slam Fluffy_Pillow 32.6/130: 25% rage bloodlust, focused_rage, horrific_appendages, potion_of_the_old_war
0:22.308 focused_rage Fluffy_Pillow 29.8/130: 23% rage bloodlust, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:22.402 colossus_smash Fluffy_Pillow 29.8/130: 23% rage bloodlust, focused_rage(2), horrific_appendages, potion_of_the_old_war
0:23.322 focused_rage Fluffy_Pillow 17.8/130: 14% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
0:23.421 mortal_strike Fluffy_Pillow 17.8/130: 14% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
0:24.336 focused_rage Fluffy_Pillow 14.4/130: 11% rage bloodlust, focused_rage, horrific_appendages
0:24.441 colossus_smash Fluffy_Pillow 39.6/130: 30% rage bloodlust, focused_rage, horrific_appendages
0:25.350 focused_rage Fluffy_Pillow 27.6/130: 21% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
0:25.460 battle_cry Fluffy_Pillow 27.6/130: 21% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
0:25.460 mortal_strike Fluffy_Pillow 27.6/130: 21% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
0:26.364 focused_rage Fluffy_Pillow 42.6/130: 33% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
0:26.479 colossus_smash Fluffy_Pillow 42.6/130: 33% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
0:27.378 focused_rage Fluffy_Pillow 80.4/130: 62% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
0:27.499 slam Fluffy_Pillow 80.4/130: 62% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
0:28.392 focused_rage Fluffy_Pillow 80.4/130: 62% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
0:28.517 mortal_strike Fluffy_Pillow 80.4/130: 62% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
0:29.406 focused_rage Fluffy_Pillow 130.0/130: 100% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
0:29.535 colossus_smash Fluffy_Pillow 130.0/130: 100% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
0:30.420 focused_rage Fluffy_Pillow 130.0/130: 100% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
0:30.553 slam Fluffy_Pillow 130.0/130: 100% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
0:31.434 focused_rage Fluffy_Pillow 102.0/130: 78% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
0:31.571 heroic_leap Fluffy_Pillow 102.0/130: 78% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
0:31.571 slam Fluffy_Pillow 102.0/130: 78% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
0:32.448 focused_rage Fluffy_Pillow 99.2/130: 76% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
0:32.589 mortal_strike Fluffy_Pillow 99.2/130: 76% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
0:33.462 focused_rage Fluffy_Pillow 95.8/130: 74% rage bloodlust, focused_rage, horrific_appendages
0:33.608 slam Fluffy_Pillow 95.8/130: 74% rage bloodlust, focused_rage, horrific_appendages
0:34.476 focused_rage Fluffy_Pillow 93.0/130: 72% rage bloodlust, focused_rage(2), horrific_appendages
0:34.627 colossus_smash Fluffy_Pillow 93.0/130: 72% rage bloodlust, focused_rage(2), horrific_appendages
0:35.490 focused_rage Fluffy_Pillow 81.0/130: 62% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
0:35.646 mortal_strike Fluffy_Pillow 81.0/130: 62% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
0:36.504 focused_rage Fluffy_Pillow 77.6/130: 60% rage bloodlust, focused_rage, horrific_appendages
0:36.664 slam Fluffy_Pillow 102.8/130: 79% rage bloodlust, focused_rage, horrific_appendages
0:37.518 focused_rage Fluffy_Pillow 74.8/130: 58% rage bloodlust, focused_rage(2), horrific_appendages
0:37.683 slam Fluffy_Pillow 74.8/130: 58% rage bloodlust, focused_rage(2), horrific_appendages
0:38.532 focused_rage Fluffy_Pillow 46.8/130: 36% rage bloodlust, focused_rage(3), horrific_appendages
0:38.701 slam Fluffy_Pillow 46.8/130: 36% rage bloodlust, focused_rage(3), horrific_appendages
0:39.546 focused_rage Fluffy_Pillow 55.3/130: 43% rage bloodlust, focused_rage(3)
0:39.720 mortal_strike Fluffy_Pillow 55.3/130: 43% rage bloodlust, focused_rage(3)
0:40.728 focused_rage Fluffy_Pillow 42.3/130: 33% rage focused_rage
0:40.956 slam Fluffy_Pillow 42.3/130: 33% rage focused_rage
0:42.046 focused_rage Fluffy_Pillow 39.5/130: 30% rage focused_rage(2)
0:42.279 slam Fluffy_Pillow 39.5/130: 30% rage focused_rage(2)
0:43.364 focused_rage Fluffy_Pillow 11.5/130: 9% rage focused_rage(3)
0:43.603 bladestorm Fluffy_Pillow 11.5/130: 9% rage focused_rage(3)
0:45.558 mortal_strike Fluffy_Pillow 36.7/130: 28% rage focused_rage(3)
0:45.558 focused_rage Fluffy_Pillow 23.7/130: 18% rage focused_rage
0:46.876 focused_rage Fluffy_Pillow 11.7/130: 9% rage focused_rage(2)
0:46.880 colossus_smash Fluffy_Pillow 11.7/130: 9% rage focused_rage(2)
0:48.194 focused_rage Fluffy_Pillow 24.9/130: 19% rage focused_rage(3), precise_strikes, shattered_defenses
0:48.202 mortal_strike Fluffy_Pillow 24.9/130: 19% rage focused_rage(3), precise_strikes, shattered_defenses
0:49.512 focused_rage Fluffy_Pillow 21.5/130: 17% rage focused_rage
0:49.525 colossus_smash Fluffy_Pillow 21.5/130: 17% rage focused_rage
0:50.830 focused_rage Fluffy_Pillow 9.5/130: 7% rage focused_rage(2), precise_strikes, shattered_defenses
0:50.848 battle_cry Fluffy_Pillow 9.5/130: 7% rage focused_rage(2), precise_strikes, shattered_defenses
0:50.848 mortal_strike Fluffy_Pillow 9.5/130: 7% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
0:52.148 focused_rage Fluffy_Pillow 61.2/130: 47% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
0:52.170 slam Fluffy_Pillow 61.2/130: 47% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
0:53.466 focused_rage Fluffy_Pillow 61.2/130: 47% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:53.491 colossus_smash Fluffy_Pillow 61.2/130: 47% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:54.784 focused_rage Fluffy_Pillow 97.5/130: 75% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:54.811 mortal_strike Fluffy_Pillow 97.5/130: 75% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:56.102 focused_rage Fluffy_Pillow 100.5/130: 77% rage focused_rage
0:56.133 colossus_smash Fluffy_Pillow 100.5/130: 77% rage focused_rage
0:57.420 focused_rage Fluffy_Pillow 88.5/130: 68% rage focused_rage(2), precise_strikes, shattered_defenses
0:57.455 mortal_strike Fluffy_Pillow 88.5/130: 68% rage focused_rage(2), precise_strikes, shattered_defenses
0:58.738 focused_rage Fluffy_Pillow 110.3/130: 85% rage focused_rage
0:58.779 slam Fluffy_Pillow 110.3/130: 85% rage focused_rage
1:00.056 focused_rage Fluffy_Pillow 82.3/130: 63% rage focused_rage(2)
1:00.103 slam Fluffy_Pillow 82.3/130: 63% rage focused_rage(2)
1:01.374 focused_rage Fluffy_Pillow 79.5/130: 61% rage focused_rage(3)
1:01.425 heroic_leap Fluffy_Pillow 79.5/130: 61% rage focused_rage(3)
1:01.571 slam Fluffy_Pillow 79.5/130: 61% rage focused_rage(3)
1:02.692 focused_rage Fluffy_Pillow 51.5/130: 40% rage focused_rage(3)
1:02.894 mortal_strike Fluffy_Pillow 51.5/130: 40% rage focused_rage(3)
1:04.010 focused_rage Fluffy_Pillow 63.7/130: 49% rage focused_rage
1:04.217 slam Fluffy_Pillow 63.7/130: 49% rage focused_rage
1:05.328 focused_rage Fluffy_Pillow 35.7/130: 27% rage focused_rage(2)
1:05.539 slam Fluffy_Pillow 35.7/130: 27% rage focused_rage(2)
1:06.646 focused_rage Fluffy_Pillow 7.7/130: 6% rage focused_rage(3)
1:06.862 warbreaker Fluffy_Pillow 7.7/130: 6% rage focused_rage(3)
1:07.964 focused_rage Fluffy_Pillow 20.9/130: 16% rage focused_rage(3), precise_strikes, shattered_defenses
1:08.184 mortal_strike Fluffy_Pillow 20.9/130: 16% rage focused_rage(3), precise_strikes, shattered_defenses
1:09.282 focused_rage Fluffy_Pillow 17.5/130: 13% rage focused_rage
1:09.507 colossus_smash Fluffy_Pillow 17.5/130: 13% rage focused_rage
1:10.600 focused_rage Fluffy_Pillow 43.1/130: 33% rage focused_rage(2), precise_strikes, shattered_defenses
1:10.830 slam Fluffy_Pillow 43.1/130: 33% rage focused_rage(2), precise_strikes, shattered_defenses
1:11.918 focused_rage Fluffy_Pillow 15.1/130: 12% rage focused_rage(3), precise_strikes, shattered_defenses
1:12.153 Waiting 0.900 sec 15.1/130: 12% rage focused_rage(3), precise_strikes, shattered_defenses
1:13.053 focused_rage Fluffy_Pillow 15.1/130: 12% rage focused_rage(3), precise_strikes, shattered_defenses
1:13.236 Waiting 0.200 sec 3.1/130: 2% rage focused_rage(3), precise_strikes, shattered_defenses
1:13.436 mortal_strike Fluffy_Pillow 28.3/130: 22% rage focused_rage(3), precise_strikes, shattered_defenses
1:14.554 focused_rage Fluffy_Pillow 24.9/130: 19% rage focused_rage
1:14.779 colossus_smash Fluffy_Pillow 24.9/130: 19% rage focused_rage
1:15.872 focused_rage Fluffy_Pillow 12.9/130: 10% rage focused_rage(2), precise_strikes, shattered_defenses
1:16.103 mortal_strike Fluffy_Pillow 12.9/130: 10% rage focused_rage(2), precise_strikes, shattered_defenses
1:17.190 focused_rage Fluffy_Pillow 34.7/130: 27% rage focused_rage
1:17.425 battle_cry Fluffy_Pillow 34.7/130: 27% rage focused_rage
1:17.425 slam Fluffy_Pillow 34.7/130: 27% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:18.508 focused_rage Fluffy_Pillow 34.7/130: 27% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:18.749 slam Fluffy_Pillow 34.7/130: 27% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:19.826 focused_rage Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
1:20.073 slam Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
1:21.144 focused_rage Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
1:21.394 mortal_strike Fluffy_Pillow 71.2/130: 55% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
1:22.462 focused_rage Fluffy_Pillow 74.2/130: 57% rage focused_rage
1:22.716 slam Fluffy_Pillow 74.2/130: 57% rage focused_rage
1:23.780 focused_rage Fluffy_Pillow 83.3/130: 64% rage focused_rage(2)
1:24.039 slam Fluffy_Pillow 83.3/130: 64% rage focused_rage(2)
1:25.098 focused_rage Fluffy_Pillow 55.3/130: 43% rage focused_rage(3)
1:25.362 slam Fluffy_Pillow 55.3/130: 43% rage focused_rage(3)
1:26.416 focused_rage Fluffy_Pillow 52.5/130: 40% rage focused_rage(3)
1:26.685 mortal_strike Fluffy_Pillow 52.5/130: 40% rage focused_rage(3)
1:27.734 focused_rage Fluffy_Pillow 39.5/130: 30% rage focused_rage
1:28.007 slam Fluffy_Pillow 39.5/130: 30% rage focused_rage
1:29.052 focused_rage Fluffy_Pillow 11.5/130: 9% rage focused_rage(2)
1:29.330 slam Fluffy_Pillow 36.7/130: 28% rage focused_rage(2)
1:30.000 avatar Fluffy_Pillow 20.7/130: 16% rage avatar, focused_rage(2)
1:30.370 focused_rage Fluffy_Pillow 8.7/130: 7% rage avatar, focused_rage(3)
1:30.653 arcane_torrent Fluffy_Pillow 8.7/130: 7% rage avatar, focused_rage(3)
1:30.653 colossus_smash Fluffy_Pillow 23.7/130: 18% rage avatar, focused_rage(3)
1:31.688 focused_rage Fluffy_Pillow 11.7/130: 9% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:31.975 heroic_leap Fluffy_Pillow 11.7/130: 9% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:31.975 mortal_strike Fluffy_Pillow 11.7/130: 9% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:33.006 focused_rage Fluffy_Pillow 33.5/130: 26% rage avatar, focused_rage
1:33.298 slam Fluffy_Pillow 33.5/130: 26% rage avatar, focused_rage
1:34.324 focused_rage Fluffy_Pillow 5.5/130: 4% rage avatar, focused_rage(2)
1:34.620 colossus_smash Fluffy_Pillow 5.5/130: 4% rage avatar, focused_rage(2)
1:35.642 focused_rage Fluffy_Pillow 30.0/130: 23% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:35.943 mortal_strike Fluffy_Pillow 30.0/130: 23% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:36.960 focused_rage Fluffy_Pillow 26.6/130: 20% rage avatar, focused_rage
1:37.266 slam Fluffy_Pillow 26.6/130: 20% rage avatar, focused_rage
1:38.589 colossus_smash Fluffy_Pillow 10.6/130: 8% rage avatar, focused_rage
1:38.789 focused_rage Fluffy_Pillow 23.8/130: 18% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:39.911 mortal_strike Fluffy_Pillow 23.8/130: 18% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:40.107 focused_rage Fluffy_Pillow 20.4/130: 16% rage avatar, focused_rage
1:41.233 slam Fluffy_Pillow 20.4/130: 16% rage avatar, focused_rage
1:41.933 focused_rage Fluffy_Pillow 29.2/130: 22% rage avatar, focused_rage(2)
1:42.556 slam Fluffy_Pillow 29.2/130: 22% rage avatar, focused_rage(2)
1:43.251 focused_rage Fluffy_Pillow 1.2/130: 1% rage avatar, focused_rage(3)
1:43.878 colossus_smash Fluffy_Pillow 1.2/130: 1% rage avatar, focused_rage(3)
1:45.078 focused_rage Fluffy_Pillow 14.4/130: 11% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:45.201 battle_cry Fluffy_Pillow 14.4/130: 11% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:45.201 mortal_strike Fluffy_Pillow 14.4/130: 11% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
1:46.396 focused_rage Fluffy_Pillow 29.4/130: 23% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
1:46.525 colossus_smash Fluffy_Pillow 29.4/130: 23% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
1:47.714 focused_rage Fluffy_Pillow 29.4/130: 23% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:47.846 mortal_strike Fluffy_Pillow 29.4/130: 23% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
1:49.032 focused_rage Fluffy_Pillow 81.8/130: 63% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
1:49.167 slam Fluffy_Pillow 81.8/130: 63% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
1:50.350 focused_rage Fluffy_Pillow 69.8/130: 54% rage focused_rage(2), horrific_appendages
1:50.490 slam Fluffy_Pillow 69.8/130: 54% rage focused_rage(2), horrific_appendages
1:51.668 focused_rage Fluffy_Pillow 67.0/130: 52% rage focused_rage(3), horrific_appendages
1:51.814 slam Fluffy_Pillow 67.0/130: 52% rage focused_rage(3), horrific_appendages
1:52.986 focused_rage Fluffy_Pillow 39.0/130: 30% rage focused_rage(3), horrific_appendages
1:53.137 mortal_strike Fluffy_Pillow 39.0/130: 30% rage focused_rage(3), horrific_appendages
1:54.304 focused_rage Fluffy_Pillow 26.0/130: 20% rage focused_rage, horrific_appendages
1:54.461 slam Fluffy_Pillow 26.0/130: 20% rage focused_rage, horrific_appendages
1:55.622 focused_rage Fluffy_Pillow 23.2/130: 18% rage focused_rage(2), horrific_appendages
1:55.784 slam Fluffy_Pillow 23.2/130: 18% rage focused_rage(2), horrific_appendages
1:57.105 Waiting 0.700 sec 7.2/130: 6% rage focused_rage(2), horrific_appendages
1:57.805 slam Fluffy_Pillow 32.4/130: 25% rage focused_rage(2), horrific_appendages
1:57.805 focused_rage Fluffy_Pillow 4.4/130: 3% rage focused_rage(3), horrific_appendages
1:59.129 Waiting 1.800 sec 4.4/130: 3% rage focused_rage(3), horrific_appendages
2:00.929 mortal_strike Fluffy_Pillow 29.6/130: 23% rage focused_rage(3), horrific_appendages
2:00.929 focused_rage Fluffy_Pillow 16.6/130: 13% rage focused_rage, horrific_appendages
2:02.247 focused_rage Fluffy_Pillow 4.6/130: 4% rage focused_rage(2), horrific_appendages
2:02.252 Waiting 1.900 sec 4.6/130: 4% rage focused_rage(2), horrific_appendages
2:04.152 slam Fluffy_Pillow 29.8/130: 23% rage focused_rage(2), horrific_appendages
2:04.152 focused_rage Fluffy_Pillow 1.8/130: 1% rage focused_rage(3), horrific_appendages
2:05.475 Waiting 1.200 sec 1.8/130: 1% rage focused_rage(3), horrific_appendages
2:06.675 warbreaker Fluffy_Pillow 1.8/130: 1% rage focused_rage(3), horrific_appendages
2:07.262 focused_rage Fluffy_Pillow 15.0/130: 12% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:08.183 heroic_leap Fluffy_Pillow 15.0/130: 12% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:08.183 mortal_strike Fluffy_Pillow 15.0/130: 12% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:08.580 focused_rage Fluffy_Pillow 11.6/130: 9% rage focused_rage, horrific_appendages
2:09.507 colossus_smash Fluffy_Pillow 11.6/130: 9% rage focused_rage, horrific_appendages
2:10.407 focused_rage Fluffy_Pillow 24.8/130: 19% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
2:10.830 mortal_strike Fluffy_Pillow 24.8/130: 19% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
2:11.725 focused_rage Fluffy_Pillow 21.4/130: 16% rage focused_rage, horrific_appendages
2:12.153 slam Fluffy_Pillow 21.4/130: 16% rage focused_rage, horrific_appendages
2:13.476 bladestorm Fluffy_Pillow 5.4/130: 4% rage focused_rage
2:15.695 battle_cry Fluffy_Pillow 30.6/130: 24% rage focused_rage
2:15.695 focused_rage Fluffy_Pillow 30.6/130: 24% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:15.695 colossus_smash Fluffy_Pillow 30.6/130: 24% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:17.013 focused_rage Fluffy_Pillow 68.0/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:17.018 mortal_strike Fluffy_Pillow 68.0/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:18.331 focused_rage Fluffy_Pillow 83.0/130: 64% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:18.342 slam Fluffy_Pillow 83.0/130: 64% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:19.649 focused_rage Fluffy_Pillow 83.0/130: 64% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:19.665 slam Fluffy_Pillow 83.0/130: 64% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:20.967 focused_rage Fluffy_Pillow 107.1/130: 82% rage focused_rage(3)
2:20.988 slam Fluffy_Pillow 107.1/130: 82% rage focused_rage(3)
2:22.285 focused_rage Fluffy_Pillow 79.1/130: 61% rage focused_rage(3)
2:22.309 mortal_strike Fluffy_Pillow 79.1/130: 61% rage focused_rage(3)
2:23.603 focused_rage Fluffy_Pillow 91.3/130: 70% rage focused_rage
2:23.629 slam Fluffy_Pillow 91.3/130: 70% rage focused_rage
2:24.921 focused_rage Fluffy_Pillow 63.3/130: 49% rage focused_rage(2)
2:24.949 slam Fluffy_Pillow 63.3/130: 49% rage focused_rage(2)
2:26.239 focused_rage Fluffy_Pillow 72.0/130: 55% rage focused_rage(3)
2:26.270 colossus_smash Fluffy_Pillow 72.0/130: 55% rage focused_rage(3)
2:27.557 focused_rage Fluffy_Pillow 60.0/130: 46% rage focused_rage(3), precise_strikes, shattered_defenses
2:27.592 mortal_strike Fluffy_Pillow 60.0/130: 46% rage focused_rage(3), precise_strikes, shattered_defenses
2:28.875 focused_rage Fluffy_Pillow 56.6/130: 44% rage focused_rage
2:28.912 slam Fluffy_Pillow 56.6/130: 44% rage focused_rage
2:30.193 focused_rage Fluffy_Pillow 53.8/130: 41% rage focused_rage(2)
2:30.236 slam Fluffy_Pillow 53.8/130: 41% rage focused_rage(2)
2:31.511 focused_rage Fluffy_Pillow 25.8/130: 20% rage focused_rage(3)
2:31.559 slam Fluffy_Pillow 25.8/130: 20% rage focused_rage(3)
2:32.829 focused_rage Fluffy_Pillow 23.0/130: 18% rage focused_rage(3)
2:32.883 mortal_strike Fluffy_Pillow 23.0/130: 18% rage focused_rage(3)
2:34.147 focused_rage Fluffy_Pillow 10.0/130: 8% rage focused_rage
2:34.205 Waiting 1.500 sec 10.0/130: 8% rage focused_rage
2:35.705 slam Fluffy_Pillow 47.3/130: 36% rage focused_rage
2:35.705 focused_rage Fluffy_Pillow 19.3/130: 15% rage focused_rage(2)
2:37.023 focused_rage Fluffy_Pillow 7.3/130: 6% rage focused_rage(3)
2:37.028 colossus_smash Fluffy_Pillow 7.3/130: 6% rage focused_rage(3)
2:38.349 heroic_leap Fluffy_Pillow 7.3/130: 6% rage focused_rage(3), precise_strikes, shattered_defenses
2:38.349 mortal_strike Fluffy_Pillow 7.3/130: 6% rage focused_rage(3), precise_strikes, shattered_defenses
2:38.349 focused_rage Fluffy_Pillow 3.9/130: 3% rage focused_rage
2:39.667 focused_rage Fluffy_Pillow 17.1/130: 13% rage focused_rage(2)
2:39.671 colossus_smash Fluffy_Pillow 17.1/130: 13% rage focused_rage(2)
2:40.985 focused_rage Fluffy_Pillow 5.1/130: 4% rage focused_rage(3), precise_strikes, shattered_defenses
2:40.992 battle_cry Fluffy_Pillow 5.1/130: 4% rage focused_rage(3), precise_strikes, shattered_defenses
2:40.992 mortal_strike Fluffy_Pillow 5.1/130: 4% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:42.303 focused_rage Fluffy_Pillow 56.9/130: 44% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:42.314 colossus_smash Fluffy_Pillow 56.9/130: 44% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:43.621 focused_rage Fluffy_Pillow 56.9/130: 44% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:43.636 mortal_strike Fluffy_Pillow 56.9/130: 44% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:44.939 focused_rage Fluffy_Pillow 71.9/130: 55% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:44.957 mortal_strike Fluffy_Pillow 71.9/130: 55% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:46.257 focused_rage Fluffy_Pillow 111.7/130: 86% rage focused_rage
2:46.279 colossus_smash Fluffy_Pillow 111.7/130: 86% rage focused_rage
2:47.575 focused_rage Fluffy_Pillow 99.7/130: 77% rage focused_rage(2), precise_strikes, shattered_defenses
2:47.602 mortal_strike Fluffy_Pillow 99.7/130: 77% rage focused_rage(2), precise_strikes, shattered_defenses
2:48.893 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage
2:48.925 colossus_smash Fluffy_Pillow 118.0/130: 91% rage focused_rage
2:50.211 focused_rage Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
2:50.248 mortal_strike Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
2:51.529 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage
2:51.570 colossus_smash Fluffy_Pillow 118.0/130: 91% rage focused_rage
2:52.847 focused_rage Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
2:52.892 mortal_strike Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
2:54.165 focused_rage Fluffy_Pillow 102.6/130: 79% rage focused_rage
2:54.216 slam Fluffy_Pillow 102.6/130: 79% rage focused_rage
2:55.483 focused_rage Fluffy_Pillow 99.8/130: 77% rage focused_rage(2)
2:55.538 slam Fluffy_Pillow 99.8/130: 77% rage focused_rage(2)
2:56.801 focused_rage Fluffy_Pillow 71.8/130: 55% rage focused_rage(3)
2:56.859 slam Fluffy_Pillow 71.8/130: 55% rage focused_rage(3)
2:58.119 focused_rage Fluffy_Pillow 69.0/130: 53% rage focused_rage(3)
2:58.181 mortal_strike Fluffy_Pillow 69.0/130: 53% rage focused_rage(3)
2:59.437 focused_rage Fluffy_Pillow 56.0/130: 43% rage focused_rage
2:59.504 slam Fluffy_Pillow 56.0/130: 43% rage focused_rage
3:00.000 avatar Fluffy_Pillow 40.0/130: 31% rage avatar, focused_rage
3:00.755 focused_rage Fluffy_Pillow 28.0/130: 22% rage avatar, focused_rage(2)
3:00.827 arcane_torrent Fluffy_Pillow 28.0/130: 22% rage avatar, focused_rage(2)
3:00.827 slam Fluffy_Pillow 43.0/130: 33% rage avatar, focused_rage(2)
3:02.073 focused_rage Fluffy_Pillow 40.2/130: 31% rage avatar, focused_rage(3)
3:02.148 colossus_smash Fluffy_Pillow 40.2/130: 31% rage avatar, focused_rage(3)
3:03.391 focused_rage Fluffy_Pillow 28.2/130: 22% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:03.471 mortal_strike Fluffy_Pillow 28.2/130: 22% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:04.709 focused_rage Fluffy_Pillow 60.8/130: 47% rage avatar, focused_rage
3:04.793 colossus_smash Fluffy_Pillow 60.8/130: 47% rage avatar, focused_rage
3:06.027 focused_rage Fluffy_Pillow 48.8/130: 38% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
3:06.116 mortal_strike Fluffy_Pillow 48.8/130: 38% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
3:07.345 focused_rage Fluffy_Pillow 70.6/130: 54% rage avatar, focused_rage, horrific_appendages
3:07.438 slam Fluffy_Pillow 70.6/130: 54% rage avatar, focused_rage, horrific_appendages
3:08.663 focused_rage Fluffy_Pillow 42.6/130: 33% rage avatar, focused_rage(2), horrific_appendages
3:08.763 heroic_leap Fluffy_Pillow 42.6/130: 33% rage avatar, focused_rage(2), horrific_appendages
3:08.763 colossus_smash Fluffy_Pillow 42.6/130: 33% rage avatar, focused_rage(2), horrific_appendages
3:09.981 focused_rage Fluffy_Pillow 30.6/130: 24% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:10.085 battle_cry Fluffy_Pillow 30.6/130: 24% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:10.085 mortal_strike Fluffy_Pillow 30.6/130: 24% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
3:11.299 focused_rage Fluffy_Pillow 82.2/130: 63% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
3:11.407 colossus_smash Fluffy_Pillow 82.2/130: 63% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
3:12.617 focused_rage Fluffy_Pillow 82.2/130: 63% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
3:12.730 mortal_strike Fluffy_Pillow 82.2/130: 63% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
3:13.935 focused_rage Fluffy_Pillow 130.0/130: 100% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
3:14.052 mortal_strike Fluffy_Pillow 130.0/130: 100% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
3:15.253 focused_rage Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage, horrific_appendages
3:15.374 colossus_smash Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage, horrific_appendages
3:16.571 focused_rage Fluffy_Pillow 106.0/130: 82% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
3:16.697 slam Fluffy_Pillow 106.0/130: 82% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
3:17.889 focused_rage Fluffy_Pillow 103.2/130: 79% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:18.018 slam Fluffy_Pillow 103.2/130: 79% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:19.207 focused_rage Fluffy_Pillow 75.2/130: 58% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:19.341 mortal_strike Fluffy_Pillow 75.2/130: 58% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:20.525 focused_rage Fluffy_Pillow 108.7/130: 84% rage focused_rage
3:20.665 slam Fluffy_Pillow 108.7/130: 84% rage focused_rage
3:21.843 focused_rage Fluffy_Pillow 80.7/130: 62% rage focused_rage(2)
3:21.988 slam Fluffy_Pillow 80.7/130: 62% rage focused_rage(2)
3:23.161 focused_rage Fluffy_Pillow 77.9/130: 60% rage focused_rage(3)
3:23.310 warbreaker Fluffy_Pillow 77.9/130: 60% rage focused_rage(3)
3:24.479 focused_rage Fluffy_Pillow 65.9/130: 51% rage focused_rage(3), precise_strikes, shattered_defenses
3:24.632 mortal_strike Fluffy_Pillow 65.9/130: 51% rage focused_rage(3), precise_strikes, shattered_defenses
3:25.797 focused_rage Fluffy_Pillow 62.5/130: 48% rage focused_rage
3:25.956 slam Fluffy_Pillow 62.5/130: 48% rage focused_rage
3:27.115 focused_rage Fluffy_Pillow 59.7/130: 46% rage focused_rage(2)
3:27.278 slam Fluffy_Pillow 59.7/130: 46% rage focused_rage(2)
3:28.433 focused_rage Fluffy_Pillow 31.7/130: 24% rage focused_rage(3)
3:28.600 slam Fluffy_Pillow 31.7/130: 24% rage focused_rage(3)
3:29.751 focused_rage Fluffy_Pillow 28.9/130: 22% rage focused_rage(3)
3:29.922 mortal_strike Fluffy_Pillow 28.9/130: 22% rage focused_rage(3)
3:31.069 focused_rage Fluffy_Pillow 15.9/130: 12% rage focused_rage
3:31.244 colossus_smash Fluffy_Pillow 15.9/130: 12% rage focused_rage
3:32.387 focused_rage Fluffy_Pillow 3.9/130: 3% rage focused_rage(2), precise_strikes, shattered_defenses
3:32.566 Waiting 0.100 sec 3.9/130: 3% rage focused_rage(2), precise_strikes, shattered_defenses
3:32.666 mortal_strike Fluffy_Pillow 29.1/130: 22% rage focused_rage(2), precise_strikes, shattered_defenses
3:33.705 focused_rage Fluffy_Pillow 25.7/130: 20% rage focused_rage
3:33.991 slam Fluffy_Pillow 25.7/130: 20% rage focused_rage
3:35.312 Waiting 0.300 sec 9.7/130: 7% rage focused_rage
3:35.612 battle_cry Fluffy_Pillow 9.7/130: 7% rage focused_rage
3:35.765 focused_rage Fluffy_Pillow 9.7/130: 7% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:35.765 colossus_smash Fluffy_Pillow 9.7/130: 7% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:37.083 focused_rage Fluffy_Pillow 46.5/130: 36% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:37.088 mortal_strike Fluffy_Pillow 46.5/130: 36% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:38.401 focused_rage Fluffy_Pillow 61.5/130: 47% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:38.411 colossus_smash Fluffy_Pillow 61.5/130: 47% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
3:39.719 focused_rage Fluffy_Pillow 98.3/130: 76% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
3:39.734 heroic_leap Fluffy_Pillow 98.3/130: 76% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
3:39.734 mortal_strike Fluffy_Pillow 98.3/130: 76% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
3:41.037 focused_rage Fluffy_Pillow 101.3/130: 78% rage focused_rage
3:41.056 colossus_smash Fluffy_Pillow 101.3/130: 78% rage focused_rage
3:42.355 focused_rage Fluffy_Pillow 114.5/130: 88% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
3:42.379 slam Fluffy_Pillow 114.5/130: 88% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
3:43.673 focused_rage Fluffy_Pillow 86.5/130: 67% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:43.700 slam Fluffy_Pillow 86.5/130: 67% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:44.991 focused_rage Fluffy_Pillow 58.5/130: 45% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:45.022 mortal_strike Fluffy_Pillow 58.5/130: 45% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:46.309 focused_rage Fluffy_Pillow 80.3/130: 62% rage focused_rage, horrific_appendages
3:46.344 colossus_smash Fluffy_Pillow 80.3/130: 62% rage focused_rage, horrific_appendages
3:47.627 focused_rage Fluffy_Pillow 68.3/130: 53% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
3:47.666 mortal_strike Fluffy_Pillow 68.3/130: 53% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
3:48.945 focused_rage Fluffy_Pillow 90.1/130: 69% rage focused_rage, horrific_appendages
3:48.987 slam Fluffy_Pillow 90.1/130: 69% rage focused_rage, horrific_appendages
3:50.263 focused_rage Fluffy_Pillow 62.1/130: 48% rage focused_rage(2), horrific_appendages
3:50.310 slam Fluffy_Pillow 62.1/130: 48% rage focused_rage(2), horrific_appendages
3:51.581 focused_rage Fluffy_Pillow 34.1/130: 26% rage focused_rage(3), horrific_appendages
3:51.632 colossus_smash Fluffy_Pillow 70.5/130: 54% rage focused_rage(3), horrific_appendages
3:52.899 focused_rage Fluffy_Pillow 58.5/130: 45% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:52.953 mortal_strike Fluffy_Pillow 58.5/130: 45% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:54.217 focused_rage Fluffy_Pillow 55.1/130: 42% rage focused_rage
3:54.276 slam Fluffy_Pillow 55.1/130: 42% rage focused_rage
3:55.535 focused_rage Fluffy_Pillow 52.3/130: 40% rage focused_rage(2)
3:55.598 colossus_smash Fluffy_Pillow 52.3/130: 40% rage focused_rage(2)
3:56.853 focused_rage Fluffy_Pillow 40.3/130: 31% rage focused_rage(3), precise_strikes, shattered_defenses
3:56.918 mortal_strike Fluffy_Pillow 40.3/130: 31% rage focused_rage(3), precise_strikes, shattered_defenses
3:58.171 focused_rage Fluffy_Pillow 62.1/130: 48% rage focused_rage, horrific_appendages
3:58.240 slam Fluffy_Pillow 62.1/130: 48% rage focused_rage, horrific_appendages
3:59.562 execute Fluffy_Pillow 46.1/130: 35% rage focused_rage, horrific_appendages
4:00.885 execute Fluffy_Pillow 14.1/130: 11% rage focused_rage, horrific_appendages
4:02.208 battle_cry Fluffy_Pillow 25.2/130: 19% rage focused_rage, horrific_appendages
4:02.208 potion Fluffy_Pillow 25.2/130: 19% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
4:02.208 focused_rage Fluffy_Pillow 25.2/130: 19% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages, potion_of_the_old_war
4:02.208 execute Fluffy_Pillow 25.2/130: 19% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages, potion_of_the_old_war
4:03.526 focused_rage Fluffy_Pillow 25.2/130: 19% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages, potion_of_the_old_war
4:03.530 mortal_strike Fluffy_Pillow 25.2/130: 19% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages, potion_of_the_old_war
4:04.844 focused_rage Fluffy_Pillow 77.0/130: 59% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages, potion_of_the_old_war
4:04.854 colossus_smash Fluffy_Pillow 77.0/130: 59% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages, potion_of_the_old_war
4:06.162 focused_rage Fluffy_Pillow 77.0/130: 59% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
4:06.177 execute Fluffy_Pillow 77.0/130: 59% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
4:07.500 execute Fluffy_Pillow 102.2/130: 79% rage focused_rage(2), horrific_appendages, potion_of_the_old_war
4:08.821 colossus_smash Fluffy_Pillow 70.2/130: 54% rage focused_rage(2), horrific_appendages, potion_of_the_old_war
4:10.145 heroic_leap Fluffy_Pillow 70.2/130: 54% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
4:10.145 execute Fluffy_Pillow 70.2/130: 54% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
4:11.468 execute Fluffy_Pillow 82.6/130: 64% rage focused_rage(2), potion_of_the_old_war
4:12.791 colossus_smash Fluffy_Pillow 50.6/130: 39% rage focused_rage(2), potion_of_the_old_war
4:14.113 execute Fluffy_Pillow 75.8/130: 58% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
4:15.436 colossus_smash Fluffy_Pillow 63.0/130: 48% rage focused_rage(2), potion_of_the_old_war
4:16.759 execute Fluffy_Pillow 63.0/130: 48% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
4:18.081 execute Fluffy_Pillow 75.4/130: 58% rage focused_rage(2), potion_of_the_old_war
4:19.404 colossus_smash Fluffy_Pillow 43.4/130: 33% rage focused_rage(2), potion_of_the_old_war
4:20.727 execute Fluffy_Pillow 79.5/130: 61% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
4:22.049 colossus_smash Fluffy_Pillow 66.7/130: 51% rage focused_rage(2), potion_of_the_old_war
4:23.372 execute Fluffy_Pillow 91.9/130: 71% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
4:24.693 execute Fluffy_Pillow 79.1/130: 61% rage focused_rage(2), potion_of_the_old_war
4:26.014 colossus_smash Fluffy_Pillow 47.1/130: 36% rage focused_rage(2), potion_of_the_old_war
4:27.338 execute Fluffy_Pillow 72.3/130: 56% rage focused_rage(2), precise_strikes, shattered_defenses
4:28.662 colossus_smash Fluffy_Pillow 59.5/130: 46% rage focused_rage(2)
4:29.983 avatar Fluffy_Pillow 84.7/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
4:30.000 execute Fluffy_Pillow 84.7/130: 65% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
4:31.322 arcane_torrent Fluffy_Pillow 71.9/130: 55% rage avatar, focused_rage(2)
4:31.322 colossus_smash Fluffy_Pillow 86.9/130: 67% rage avatar, focused_rage(2)
4:32.645 execute Fluffy_Pillow 86.9/130: 67% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
4:33.968 execute Fluffy_Pillow 99.3/130: 76% rage avatar, focused_rage(2)
4:35.290 colossus_smash Fluffy_Pillow 67.3/130: 52% rage avatar, focused_rage(2)
4:36.613 battle_cry Fluffy_Pillow 92.5/130: 71% rage avatar, precise_strikes, shattered_defenses
4:36.613 focused_rage Fluffy_Pillow 92.5/130: 71% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
4:36.613 execute Fluffy_Pillow 92.5/130: 71% rage avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses
4:37.931 focused_rage Fluffy_Pillow 92.5/130: 71% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:37.935 execute Fluffy_Pillow 92.5/130: 71% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:39.249 focused_rage Fluffy_Pillow 129.4/130: 100% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:39.258 mortal_strike Fluffy_Pillow 129.4/130: 100% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:40.567 focused_rage Fluffy_Pillow 130.0/130: 100% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:40.580 heroic_leap Fluffy_Pillow 130.0/130: 100% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:40.580 execute Fluffy_Pillow 130.0/130: 100% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:41.902 colossus_smash Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage
4:43.226 execute Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage, precise_strikes, shattered_defenses
4:44.548 execute Fluffy_Pillow 117.2/130: 90% rage avatar, focused_rage
4:45.871 execute Fluffy_Pillow 110.4/130: 85% rage avatar, focused_rage
4:47.193 colossus_smash Fluffy_Pillow 78.4/130: 60% rage avatar, focused_rage
4:48.515 execute Fluffy_Pillow 78.4/130: 60% rage avatar, focused_rage, precise_strikes, shattered_defenses
4:49.836 execute Fluffy_Pillow 90.8/130: 70% rage avatar, focused_rage
4:51.160 colossus_smash Fluffy_Pillow 58.8/130: 45% rage focused_rage, horrific_appendages
4:52.481 execute Fluffy_Pillow 96.6/130: 74% rage focused_rage, precise_strikes, shattered_defenses, horrific_appendages
4:53.803 colossus_smash Fluffy_Pillow 83.8/130: 64% rage focused_rage, horrific_appendages

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 27987 26281 14801 (6219)
Agility 6579 6254 0
Stamina 42257 42257 26247
Intellect 5328 5003 0
Spirit 2 2 0
Health 2535420 2535420 0
Rage 130 130 0
Crit 18.49% 18.49% 4370
Haste 13.75% 13.75% 4470
Damage / Heal Versatility 2.81% 2.81% 1124
Attack Power 27987 26281 0
Mastery 81.32% 79.18% 11055
Armor 4353 4353 4353
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Warhelm of the Obsidian Aspect
ilevel: 880, stats: { 593 Armor, +1715 Str, +2573 Sta, +793 Crit, +668 Haste }
Local Neck Zealous Timestone Pendant
ilevel: 880, stats: { +1448 Sta, +1233 Mastery, +822 Haste }, enchant: { +300 Mastery }
Local Shoulders Shoulderplates of the Obsidian Aspect
ilevel: 880, stats: { 547 Armor, +1287 Str, +1930 Sta, +759 Haste, +336 Crit }
Local Chest Breastplate of the Remembered King
ilevel: 880, stats: { 729 Armor, +2573 Sta, +1715 StrInt, +1012 Mastery, +448 Vers }
Local Waist Gilded Nightborne Waistplate
ilevel: 880, stats: { 410 Armor, +1930 Sta, +1287 StrInt, +759 Mastery, +336 Vers }
Local Legs Legplates of the Obsidian Aspect
ilevel: 880, stats: { 638 Armor, +1715 Str, +2573 Sta, +918 Crit, +542 Haste }
Local Feet Leystone-Toe Kickers
ilevel: 880, stats: { 501 Armor, +1930 Sta, +1287 StrInt, +665 Mastery, +430 Haste }
Local Wrists Jagged Carapace Wristclamps
ilevel: 880, stats: { 319 Armor, +1448 Sta, +965 StrInt, +481 Mastery, +340 Vers }
Local Hands Archavon's Heavy Hand
ilevel: 895, stats: { 471 Armor, +2219 Sta, +1479 Str, +496 Crit, +662 Haste }
Local Finger1 Ring of Exclusive Servitude
ilevel: 880, stats: { +1448 Sta, +1350 Mastery, +704 Crit }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 880, stats: { +1448 Sta, +1467 Mastery, +587 Haste }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Trinket2 Terrorbound Nexus
ilevel: 880, stats: { +1043 Mastery }
Local Back Greatcloak of the Obsidian Aspect
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +516 Mastery, +305 Crit }, enchant: { +200 Str }
Local Main Hand Strom'kar, the Warbreaker
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Dauntless (Arms Warrior) Overpower (Arms Warrior) Sweeping Strikes (Arms Warrior)
30 Shockwave (Arms Warrior) Storm Bolt (Arms Warrior) Double Time
45 Fervor of Battle (Arms Warrior) Rend (Arms Warrior) Avatar
60 Second Wind Bounding Stride Defensive Stance (Arms Warrior)
75 In For The Kill (Arms Warrior) Mortal Combo (Arms Warrior) Focused Rage (Arms Warrior)
90 Deadly Calm (Arms Warrior) Trauma (Arms Warrior) Titanic Might (Arms Warrior)
100 Anger Management Opportunity Strikes (Arms Warrior) Ravager (Arms Warrior)

Profile

warrior="Warrior_Arms_T19M"
level=110
race=blood_elf
role=attack
position=back
talents=1332311
artifact=36:140815:141523:140822:0:1136:1:1137:1:1138:1:1139:1:1140:1:1141:1:1142:1:1143:3:1144:3:1145:3:1146:3:1147:3:1148:3:1149:4:1150:5:1151:3:1356:1
spec=arms

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=charge
actions+=/auto_attack
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
actions+=/blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
actions+=/berserking,if=buff.battle_cry.up|target.time_to_die<=11
actions+=/arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
actions+=/battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
actions+=/avatar,if=(buff.bloodlust.up|time>=1)
actions+=/heroic_leap,if=debuff.colossus_smash.up
actions+=/rend,if=remains<gcd
actions+=/focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
actions+=/colossus_smash,if=debuff.colossus_smash.down
actions+=/warbreaker,if=debuff.colossus_smash.down
actions+=/ravager
actions+=/overpower,if=buff.overpower.react
actions+=/run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
actions+=/run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
actions+=/run_action_list,name=execute,if=target.health.pct<=20
actions+=/run_action_list,name=single,if=target.health.pct>20

actions.aoe=mortal_strike
actions.aoe+=/execute,if=buff.stone_heart.react
actions.aoe+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.aoe+=/warbreaker,if=buff.shattered_defenses.down
actions.aoe+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.aoe+=/rend,if=remains<=duration*0.3
actions.aoe+=/bladestorm
actions.aoe+=/cleave
actions.aoe+=/whirlwind,if=rage>=60
actions.aoe+=/shockwave
actions.aoe+=/storm_bolt

actions.cleave=mortal_strike
actions.cleave+=/execute,if=buff.stone_heart.react
actions.cleave+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.cleave+=/warbreaker,if=buff.shattered_defenses.down
actions.cleave+=/focused_rage,if=rage>100|buff.battle_cry_deadly_calm.up
actions.cleave+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.cleave+=/rend,if=remains<=duration*0.3
actions.cleave+=/bladestorm
actions.cleave+=/cleave
actions.cleave+=/whirlwind,if=rage>40|buff.cleave.up
actions.cleave+=/shockwave
actions.cleave+=/storm_bolt

actions.execute=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
actions.execute+=/execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/colossus_smash,if=buff.shattered_defenses.down
actions.execute+=/warbreaker,if=buff.shattered_defenses.down&rage<=30
actions.execute+=/execute,if=buff.shattered_defenses.up&rage>22
actions.execute+=/mortal_strike,if=equipped.archavons_heavy_hand&rage<60
actions.execute+=/execute,if=buff.shattered_defenses.down
actions.execute+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

actions.single=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
actions.single+=/colossus_smash,if=buff.shattered_defenses.down
actions.single+=/warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
actions.single+=/focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
actions.single+=/mortal_strike
actions.single+=/execute,if=buff.stone_heart.react
actions.single+=/slam
actions.single+=/execute,if=equipped.archavons_heavy_hand
actions.single+=/focused_rage,if=equipped.archavons_heavy_hand
actions.single+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

head=warhelm_of_the_obsidian_aspect,id=138357,bonus_id=1806
neck=zealous_timestone_pendant,id=140894,bonus_id=1806,enchant=mark_of_the_trained_soldier
shoulders=shoulderplates_of_the_obsidian_aspect,id=138363,bonus_id=1806
back=greatcloak_of_the_obsidian_aspect,id=138374,bonus_id=1806,enchant=binding_of_strength
chest=breastplate_of_the_remembered_king,id=140913,bonus_id=1806
wrists=jagged_carapace_wristclamps,id=140902,bonus_id=1806
hands=archavons_heavy_hand,id=137060,bonus_id=1811
waist=gilded_nightborne_waistplate,id=140880,bonus_id=1806
legs=legplates_of_the_obsidian_aspect,id=138360,bonus_id=1806
feet=leystonetoe_kickers,id=140884,bonus_id=1806
finger1=ring_of_exclusive_servitude,id=140906,bonus_id=1806,enchant=binding_of_mastery
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=1806,enchant=binding_of_mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1806
trinket2=terrorbound_nexus,id=137406,bonus_id=1806
main_hand=stromkar_the_warbreaker,id=128910,bonus_id=750,gem_id=140815/137377/139257,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=882.73
# gear_strength=14801
# gear_stamina=26247
# gear_crit_rating=4370
# gear_haste_rating=4470
# gear_mastery_rating=11055
# gear_versatility_rating=1124
# gear_armor=4353
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

Warrior_Fury_T19M : 466846 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
466845.7 466845.7 361.7 / 0.077% 63823.3 / 13.7% 50635.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.2 9.2 Rage 0.00% 57.0 100.0% 100%
Talents
  • 15: Endless Rage (Fury Warrior)
  • 30: Storm Bolt (Fury Warrior)
  • 45: Avatar
  • 60: Bounding Stride
  • 75: Massacre (Fury Warrior)
  • 90: Inner Rage (Fury Warrior)
  • 100: Dragon Roar (Fury Warrior)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Warrior_Fury_T19M 466846
auto_attack_mh 50628 10.8% 225.9 1.33sec 67262 50678 Direct 225.9 46356 99752 67262 40.1% 1.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 225.94 225.94 0.00 0.00 1.3273 0.0000 15197138.90 22341233.70 31.98 50678.08 50678.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.00 58.87% 46356.26 31711 61309 46362.40 44658 48227 6165537 9063923 31.98
crit 90.54 40.07% 99752.36 63422 141011 99804.64 94878 107798 9031602 13277310 31.98
miss 2.39 1.06% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 25327 5.4% 225.9 1.33sec 33648 25352 Direct 225.9 23176 49877 33648 40.1% 1.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 225.94 225.94 0.00 0.00 1.3273 0.0000 7602447.85 11176318.47 31.98 25351.97 25351.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.85 58.80% 23176.45 15855 30654 23179.44 22251 24202 3079097 4526564 31.98
crit 90.69 40.14% 49876.78 31711 70505 49903.65 47379 52969 4523351 6649755 31.98
miss 2.39 1.06% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bloodthirst 33120 7.1% 50.6 5.24sec 196623 176939 Direct 50.6 129223 265336 196623 49.5% 0.0%  

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.59 50.59 0.00 0.00 1.1112 0.0000 9946975.04 14622995.51 31.98 176938.92 176938.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.54 50.48% 129223.19 90031 174063 129352.31 117073 142635 3300165 4851555 31.98
crit 25.05 49.52% 265336.05 180061 400346 265411.88 234073 298585 6646810 9771441 31.98
 
 

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.down|rage<50
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Assault the target in a bloodthirsty craze, dealing ${$sw2*$<mult>} Physical damage and restoring {$117313s1=4}% of your health. |cFFFFFFFFGenerates ${$m3/10} Rage.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.01
 
Dragon Roar 6744 1.4% 13.7 22.63sec 147784 132473 Direct 13.7 0 147785 147785 100.0% 0.0%  

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.70 13.70 0.00 0.00 1.1156 0.0000 2024459.65 2024459.65 0.00 132473.48 132473.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 13.70 100.00% 147784.57 101697 188426 147829.06 131693 161433 2024460 2024460 0.00
 
 

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:Damage done increased by {$s2=20}%.
  • description:Roar explosively, dealing $m1 damage to all enemies within $A1 yards and increasing all damage you deal by {$s2=20}% for {$d=6 seconds}. Dragon Roar ignores all armor and always critically strikes.
 
Execute 68987 (103513) 14.8% (22.2%) 43.9 6.85sec 708654 621592 Direct 43.9 302230 630014 472258 51.9% 0.0%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.94 43.94 0.00 0.00 1.1401 0.0000 20753701.75 30509907.42 31.98 621592.04 621592.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.15 48.13% 302230.17 149257 851286 301246.31 217077 421715 6391726 9396443 31.98
crit 22.80 51.87% 630014.25 298515 1825215 627370.20 476662 842844 14361976 21113465 31.98
 
 

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.13
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2))|buff.stone_heart.react
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
    Execute Off-Hand 34526 7.4% 0.0 0.00sec 0 0 Direct 43.9 151110 314989 236390 52.0% 0.0%  

Stats details: execute_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 43.94 0.00 0.00 0.0000 0.0000 10388059.32 15271431.19 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.08 47.96% 151110.20 74630 425653 150624.71 113707 206831 3184968 4682205 31.98
crit 22.87 52.04% 314988.94 149261 912629 313648.17 239408 423489 7203091 10589227 31.98
 
 

Action details: execute_offhand

Static Values
  • id:163558
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.13
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:163558
  • name:Execute Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc5308=Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Fel-Crazed Rage 1451 0.3% 2.9 129.06sec 151975 0 Direct 2.9 78323 156369 152106 94.5% 0.0%  

Stats details: felcrazed_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 2.87 0.00 0.00 0.0000 0.0000 436187.28 436187.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.16 5.46% 78323.10 54356 105091 12261.55 0 105091 12272 12272 0.00
crit 2.71 94.54% 156369.24 108712 241708 155199.80 119583 189383 423915 423915 0.00
 
 

Action details: felcrazed_rage

Static Values
  • id:225777
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225777
  • name:Fel-Crazed Rage
  • school:shadow
  • tooltip:
  • description:{$@spelldesc225141=Enter a fel-crazed rage, dealing {$225777s1=29114 to 32178} Shadow damage to a random nearby enemy every ${$t1}.2 sec for {$d=3 seconds}. You cannot move or use abilities during your rage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:50927.68
  • base_dd_max:56288.48
 
Furious Slash 10580 2.3% 27.6 8.67sec 114936 103594 Direct 27.6 84148 178102 114936 32.8% 0.0%  

Stats details: furious_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.64 27.64 0.00 0.00 1.1095 0.0000 3176822.02 4670229.28 31.98 103594.27 103594.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.58 67.23% 84147.57 58710 113508 84167.29 75243 95163 1563645 2298706 31.98
crit 9.06 32.77% 178101.58 117419 261068 178516.13 137535 237106 1613177 2371523 31.98
 
 

Action details: furious_slash

Static Values
  • id:100130
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
Spelldata
  • id:100130
  • name:Furious Slash
  • school:physical
  • tooltip:
  • description:Aggressively strike with your off-hand weapon for ${$sw3*$<mult>} Physical damage.$?a231824[ Increases your Bloodthirst critical strike chance by {$206333s1=15}% until it next deals a critical strike, stacking up to {$206333u=6} times.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.93
 
Mark of the Hidden Satyr 6762 1.4% 19.4 15.54sec 104360 0 Direct 19.4 71490 156025 104358 38.9% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.44 19.44 0.00 0.00 0.0000 0.0000 2028825.06 2028825.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.88 61.12% 71490.20 50191 97037 71450.23 50191 84638 849431 849431 0.00
crit 7.56 38.88% 156024.58 100381 223186 155900.60 0 223186 1179394 1179394 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Odyn's Fury 0 (25507) 0.0% (5.5%) 7.2 44.26sec 1057857 969611

Stats details: odyns_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.24 0.00 0.00 0.00 1.0910 0.0000 0.00 0.00 0.00 969610.95 969610.95
 
 

Action details: odyns_fury

Static Values
  • id:205545
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up&buff.enrage.up
Spelldata
  • id:205545
  • name:Odyn's Fury
  • school:physical
  • tooltip:
  • description:Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.
 
    Odyn's Fury (_mh) 20270 4.3% 0.0 0.00sec 0 0 Direct 7.2 0 434413 434413 100.0% 0.0%  
Periodic 28.7 52940 112584 102464 83.0% 0.0% 9.6%

Stats details: odyns_fury_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.24 28.71 28.71 0.0000 1.0000 6087900.62 6087900.62 0.00 212040.70 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 7.24 100.00% 434413.10 366254 527406 434390.47 405321 498106 3145991 3145991 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.9 16.97% 52940.19 31389 60687 53164.58 0 60687 257912 257912 0.00
crit 23.8 83.03% 112583.89 62778 139579 112687.22 100858 131410 2683998 2683998 0.00
 
 

Action details: odyns_fury_mh

Static Values
  • id:205546
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205546
  • name:Odyn's Fury
  • school:fire
  • tooltip:Suffering $o3 Fire damage over {$d=4 seconds}.
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
    Odyn's Fury (_oh) 5237 1.1% 0.0 0.00sec 0 0 Direct 7.2 0 217207 217207 100.0% 0.0%  

Stats details: odyns_fury_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.24 0.00 0.00 0.0000 0.0000 1572995.49 1572995.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 7.24 100.00% 217206.55 183127 263703 217195.23 202661 249053 1572995 1572995 0.00
 
 

Action details: odyns_fury_oh

Static Values
  • id:205547
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205547
  • name:Odyn's Fury
  • school:fire
  • tooltip:
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
Potion of the Old War 26510 5.6% 27.6 11.01sec 283986 0 Direct 27.6 180369 403573 283988 46.4% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.59 27.59 0.00 0.00 0.0000 0.0000 7833972.80 11516682.07 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.78 53.58% 180368.53 117183 226559 180309.29 147078 207679 2665706 3918840 31.98
crit 12.81 46.42% 403572.53 234366 521087 404783.30 330719 499375 5168267 7597842 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Raging Blow 0 (93896) 0.0% (20.1%) 61.7 4.72sec 457195 410277

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.67 0.00 0.00 0.00 1.1144 0.0000 0.00 0.00 0.00 410277.13 410277.13
 
 

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.juggernaut.down&buff.enrage.up
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r
 
    Raging Blow (_oh) 31287 6.7% 0.0 0.00sec 0 0 Direct 61.7 108095 230895 152350 36.0% 0.0%  

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 61.67 0.00 0.00 0.0000 0.0000 9396037.31 13813064.86 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.45 63.96% 108094.92 73955 142983 108134.37 102127 116315 4263978 6268451 31.98
crit 22.23 36.04% 230895.40 147909 328860 231330.02 205733 268331 5132059 7544613 31.98
 
 

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.95
 
    Raging Blow (_mh) 62610 13.4% 0.0 0.00sec 0 0 Direct 61.7 216175 461793 304842 36.1% 0.0%  

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 61.67 0.00 0.00 0.0000 0.0000 18800669.07 27638764.37 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.41 63.90% 216175.24 147909 285965 216242.97 203507 230361 8519361 12524268 31.98
crit 22.26 36.10% 461792.86 295819 657720 462615.01 423171 541127 10281308 15114496 31.98
 
 

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.95
 
Rampage 0 (71540) 0.0% (15.3%) 49.4 6.11sec 434949 301507

Stats details: rampage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.39 0.00 0.00 0.00 1.4426 0.0000 0.00 0.00 0.00 301506.97 301506.97
 
 

Action details: rampage

Static Values
  • id:184367
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:2.0000
  • min_gcd:0.7500
  • base_cost:85.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.meat_cleaver.up
Spelldata
  • id:184367
  • name:Rampage
  • school:physical
  • tooltip:
  • description:Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.
 
    Rampage (1) 6173 1.3% 0.0 0.00sec 0 0 Direct 49.4 25950 55383 37534 39.4% 0.0%  

Stats details: rampage1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.39 0.00 0.00 0.0000 0.0000 1853760.20 2725203.08 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.95 60.64% 25949.76 18565 35893 25950.76 23024 28711 777160 1142498 31.98
crit 19.44 39.36% 55382.82 37130 82554 55426.02 47579 63728 1076600 1582705 31.98
 
 

Action details: rampage1

Static Values
  • id:218617
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218617
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.62
 
    Rampage (2) 9803 2.1% 0.0 0.00sec 0 0 Direct 49.3 41310 87896 59664 39.4% 0.0%  

Stats details: rampage2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.34 0.00 0.00 0.0000 0.0000 2943582.57 4327345.21 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.90 60.60% 41309.55 37607 54154 41318.89 39017 45487 1235104 1815720 31.98
crit 19.44 39.40% 87895.60 75214 124555 87992.69 78599 99049 1708478 2511625 31.98
 
 

Action details: rampage2

Static Values
  • id:184707
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184707
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.87
 
    Rampage (3) 12975 2.8% 0.0 0.00sec 0 0 Direct 49.3 54662 116369 79059 39.5% 0.0%  

Stats details: rampage3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.29 0.00 0.00 0.0000 0.0000 3896671.25 5728475.84 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.80 60.46% 54662.10 49851 71786 54675.50 51585 58682 1628908 2394649 31.98
crit 19.49 39.54% 116369.09 99703 165108 116476.71 105685 132724 2267764 3333827 31.98
 
 

Action details: rampage3

Static Values
  • id:184709
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184709
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.24
 
    Rampage (4) 19673 4.2% 0.0 0.00sec 0 0 Direct 49.2 82601 176972 120107 39.7% 0.0%  

Stats details: rampage4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.18 0.00 0.00 0.0000 0.0000 5907130.34 8684041.14 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.64 60.26% 82600.60 75433 108623 82619.51 77947 88325 2447883 3598620 31.98
crit 19.55 39.74% 176972.16 150866 249834 177223.44 159918 199922 3459248 5085422 31.98
 
 

Action details: rampage4

Static Values
  • id:201364
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201364
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
    Rampage (5) 22915 4.9% 0.0 0.00sec 0 0 Direct 49.2 96272 206163 139906 39.7% 0.0%  

Stats details: rampage5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.18 0.00 0.00 0.0000 0.0000 6880021.14 10114282.77 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.65 60.29% 96271.67 87896 126570 96292.54 91092 103278 2854506 4196394 31.98
crit 19.53 39.71% 206162.51 175792 291111 206423.21 184581 234014 4025516 5917889 31.98
 
 

Action details: rampage5

Static Values
  • id:201363
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201363
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.19
 
Rend Flesh 11266 2.4% 45.4 6.66sec 74606 0 Periodic 132.6 17412 37973 25532 39.5% 0.0% 85.9%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.38 0.00 132.60 132.60 0.0000 1.9472 3385638.77 3385638.77 0.00 13112.21 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.2 60.51% 17412.00 8 23852 17415.44 16128 18779 1397026 1397026 0.00
crit 52.4 39.49% 37973.22 17 54859 38004.09 34014 42044 1988612 1988612 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:12167.02
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Warrior_Fury_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_T19M
  • harmful:false
  • if_expr:
 
Avatar 4.1 85.99sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 7.5 43.60sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.45 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:50.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Berserking 2.0 180.64sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.battle_cry.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_T19M
  • harmful:false
  • if_expr:
 
Heroic Leap 11.9 26.32sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 4.1 0.0 85.8sec 86.1sec 26.12% 26.12% 0.0(0.0) 3.7

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:26.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 7.5 0.0 43.3sec 43.6sec 12.30% 12.30% 0.0(0.0) 7.3

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:12.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Berserking 2.0 0.0 199.9sec 181.2sec 6.77% 8.48% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking (_) 6.2 66.4 47.0sec 3.6sec 27.98% 27.98% 0.0(0.0) 5.8

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_berserking_
  • max_stacks:12
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03

Stack Uptimes

  • berserking__1:2.07%
  • berserking__2:2.06%
  • berserking__3:2.05%
  • berserking__4:2.04%
  • berserking__5:2.03%
  • berserking__6:2.02%
  • berserking__7:2.00%
  • berserking__8:1.99%
  • berserking__9:1.98%
  • berserking__10:1.97%
  • berserking__11:1.96%
  • berserking__12:5.80%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:200953
  • name:Berserking
  • tooltip:Attack speed and critical strike chance increased by {$s1=3}%.
  • description:{$@spelldesc200845=Rampage and Execute have a chance to activate Berserking, increasing your attack speed and critical strike chance by {$200953s1=3}% every $200951t sec for {$200951d=12 seconds}.}
  • max_stacks:12
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 18.03% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dragon Roar 13.7 0.0 22.6sec 22.7sec 27.10% 27.10% 0.0(0.0) 13.4

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_dragon_roar
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • dragon_roar_1:27.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118000
  • name:Dragon Roar
  • tooltip:Damage done increased by {$s2=20}%.
  • description:Roar explosively, dealing $m1 damage to all enemies within $A1 yards and increasing all damage you deal by {$s2=20}% for {$d=6 seconds}. Dragon Roar ignores all armor and always critically strikes.
  • max_stacks:0
  • duration:6.00
  • cooldown:25.00
  • default_chance:0.00%
Enrage 15.2 59.3 18.7sec 4.0sec 92.57% 94.42% 59.3(59.3) 14.2

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:5.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • enrage_1:92.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184362
  • name:Enrage
  • tooltip:Attack speed increased by {$s1=100}% and damage taken increased by {$s2=20}%.
  • description:{$@spelldesc184361=Bloodthirst critical strikes $?a206320[or activating Berserker Rage ][]will Enrage you, increasing your attack speed by {$184362s1=100}% and damage you take by {$184362s2=20}% for {$184362d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Juggernaut 13.7 30.3 19.1sec 6.9sec 50.34% 68.87% 0.0(0.0) 12.7

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_juggernaut
  • max_stacks:99
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05

Stack Uptimes

  • juggernaut_1:23.22%
  • juggernaut_2:7.06%
  • juggernaut_3:2.54%
  • juggernaut_4:1.26%
  • juggernaut_5:0.89%
  • juggernaut_6:0.78%
  • juggernaut_7:0.75%
  • juggernaut_8:0.73%
  • juggernaut_9:0.75%
  • juggernaut_10:0.74%
  • juggernaut_11:0.75%
  • juggernaut_12:0.75%
  • juggernaut_13:0.75%
  • juggernaut_14:0.77%
  • juggernaut_15:0.75%
  • juggernaut_16:0.76%
  • juggernaut_17:0.76%
  • juggernaut_18:0.76%
  • juggernaut_19:0.76%
  • juggernaut_20:0.74%
  • juggernaut_21:0.72%
  • juggernaut_22:0.67%
  • juggernaut_23:0.59%
  • juggernaut_24:0.51%
  • juggernaut_25:0.41%
  • juggernaut_26:0.33%
  • juggernaut_27:0.25%
  • juggernaut_28:0.19%
  • juggernaut_29:0.14%
  • juggernaut_30:0.10%
  • juggernaut_31:0.07%
  • juggernaut_32:0.05%
  • juggernaut_33:0.03%
  • juggernaut_34:0.02%
  • juggernaut_35:0.01%
  • juggernaut_36:0.00%
  • juggernaut_37:0.00%
  • juggernaut_38:0.00%
  • juggernaut_39:0.00%
  • juggernaut_40:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201009
  • name:Juggernaut
  • tooltip:Execute damage increased by {$s1=5}%.
  • description:{$@spelldesc200875=Execute increases damage dealt by Execute by {$201009s1=5}% for {$201009d=6 seconds}, stacking up to {$201009u=99} times.}
  • max_stacks:99
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Massacre 23.0 22.6 13.4sec 6.6sec 19.71% 19.71% 22.6(22.6) 0.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_massacre
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • massacre_1:19.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206316
  • name:Massacre
  • tooltip:Rampage costs no Rage.
  • description:{$@spelldesc206315=Execute critical strikes reduce the Rage cost of your next Rampage by {$206316s1=100}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Odyn's Champion 8.8 1.0 32.0sec 28.4sec 18.79% 15.93% 1.0(1.0) 8.6

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_odyns_champion
  • max_stacks:1
  • duration:6.00
  • cooldown:0.10
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • odyns_champion_1:18.79%

Trigger Attempt Success

  • trigger_pct:20.04%

Spelldata details

  • id:200986
  • name:Odyn's Champion
  • tooltip:All special ability uses will reduce the cooldown of all abilities by {$200872s1=1} sec.
  • description:{$@spelldesc200872=When you use Rampage, Odyn has a chance to declare you the Champion of the Valarjar for {$200986d=6 seconds}, causing all your offensive abilities to reduce the cooldown of all your abilities by {$s1=1} sec.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 260.2sec 0.0sec 16.22% 16.22% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Sense Death 6.6 0.0 37.6sec 36.7sec 10.18% 10.18% 0.0(0.0) 1.2

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_sense_death
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • sense_death_1:10.18%

Trigger Attempt Success

  • trigger_pct:14.93%

Spelldata details

  • id:200979
  • name:Sense Death
  • tooltip:Your next Execute will cost 0 rage.
  • description:{$@spelldesc200863=Execute has a {$h=15}% chance to make your next Execute cost no Rage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Stone Heart 22.1 1.2 13.6sec 13.0sec 5.87% 5.87% 1.2(1.2) 0.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_stone_heart
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stone_heart_1:5.87%

Trigger Attempt Success

  • trigger_pct:2.03%

Spelldata details

  • id:225947
  • name:Stone Heart
  • tooltip:Execute costs no Rage and can be used on any target.
  • description:{$@spelldesc207767=Your attacks have a chance to make your next Execute cost no $?s12712[initial ][]Rage$?s12712[, consume no extra Rage,][] and be usable on any target, regardless of health level.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Taste for Blood 22.2 5.5 10.9sec 8.7sec 42.89% 42.89% 0.0(0.0) 5.2

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_taste_for_blood
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • taste_for_blood_1:35.47%
  • taste_for_blood_2:6.63%
  • taste_for_blood_3:0.76%
  • taste_for_blood_4:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206333
  • name:Taste for Blood
  • tooltip:Critical strike chance of Bloodthirst increased by {$s1=15}%.
  • description:Furious Slash increases the critical strike chance of Bloodthirst by {$s1=15}%.
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Heroic Leap0.7510.0011.5222.5450.00010.440
Battle Cry1.6560.0014.7060.5500.0008.700
Avatar5.2020.00117.4596.2010.00029.656
Bloodthirst1.9080.00678.60794.60040.479186.461
Odyn's Fury5.7300.001104.42617.2750.000112.130
Dragon Roar1.6370.00117.4208.1340.00029.145

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Fury_T19M
execute Rage 43.9 479.8 10.9 10.9 64908.1
rampage Rage 49.4 2287.3 46.3 46.3 9391.5
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 35.00 (1.25%) 35.00 0.00 0.00%
bloodthirst Rage 50.59 483.66 (17.28%) 9.56 22.23 4.39%
raging_blow Rage 61.67 296.02 (10.58%) 4.80 12.35 4.00%
melee_main_hand Rage 223.54 1348.06 (48.17%) 6.03 127.33 8.63%
melee_off_hand Rage 223.55 635.78 (22.72%) 2.84 101.92 13.82%
Resource RPS-Gain RPS-Loss
Health 9297.81 0.00
Rage 9.31 9.21
Combat End Resource Mean Min Max
Rage 31.77 0.10 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 9.4%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Warrior_Fury_T19M Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Warrior_Fury_T19M Damage Per Second
Count 7499
Mean 466845.69
Minimum 413072.18
Maximum 541949.91
Spread ( max - min ) 128877.73
Range [ ( max - min ) / 2 * 100% ] 13.80%
Standard Deviation 15982.4377
5th Percentile 441153.45
95th Percentile 494148.80
( 95th Percentile - 5th Percentile ) 52995.36
Mean Distribution
Standard Deviation 184.5616
95.00% Confidence Intervall ( 466483.96 - 467207.43 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4502
0.1 Scale Factor Error with Delta=300 2180568
0.05 Scale Factor Error with Delta=300 8722273
0.01 Scale Factor Error with Delta=300 218056838
Priority Target DPS
Sample Data Warrior_Fury_T19M Priority Target Damage Per Second
Count 7499
Mean 466845.69
Minimum 413072.18
Maximum 541949.91
Spread ( max - min ) 128877.73
Range [ ( max - min ) / 2 * 100% ] 13.80%
Standard Deviation 15982.4377
5th Percentile 441153.45
95th Percentile 494148.80
( 95th Percentile - 5th Percentile ) 52995.36
Mean Distribution
Standard Deviation 184.5616
95.00% Confidence Intervall ( 466483.96 - 467207.43 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4502
0.1 Scale Factor Error with Delta=300 2180568
0.05 Scale Factor Error with Delta=300 8722273
0.01 Scale Factor Error with Delta=300 218056838
DPS(e)
Sample Data Warrior_Fury_T19M Damage Per Second (Effective)
Count 7499
Mean 466845.69
Minimum 413072.18
Maximum 541949.91
Spread ( max - min ) 128877.73
Range [ ( max - min ) / 2 * 100% ] 13.80%
Damage
Sample Data Warrior_Fury_T19M Damage
Count 7499
Mean 140112996.44
Minimum 101501988.70
Maximum 184741400.58
Spread ( max - min ) 83239411.88
Range [ ( max - min ) / 2 * 100% ] 29.70%
DTPS
Sample Data Warrior_Fury_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Warrior_Fury_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Warrior_Fury_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Warrior_Fury_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Warrior_Fury_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Warrior_Fury_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Warrior_Fury_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Warrior_Fury_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 1.00 charge
7 0.00 run_action_list,name=movement,if=movement.distance>5
8 11.95 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
9 2.87 use_item,name=draught_of_souls,if=(spell_targets.whirlwind>1|!raid_event.adds.exists)&((talent.bladestorm.enabled&cooldown.bladestorm.remains=0)|buff.battle_cry.up|target.time_to_die<25)
A 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
B 7.45 battle_cry,if=(cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))
C 4.09 avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
0.00 bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
0.00 blood_fury,if=buff.battle_cry.up
D 2.01 berserking,if=buff.battle_cry.up
0.00 arcane_torrent,if=rage<rage.max-40
E 0.00 call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
F 0.00 call_action_list,name=aoe,if=spell_targets.whirlwind>3
G 0.00 call_action_list,name=single_target
actions.single_target
# count action,conditions
0.00 bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
I 20.93 execute,if=(artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2))|buff.stone_heart.react
J 45.52 rampage,if=rage=100&(target.health.pct>20|target.health.pct<20&!talent.massacre.enabled)|buff.massacre.react&buff.enrage.remains<1
0.00 berserker_rage,if=talent.outburst.enabled&cooldown.odyns_fury.remains=0&buff.enrage.down
K 13.70 dragon_roar,if=cooldown.odyns_fury.remains>=10|cooldown.odyns_fury.remains<=3
L 7.24 odyns_fury,if=buff.battle_cry.up&buff.enrage.up
M 3.87 rampage,if=buff.enrage.down&buff.juggernaut.down
0.00 furious_slash,if=talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
N 35.38 raging_blow,if=buff.juggernaut.down&buff.enrage.up
0.00 whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
O 23.02 execute,if=talent.inner_rage.enabled|!talent.inner_rage.enabled&rage>50
P 7.80 bloodthirst,if=buff.enrage.down
Q 2.93 raging_blow,if=buff.enrage.down
0.00 execute,if=artifact.juggernaut.enabled
R 23.37 raging_blow
S 42.79 bloodthirst
T 27.64 furious_slash
U 0.00 call_action_list,name=bladestorm
0.00 bloodbath,if=buff.frothing_berserker.up|(rage>80&!talent.frothing_berserker.enabled)

Sample Sequence

0124568B9CDIJKLRSTJNSTNSTJNSTNSMNSTKNI8PRJSRTSNTJNSTNSMBLKNSTIRJ8JIRSJRSJNSIKPQTPJNST8NPMNSTIRBCJLRJKNISRTSIJRSTI8RJJRSTKNIJJRSTNSTJNB9L8IJRSTIJJKRSIRSJJNSTN8SJNSTNPTNJKNSTQBCPLJNST8NSTIJJKRSTQPTJNSTN8IJRKJNSTNBDLSJNSTNSMIRSTRSJ8JIKIJOOOJOOOJOROJROSOOKI8JBC9ALOOJOOOJOOOJOORJOKIJOOR8JO

Sample Sequence Table

time name target resources buffs
Pre flask Warrior_Fury_T19M 0.0/100: 0% rage
Pre food Warrior_Fury_T19M 0.0/100: 0% rage
Pre augmentation Warrior_Fury_T19M 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% rage potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% rage potion_of_the_old_war
0:00.000 charge Fluffy_Pillow 3.3/100: 3% rage bloodlust, stone_heart, potion_of_the_old_war
0:00.000 heroic_leap Fluffy_Pillow 38.3/100: 38% rage bloodlust, stone_heart, potion_of_the_old_war
0:00.000 battle_cry Fluffy_Pillow 38.3/100: 38% rage bloodlust, stone_heart, potion_of_the_old_war
0:00.000 use_item_draught_of_souls Fluffy_Pillow 38.3/100: 38% rage bloodlust, battle_cry, stone_heart, potion_of_the_old_war
0:00.000 avatar Fluffy_Pillow 38.3/100: 38% rage bloodlust, battle_cry, stone_heart, potion_of_the_old_war
0:00.000 berserking Fluffy_Pillow 38.3/100: 38% rage bloodlust, avatar, battle_cry, stone_heart, potion_of_the_old_war
0:00.000 execute Fluffy_Pillow 38.3/100: 38% rage bloodlust, berserking, avatar, battle_cry, stone_heart, potion_of_the_old_war
0:00.788 rampage Fluffy_Pillow 38.3/100: 38% rage bloodlust, berserking, massacre, avatar, sense_death, juggernaut, battle_cry, potion_of_the_old_war
0:01.837 dragon_roar Fluffy_Pillow 38.3/100: 38% rage bloodlust, berserking, avatar, enrage, sense_death, juggernaut, battle_cry, potion_of_the_old_war
0:02.626 odyns_fury Fluffy_Pillow 48.2/100: 48% rage bloodlust, berserking, avatar, dragon_roar, enrage, sense_death, juggernaut, battle_cry, potion_of_the_old_war
0:03.415 raging_blow Fluffy_Pillow 58.1/100: 58% rage bloodlust, berserking, avatar, dragon_roar, enrage, sense_death, juggernaut, battle_cry, potion_of_the_old_war
0:04.203 bloodthirst Fluffy_Pillow 73.0/100: 73% rage bloodlust, berserking, avatar, dragon_roar, enrage, sense_death, juggernaut, battle_cry, potion_of_the_old_war
0:04.991 furious_slash Fluffy_Pillow 92.9/100: 93% rage bloodlust, berserking, avatar, dragon_roar, enrage, sense_death, juggernaut, battle_cry, potion_of_the_old_war
0:05.778 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, berserking, avatar, dragon_roar, enrage, taste_for_blood, sense_death, juggernaut, potion_of_the_old_war
0:06.828 raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, berserking, avatar, dragon_roar, enrage, taste_for_blood, sense_death, potion_of_the_old_war
0:07.614 bloodthirst Fluffy_Pillow 39.8/100: 40% rage bloodlust, berserking, avatar, dragon_roar, enrage, taste_for_blood, sense_death, potion_of_the_old_war
0:08.402 furious_slash Fluffy_Pillow 49.8/100: 50% rage bloodlust, berserking, avatar, enrage, taste_for_blood, sense_death, potion_of_the_old_war
0:09.189 raging_blow Fluffy_Pillow 59.7/100: 60% rage bloodlust, berserking, avatar, enrage, taste_for_blood(2), sense_death, potion_of_the_old_war
0:09.976 bloodthirst Fluffy_Pillow 74.6/100: 75% rage bloodlust, berserking, avatar, enrage, taste_for_blood(2), sense_death, potion_of_the_old_war
0:10.882 furious_slash Fluffy_Pillow 94.5/100: 94% rage bloodlust, avatar, enrage, sense_death, potion_of_the_old_war
0:11.788 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, enrage, taste_for_blood, sense_death, potion_of_the_old_war
0:12.995 raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:13.902 bloodthirst Fluffy_Pillow 39.8/100: 40% rage bloodlust, avatar, enrage, taste_for_blood, odyns_champion, potion_of_the_old_war
0:14.809 furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, avatar, enrage, taste_for_blood, odyns_champion, potion_of_the_old_war
0:15.714 raging_blow Fluffy_Pillow 69.6/100: 70% rage bloodlust, avatar, enrage, taste_for_blood(2), odyns_champion, potion_of_the_old_war
0:16.620 bloodthirst Fluffy_Pillow 74.6/100: 75% rage bloodlust, avatar, enrage, taste_for_blood(2), odyns_champion, potion_of_the_old_war
0:17.525 rampage Fluffy_Pillow 94.5/100: 94% rage bloodlust, avatar, taste_for_blood(2), odyns_champion, potion_of_the_old_war
0:18.729 raging_blow Fluffy_Pillow 19.4/100: 19% rage bloodlust, avatar, enrage, taste_for_blood(2), odyns_champion, potion_of_the_old_war
0:19.636 bloodthirst Fluffy_Pillow 34.3/100: 34% rage bloodlust, avatar, enrage, taste_for_blood(2), potion_of_the_old_war
0:20.539 furious_slash Fluffy_Pillow 54.2/100: 54% rage bloodlust, enrage, taste_for_blood(2), potion_of_the_old_war
0:21.446 dragon_roar Fluffy_Pillow 64.1/100: 64% rage bloodlust, enrage, taste_for_blood(3), potion_of_the_old_war
0:22.351 raging_blow Fluffy_Pillow 74.0/100: 74% rage bloodlust, dragon_roar, enrage, taste_for_blood(3), potion_of_the_old_war
0:23.258 execute Fluffy_Pillow 88.9/100: 89% rage bloodlust, dragon_roar, taste_for_blood(3), stone_heart
0:24.163 heroic_leap Fluffy_Pillow 88.9/100: 89% rage bloodlust, dragon_roar, taste_for_blood(3), juggernaut
0:24.163 bloodthirst Fluffy_Pillow 88.9/100: 89% rage bloodlust, dragon_roar, taste_for_blood(3), juggernaut
0:25.069 raging_blow Fluffy_Pillow 98.9/100: 99% rage bloodlust, dragon_roar, enrage, juggernaut
0:25.975 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, dragon_roar, enrage, juggernaut
0:27.181 bloodthirst Fluffy_Pillow 24.9/100: 25% rage bloodlust, dragon_roar, enrage, juggernaut
0:28.086 raging_blow Fluffy_Pillow 44.8/100: 45% rage bloodlust, enrage, juggernaut, odyns_champion
0:28.990 furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, enrage, juggernaut, odyns_champion
0:29.898 bloodthirst Fluffy_Pillow 69.6/100: 70% rage bloodlust, enrage, taste_for_blood, odyns_champion
0:30.805 raging_blow Fluffy_Pillow 89.5/100: 89% rage bloodlust, enrage, taste_for_blood, odyns_champion
0:31.711 furious_slash Fluffy_Pillow 94.5/100: 94% rage bloodlust, enrage, taste_for_blood, odyns_champion
0:32.616 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, taste_for_blood(2), odyns_champion
0:33.822 raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, enrage, taste_for_blood(2)
0:34.729 bloodthirst Fluffy_Pillow 39.8/100: 40% rage bloodlust, enrage, taste_for_blood(2)
0:35.634 furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, enrage, taste_for_blood(2)
0:36.541 raging_blow Fluffy_Pillow 69.6/100: 70% rage bloodlust, enrage, taste_for_blood(3)
0:37.447 bloodthirst Fluffy_Pillow 84.5/100: 84% rage bloodlust, enrage, taste_for_blood(3)
0:38.353 rampage Fluffy_Pillow 97.8/100: 98% rage bloodlust, taste_for_blood(3)
0:38.353 battle_cry Fluffy_Pillow 12.8/100: 13% rage bloodlust, enrage, taste_for_blood(3), battle_cry
0:39.558 odyns_fury Fluffy_Pillow 12.8/100: 13% rage bloodlust, enrage, taste_for_blood(3), battle_cry
0:40.605 dragon_roar Fluffy_Pillow 22.7/100: 23% rage enrage, taste_for_blood(3), battle_cry
0:41.781 raging_blow Fluffy_Pillow 22.7/100: 23% rage dragon_roar, enrage, taste_for_blood(3), battle_cry
0:42.960 bloodthirst Fluffy_Pillow 37.6/100: 38% rage dragon_roar, enrage, taste_for_blood(3), battle_cry
0:44.135 furious_slash Fluffy_Pillow 57.5/100: 57% rage dragon_roar, enrage
0:45.313 execute Fluffy_Pillow 67.4/100: 67% rage dragon_roar, enrage, taste_for_blood, stone_heart
0:46.490 raging_blow Fluffy_Pillow 77.3/100: 77% rage massacre, dragon_roar, enrage, taste_for_blood, juggernaut
0:47.666 rampage Fluffy_Pillow 92.2/100: 92% rage massacre, enrage, taste_for_blood, juggernaut
0:49.170 heroic_leap Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, juggernaut, stone_heart
0:49.170 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, juggernaut, stone_heart
0:50.676 execute Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, juggernaut, stone_heart
0:51.853 raging_blow Fluffy_Pillow 34.8/100: 35% rage massacre, enrage, taste_for_blood, juggernaut(2)
0:53.029 bloodthirst Fluffy_Pillow 39.8/100: 40% rage massacre, enrage, juggernaut(2)
0:54.206 rampage Fluffy_Pillow 59.7/100: 60% rage massacre, enrage, juggernaut(2)
0:55.710 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, juggernaut(2), odyns_champion
0:56.888 bloodthirst Fluffy_Pillow 84.5/100: 84% rage enrage, odyns_champion
0:58.064 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, odyns_champion
0:59.567 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, odyns_champion
1:00.743 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, odyns_champion
1:01.919 execute Fluffy_Pillow 59.7/100: 60% rage enrage, stone_heart
1:03.095 dragon_roar Fluffy_Pillow 59.7/100: 60% rage enrage, juggernaut
1:04.273 bloodthirst Fluffy_Pillow 69.6/100: 70% rage dragon_roar, juggernaut
1:05.450 raging_blow Fluffy_Pillow 86.2/100: 86% rage dragon_roar, juggernaut
1:06.626 furious_slash Fluffy_Pillow 91.2/100: 91% rage dragon_roar, juggernaut
1:07.802 bloodthirst Fluffy_Pillow 97.8/100: 98% rage dragon_roar, taste_for_blood, juggernaut
1:08.979 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage
1:10.483 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage
1:11.659 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage
1:12.834 furious_slash Fluffy_Pillow 49.8/100: 50% rage enrage
1:14.011 heroic_leap Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood
1:14.170 raging_blow Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood
1:15.346 bloodthirst Fluffy_Pillow 74.6/100: 75% rage taste_for_blood
1:16.523 rampage Fluffy_Pillow 94.5/100: 94% rage taste_for_blood
1:18.027 raging_blow Fluffy_Pillow 9.5/100: 9% rage enrage, taste_for_blood
1:19.203 bloodthirst Fluffy_Pillow 24.4/100: 24% rage enrage, taste_for_blood
1:20.381 furious_slash Fluffy_Pillow 44.3/100: 44% rage enrage
1:21.559 execute Fluffy_Pillow 54.2/100: 54% rage enrage, taste_for_blood, stone_heart
1:22.736 raging_blow Fluffy_Pillow 54.2/100: 54% rage massacre, enrage, taste_for_blood, juggernaut
1:23.353 battle_cry Fluffy_Pillow 69.1/100: 69% rage massacre, enrage, taste_for_blood, juggernaut, battle_cry
1:23.453 avatar Fluffy_Pillow 69.1/100: 69% rage massacre, avatar, enrage, taste_for_blood, juggernaut, battle_cry
1:23.911 rampage Fluffy_Pillow 69.1/100: 69% rage massacre, avatar, enrage, taste_for_blood, juggernaut, battle_cry
1:25.416 odyns_fury Fluffy_Pillow 79.0/100: 79% rage avatar, enrage, taste_for_blood, juggernaut, battle_cry
1:26.593 raging_blow Fluffy_Pillow 88.9/100: 89% rage avatar, enrage, taste_for_blood, juggernaut, battle_cry
1:27.772 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, enrage, taste_for_blood, battle_cry
1:29.277 dragon_roar Fluffy_Pillow 24.9/100: 25% rage avatar, enrage
1:30.453 raging_blow Fluffy_Pillow 34.8/100: 35% rage avatar, dragon_roar, enrage
1:31.630 execute Fluffy_Pillow 49.7/100: 50% rage avatar, dragon_roar, enrage, stone_heart
1:32.807 bloodthirst Fluffy_Pillow 59.6/100: 60% rage avatar, dragon_roar, enrage, juggernaut
1:33.984 raging_blow Fluffy_Pillow 69.6/100: 70% rage avatar, dragon_roar, enrage, juggernaut
1:35.161 furious_slash Fluffy_Pillow 84.5/100: 84% rage avatar, dragon_roar, enrage, juggernaut
1:36.338 bloodthirst Fluffy_Pillow 94.4/100: 94% rage avatar, enrage, taste_for_blood, juggernaut
1:37.514 execute Fluffy_Pillow 100.0/100: 100% rage avatar, enrage, taste_for_blood, juggernaut, stone_heart
1:38.689 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, taste_for_blood, juggernaut(2), berserking_
1:40.193 raging_blow Fluffy_Pillow 24.9/100: 25% rage avatar, enrage, taste_for_blood, juggernaut(2), berserking_(2)
1:41.369 bloodthirst Fluffy_Pillow 39.8/100: 40% rage avatar, enrage, taste_for_blood, juggernaut(2), berserking_(3)
1:42.547 furious_slash Fluffy_Pillow 59.7/100: 60% rage avatar, enrage, juggernaut(2), berserking_(5)
1:43.723 execute Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, berserking_(6), stone_heart
1:44.901 heroic_leap Fluffy_Pillow 79.5/100: 79% rage massacre, enrage, taste_for_blood, juggernaut, berserking_(7)
1:44.901 raging_blow Fluffy_Pillow 79.5/100: 79% rage massacre, enrage, taste_for_blood, juggernaut, berserking_(7)
1:46.076 rampage Fluffy_Pillow 94.4/100: 94% rage massacre, enrage, taste_for_blood, juggernaut, berserking_(8)
1:47.581 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, juggernaut, berserking_(10)
1:49.086 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, juggernaut, odyns_champion, berserking_(11)
1:50.264 bloodthirst Fluffy_Pillow 49.7/100: 50% rage enrage, taste_for_blood, odyns_champion, berserking_(12)
1:51.440 furious_slash Fluffy_Pillow 69.6/100: 70% rage enrage, odyns_champion, berserking_(12)
1:52.616 dragon_roar Fluffy_Pillow 79.5/100: 79% rage enrage, taste_for_blood, odyns_champion
1:53.793 raging_blow Fluffy_Pillow 89.4/100: 89% rage dragon_roar, enrage, taste_for_blood, odyns_champion
1:54.969 execute Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage, taste_for_blood, stone_heart
1:56.144 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, dragon_roar, taste_for_blood, juggernaut
1:57.648 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage, taste_for_blood, juggernaut
1:59.152 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, juggernaut
2:00.328 bloodthirst Fluffy_Pillow 29.9/100: 30% rage enrage, juggernaut
2:01.504 furious_slash Fluffy_Pillow 49.8/100: 50% rage enrage
2:02.682 raging_blow Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood
2:03.858 bloodthirst Fluffy_Pillow 74.6/100: 75% rage enrage, taste_for_blood
2:05.035 furious_slash Fluffy_Pillow 94.5/100: 94% rage enrage
2:06.213 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
2:07.717 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood
2:08.353 battle_cry Fluffy_Pillow 29.9/100: 30% rage enrage, taste_for_blood, battle_cry
2:08.895 use_item_draught_of_souls Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, battle_cry
2:08.895 odyns_fury Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, battle_cry
2:10.072 heroic_leap Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, battle_cry
2:10.072 execute Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, battle_cry, stone_heart
2:11.249 rampage Fluffy_Pillow 49.7/100: 50% rage massacre, enrage, taste_for_blood, juggernaut, battle_cry
2:12.752 raging_blow Fluffy_Pillow 59.6/100: 60% rage enrage, taste_for_blood, juggernaut, battle_cry
2:13.927 bloodthirst Fluffy_Pillow 74.5/100: 74% rage enrage, juggernaut
2:15.105 furious_slash Fluffy_Pillow 94.4/100: 94% rage enrage, juggernaut
2:16.282 execute Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, stone_heart
2:17.458 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, taste_for_blood, juggernaut
2:18.962 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, juggernaut, odyns_champion, berserking_
2:20.467 dragon_roar Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, juggernaut, odyns_champion, berserking_(3)
2:21.641 raging_blow Fluffy_Pillow 34.8/100: 35% rage dragon_roar, enrage, taste_for_blood, juggernaut, odyns_champion, berserking_(4)
2:22.819 bloodthirst Fluffy_Pillow 49.7/100: 50% rage dragon_roar, enrage, taste_for_blood, odyns_champion, berserking_(5)
2:23.994 execute Fluffy_Pillow 69.6/100: 70% rage dragon_roar, enrage, odyns_champion, berserking_(6), stone_heart
2:25.171 raging_blow Fluffy_Pillow 79.5/100: 79% rage massacre, dragon_roar, enrage, juggernaut, berserking_(7)
2:26.347 bloodthirst Fluffy_Pillow 94.4/100: 94% rage massacre, dragon_roar, enrage, juggernaut, berserking_(8)
2:27.522 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, enrage, juggernaut, berserking_(10)
2:29.026 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, juggernaut, berserking_(11)
2:30.531 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, berserking_(12)
2:31.708 bloodthirst Fluffy_Pillow 49.7/100: 50% rage enrage, berserking_(12)
2:32.885 furious_slash Fluffy_Pillow 69.6/100: 70% rage enrage
2:34.060 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood
2:35.236 heroic_leap Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood
2:35.236 bloodthirst Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood
2:36.413 rampage Fluffy_Pillow 100.0/100: 100% rage enrage
2:37.915 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage
2:39.093 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage
2:40.270 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage
2:41.445 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood
2:42.624 bloodthirst Fluffy_Pillow 77.9/100: 78% rage taste_for_blood
2:43.799 furious_slash Fluffy_Pillow 87.9/100: 88% rage enrage
2:44.976 raging_blow Fluffy_Pillow 87.9/100: 88% rage enrage, taste_for_blood
2:46.153 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
2:47.657 dragon_roar Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, odyns_champion
2:48.832 raging_blow Fluffy_Pillow 34.8/100: 35% rage dragon_roar, enrage, taste_for_blood, odyns_champion
2:50.008 bloodthirst Fluffy_Pillow 49.7/100: 50% rage dragon_roar, enrage, taste_for_blood, odyns_champion
2:51.185 furious_slash Fluffy_Pillow 69.6/100: 70% rage dragon_roar, enrage, taste_for_blood, odyns_champion
2:52.361 raging_blow Fluffy_Pillow 76.2/100: 76% rage dragon_roar, taste_for_blood(2), odyns_champion
2:53.536 battle_cry Fluffy_Pillow 81.2/100: 81% rage dragon_roar, taste_for_blood(2)
2:53.536 avatar Fluffy_Pillow 81.2/100: 81% rage dragon_roar, taste_for_blood(2), battle_cry
2:53.536 bloodthirst Fluffy_Pillow 81.2/100: 81% rage avatar, dragon_roar, taste_for_blood(2), battle_cry
2:54.713 odyns_fury Fluffy_Pillow 91.2/100: 91% rage avatar, enrage, battle_cry
2:55.891 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, enrage, battle_cry
2:57.396 raging_blow Fluffy_Pillow 24.9/100: 25% rage avatar, enrage, battle_cry
2:58.571 bloodthirst Fluffy_Pillow 39.8/100: 40% rage avatar, enrage
2:59.748 furious_slash Fluffy_Pillow 59.7/100: 60% rage avatar, enrage
3:00.925 heroic_leap Fluffy_Pillow 69.6/100: 70% rage avatar, enrage, taste_for_blood
3:00.925 raging_blow Fluffy_Pillow 69.6/100: 70% rage avatar, enrage, taste_for_blood
3:02.102 bloodthirst Fluffy_Pillow 74.6/100: 75% rage avatar, enrage, taste_for_blood
3:03.280 furious_slash Fluffy_Pillow 94.5/100: 94% rage avatar, enrage
3:04.456 execute Fluffy_Pillow 100.0/100: 100% rage avatar, enrage, taste_for_blood, stone_heart
3:05.633 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, avatar, enrage, taste_for_blood, juggernaut
3:07.139 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, enrage, taste_for_blood, juggernaut, odyns_champion
3:08.643 dragon_roar Fluffy_Pillow 24.9/100: 25% rage avatar, enrage, taste_for_blood, juggernaut, odyns_champion
3:09.820 raging_blow Fluffy_Pillow 34.8/100: 35% rage avatar, dragon_roar, enrage, taste_for_blood, juggernaut, odyns_champion
3:10.999 bloodthirst Fluffy_Pillow 49.7/100: 50% rage avatar, dragon_roar, enrage, taste_for_blood, odyns_champion
3:12.175 furious_slash Fluffy_Pillow 69.6/100: 70% rage avatar, dragon_roar, enrage, odyns_champion
3:13.352 raging_blow Fluffy_Pillow 69.6/100: 70% rage avatar, dragon_roar, taste_for_blood
3:14.529 bloodthirst Fluffy_Pillow 84.5/100: 84% rage dragon_roar, taste_for_blood
3:15.706 furious_slash Fluffy_Pillow 94.5/100: 94% rage enrage
3:16.883 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
3:18.388 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, odyns_champion
3:19.566 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, odyns_champion
3:20.743 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood, odyns_champion
3:21.919 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood(2), odyns_champion
3:23.094 heroic_leap Fluffy_Pillow 74.6/100: 75% rage taste_for_blood(2), odyns_champion
3:23.094 execute Fluffy_Pillow 74.6/100: 75% rage taste_for_blood(2), odyns_champion, stone_heart
3:24.270 rampage Fluffy_Pillow 84.5/100: 84% rage massacre, taste_for_blood(2), sense_death, juggernaut
3:25.774 raging_blow Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood(2), sense_death, juggernaut
3:26.951 dragon_roar Fluffy_Pillow 99.4/100: 99% rage enrage, taste_for_blood(2), sense_death, juggernaut
3:28.127 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage, taste_for_blood(2), sense_death, juggernaut
3:29.631 raging_blow Fluffy_Pillow 24.9/100: 25% rage dragon_roar, enrage, sense_death
3:30.806 bloodthirst Fluffy_Pillow 39.8/100: 40% rage dragon_roar, enrage, sense_death
3:31.984 furious_slash Fluffy_Pillow 59.7/100: 60% rage dragon_roar, enrage, sense_death
3:33.162 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, sense_death
3:33.536 battle_cry Fluffy_Pillow 74.6/100: 75% rage enrage, taste_for_blood, sense_death, battle_cry
3:34.338 berserking Fluffy_Pillow 74.6/100: 75% rage enrage, taste_for_blood, sense_death, battle_cry
3:34.338 odyns_fury Fluffy_Pillow 74.6/100: 75% rage berserking, enrage, taste_for_blood, sense_death, battle_cry
3:35.360 bloodthirst Fluffy_Pillow 84.5/100: 84% rage berserking, enrage, taste_for_blood, battle_cry
3:36.383 rampage Fluffy_Pillow 100.0/100: 100% rage berserking, enrage, battle_cry
3:37.747 raging_blow Fluffy_Pillow 24.9/100: 25% rage berserking, enrage, battle_cry
3:38.769 bloodthirst Fluffy_Pillow 39.8/100: 40% rage berserking, enrage
3:39.791 furious_slash Fluffy_Pillow 59.7/100: 60% rage berserking, enrage
3:40.815 raging_blow Fluffy_Pillow 69.6/100: 70% rage berserking, enrage, taste_for_blood
3:41.838 bloodthirst Fluffy_Pillow 74.6/100: 75% rage berserking, enrage, taste_for_blood
3:42.861 rampage Fluffy_Pillow 94.5/100: 94% rage berserking, taste_for_blood
3:44.223 execute Fluffy_Pillow 19.4/100: 19% rage berserking, enrage, taste_for_blood, berserking_, stone_heart
3:45.383 raging_blow Fluffy_Pillow 29.3/100: 29% rage massacre, enrage, taste_for_blood, juggernaut, berserking_(2)
3:46.561 bloodthirst Fluffy_Pillow 44.2/100: 44% rage massacre, enrage, taste_for_blood, juggernaut, berserking_(3)
3:47.736 furious_slash Fluffy_Pillow 64.1/100: 64% rage massacre, enrage, juggernaut, berserking_(4)
3:48.913 raging_blow Fluffy_Pillow 74.0/100: 74% rage massacre, enrage, taste_for_blood, juggernaut, berserking_(6)
3:50.090 bloodthirst Fluffy_Pillow 88.9/100: 89% rage massacre, enrage, taste_for_blood, juggernaut, berserking_(7)
3:51.265 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, enrage, berserking_(8)
3:52.770 heroic_leap Fluffy_Pillow 100.0/100: 100% rage enrage, berserking_(9)
3:52.770 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, berserking_(9)
3:54.275 execute Fluffy_Pillow 34.8/100: 35% rage enrage, berserking_(11), stone_heart
3:55.452 dragon_roar Fluffy_Pillow 44.7/100: 45% rage massacre, enrage, sense_death, juggernaut, berserking_(12)
3:56.629 execute Fluffy_Pillow 54.6/100: 55% rage massacre, dragon_roar, enrage, sense_death, juggernaut, berserking_(12), stone_heart
3:57.807 rampage Fluffy_Pillow 64.5/100: 65% rage massacre, dragon_roar, enrage, juggernaut(2), berserking_(12)
3:59.312 execute Fluffy_Pillow 74.4/100: 74% rage dragon_roar, enrage, juggernaut(2)
4:00.488 execute Fluffy_Pillow 59.3/100: 59% rage massacre, dragon_roar, enrage, sense_death, juggernaut(3)
4:01.665 execute Fluffy_Pillow 69.2/100: 69% rage massacre, enrage, juggernaut(4)
4:02.840 rampage Fluffy_Pillow 54.1/100: 54% rage massacre, enrage, juggernaut(5)
4:04.343 execute Fluffy_Pillow 64.0/100: 64% rage enrage, juggernaut(5), berserking_
4:05.518 execute Fluffy_Pillow 48.9/100: 49% rage massacre, enrage, juggernaut(6), berserking_(2)
4:06.694 execute Fluffy_Pillow 33.8/100: 34% rage massacre, enrage, juggernaut(7), berserking_(3)
4:07.871 rampage Fluffy_Pillow 18.7/100: 19% rage massacre, enrage, juggernaut(8), berserking_(5)
4:09.375 execute Fluffy_Pillow 28.6/100: 29% rage enrage, juggernaut(8), berserking_(6)
4:10.551 raging_blow Fluffy_Pillow 13.5/100: 13% rage massacre, enrage, juggernaut(9), berserking_(7)
4:11.727 execute Fluffy_Pillow 28.4/100: 28% rage massacre, enrage, juggernaut(9), berserking_(8)
4:12.905 rampage Fluffy_Pillow 13.3/100: 13% rage massacre, enrage, juggernaut(10), berserking_(10)
4:14.409 raging_blow Fluffy_Pillow 23.2/100: 23% rage enrage, juggernaut(10), berserking_(11)
4:15.586 execute Fluffy_Pillow 38.1/100: 38% rage enrage, juggernaut(10), berserking_(12)
4:16.765 bloodthirst Fluffy_Pillow 23.0/100: 23% rage massacre, enrage, juggernaut(11), berserking_(12)
4:17.941 execute Fluffy_Pillow 52.8/100: 53% rage massacre, enrage, juggernaut(11), stone_heart
4:19.117 execute Fluffy_Pillow 62.7/100: 63% rage massacre, enrage, juggernaut(12), stone_heart
4:20.291 dragon_roar Fluffy_Pillow 72.6/100: 73% rage massacre, enrage, juggernaut(13), stone_heart
4:21.628 execute Fluffy_Pillow 72.6/100: 73% rage massacre, dragon_roar, enrage, juggernaut(13), stone_heart
4:22.803 heroic_leap Fluffy_Pillow 82.5/100: 82% rage massacre, dragon_roar, juggernaut(14)
4:22.803 rampage Fluffy_Pillow 82.5/100: 82% rage massacre, dragon_roar, juggernaut(14)
4:23.536 battle_cry Fluffy_Pillow 92.4/100: 92% rage dragon_roar, enrage, juggernaut(14), battle_cry
4:23.636 avatar Fluffy_Pillow 92.4/100: 92% rage avatar, dragon_roar, enrage, juggernaut(14), battle_cry
4:24.308 use_item_draught_of_souls Fluffy_Pillow 92.4/100: 92% rage avatar, dragon_roar, enrage, juggernaut(14), battle_cry
4:24.308 potion Fluffy_Pillow 92.4/100: 92% rage avatar, dragon_roar, enrage, juggernaut(14), battle_cry
4:24.308 odyns_fury Fluffy_Pillow 92.4/100: 92% rage avatar, dragon_roar, enrage, juggernaut(14), battle_cry, potion_of_the_old_war
4:25.486 execute Fluffy_Pillow 100.0/100: 100% rage avatar, dragon_roar, enrage, juggernaut(14), battle_cry, potion_of_the_old_war
4:26.663 execute Fluffy_Pillow 84.9/100: 85% rage massacre, avatar, enrage, juggernaut(15), battle_cry, potion_of_the_old_war
4:27.839 rampage Fluffy_Pillow 69.8/100: 70% rage massacre, avatar, enrage, juggernaut(16), battle_cry, potion_of_the_old_war
4:29.344 execute Fluffy_Pillow 79.7/100: 80% rage avatar, enrage, juggernaut(16), stone_heart, potion_of_the_old_war
4:30.519 execute Fluffy_Pillow 89.6/100: 90% rage massacre, avatar, enrage, juggernaut(17), potion_of_the_old_war
4:31.695 execute Fluffy_Pillow 74.5/100: 74% rage massacre, avatar, enrage, juggernaut(18), potion_of_the_old_war
4:32.869 rampage Fluffy_Pillow 49.5/100: 49% rage massacre, avatar, enrage, juggernaut(19), potion_of_the_old_war
4:34.374 execute Fluffy_Pillow 69.3/100: 69% rage avatar, enrage, juggernaut(19), potion_of_the_old_war
4:35.549 execute Fluffy_Pillow 44.3/100: 44% rage avatar, enrage, juggernaut(20), potion_of_the_old_war
4:36.728 execute Fluffy_Pillow 29.2/100: 29% rage massacre, avatar, enrage, juggernaut(21), potion_of_the_old_war
4:37.905 rampage Fluffy_Pillow 14.1/100: 14% rage massacre, avatar, enrage, sense_death, juggernaut(22), potion_of_the_old_war
4:39.411 execute Fluffy_Pillow 24.0/100: 24% rage avatar, enrage, sense_death, juggernaut(22), potion_of_the_old_war
4:40.589 execute Fluffy_Pillow 33.9/100: 34% rage massacre, avatar, enrage, juggernaut(23), potion_of_the_old_war
4:41.766 raging_blow Fluffy_Pillow 18.8/100: 19% rage massacre, avatar, enrage, juggernaut(24), potion_of_the_old_war
4:42.942 rampage Fluffy_Pillow 33.7/100: 34% rage massacre, avatar, enrage, juggernaut(24), potion_of_the_old_war
4:44.447 execute Fluffy_Pillow 43.6/100: 44% rage enrage, juggernaut(24), potion_of_the_old_war
4:45.623 dragon_roar Fluffy_Pillow 28.5/100: 28% rage massacre, enrage, juggernaut(25), potion_of_the_old_war
4:46.800 execute Fluffy_Pillow 28.5/100: 28% rage massacre, dragon_roar, enrage, juggernaut(25), stone_heart, potion_of_the_old_war
4:47.976 rampage Fluffy_Pillow 38.4/100: 38% rage massacre, dragon_roar, enrage, juggernaut(26), potion_of_the_old_war
4:49.481 execute Fluffy_Pillow 48.3/100: 48% rage dragon_roar, enrage, juggernaut(26)
4:50.657 execute Fluffy_Pillow 33.2/100: 33% rage dragon_roar, enrage, juggernaut(27)
4:51.834 raging_blow Fluffy_Pillow 18.1/100: 18% rage massacre, enrage, juggernaut(28)
4:53.011 heroic_leap Fluffy_Pillow 33.0/100: 33% rage massacre, enrage, juggernaut(28)
4:53.011 rampage Fluffy_Pillow 33.0/100: 33% rage massacre, enrage, juggernaut(28)
4:54.516 execute Fluffy_Pillow 42.9/100: 43% rage enrage, juggernaut(28)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 30956 29250 17625 (4389)
Agility 6579 6254 0
Stamina 51209 51209 27995
Intellect 5321 4996 0
Spirit 1 1 0
Health 3072540 3072540 0
Rage 100 100 0
Crit 24.43% 24.43% 6802
Haste 27.98% 27.98% 9093
Damage / Heal Versatility 1.39% 1.39% 558
Attack Power 30956 29250 0
Mastery 30.35% 28.85% 4414
Armor 4262 4262 4262
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Warhelm of the Obsidian Aspect
ilevel: 870, stats: { 580 Armor, +1563 Str, +2345 Sta, +763 Crit, +643 Haste }
Local Neck Radiant String of Scorpid Eyes
ilevel: 870, stats: { +1319 Sta, +1074 Haste, +905 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Shoulderplates of the Obsidian Aspect
ilevel: 870, stats: { 535 Armor, +1172 Str, +1758 Sta, +731 Haste, +324 Crit }
Local Chest Chestplate of the Obsidian Aspect
ilevel: 870, stats: { 713 Armor, +1563 Str, +2345 Sta, +945 Haste, +462 Crit }
Local Waist Waistplate of Nameless Horror
ilevel: 880, stats: { 410 Armor, +1930 Sta, +1287 StrInt, +665 Haste, +430 Crit }
Local Legs Legplates of the Obsidian Aspect
ilevel: 870, stats: { 624 Armor, +1563 Str, +2345 Sta, +885 Crit, +523 Haste }
Local Feet Immaculately Polished Boots
ilevel: 870, stats: { 490 Armor, +1758 Sta, +1172 StrInt, +731 Haste, +324 Mastery }
Local Wrists Dragonbone Wristclamps
ilevel: 880, stats: { 319 Armor, +1447 Sta, +965 StrInt, +551 Mastery, +270 Haste }
Local Hands Gauntlets of the Obsidian Aspect
ilevel: 870, stats: { 446 Armor, +1172 Str, +1758 Sta, +731 Haste, +324 Vers }
Local Finger1 Ring of Braided Stems
ilevel: 870, stats: { +1319 Sta, +1188 Haste, +791 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ayala's Stone Heart
ilevel: 895, stats: { +1665 Sta, +1397 Crit, +776 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Ursoc's Rending Paw
ilevel: 880, stats: { +1631 Str }
Local Trinket2 Draught of Souls
ilevel: 870, stats: { +1005 Haste }
Local Back Astromancer's Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +587 Haste, +234 Vers }, enchant: { +200 Str }
Local Main Hand Warswords of the Valarjar
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Warswords of the Valarjar
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }

Talents

Level
15 War Machine (Fury Warrior) Endless Rage (Fury Warrior) Fresh Meat (Fury Warrior)
30 Shockwave (Fury Warrior) Storm Bolt (Fury Warrior) Double Time
45 Wrecking Ball (Fury Warrior) Outburst Avatar
60 Furious Charge (Fury Warrior) Bounding Stride Warpaint (Fury Warrior)
75 Massacre (Fury Warrior) Frothing Berserker (Fury Warrior) Carnage (Fury Warrior)
90 Bloodbath (Fury Warrior) Frenzy (Fury Warrior) Inner Rage (Fury Warrior)
100 Bladestorm (Fury Warrior) Reckless Abandon (Fury Warrior) Dragon Roar (Fury Warrior)

Profile

warrior="Warrior_Fury_T19M"
level=110
race=troll
role=attack
position=back
talents=2232133
artifact=35:139256:139262:139255:0:980:1:981:1:982:1:984:1:985:1:986:1:987:1:988:4:989:4:990:4:991:3:992:3:993:3:994:3:995:3:996:3:1357:1
spec=fury

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/charge
actions+=/run_action_list,name=movement,if=movement.distance>5
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
actions+=/use_item,name=draught_of_souls,if=(spell_targets.whirlwind>1|!raid_event.adds.exists)&((talent.bladestorm.enabled&cooldown.bladestorm.remains=0)|buff.battle_cry.up|target.time_to_die<25)
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
actions+=/battle_cry,if=(cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))
actions+=/avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
actions+=/bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
actions+=/blood_fury,if=buff.battle_cry.up
actions+=/berserking,if=buff.battle_cry.up
actions+=/arcane_torrent,if=rage<rage.max-40
actions+=/call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
actions+=/call_action_list,name=aoe,if=spell_targets.whirlwind>3
actions+=/call_action_list,name=single_target

actions.aoe=bloodthirst,if=buff.enrage.down|rage<50
actions.aoe+=/call_action_list,name=bladestorm
actions.aoe+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.aoe+=/whirlwind,if=buff.enrage.up
actions.aoe+=/dragon_roar
actions.aoe+=/rampage,if=buff.meat_cleaver.up
actions.aoe+=/bloodthirst
actions.aoe+=/whirlwind

actions.bladestorm=bladestorm,if=buff.enrage.remains>2&(raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets)

actions.movement=heroic_leap

actions.single_target=bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
actions.single_target+=/execute,if=(artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2))|buff.stone_heart.react
actions.single_target+=/rampage,if=rage=100&(target.health.pct>20|target.health.pct<20&!talent.massacre.enabled)|buff.massacre.react&buff.enrage.remains<1
actions.single_target+=/berserker_rage,if=talent.outburst.enabled&cooldown.odyns_fury.remains=0&buff.enrage.down
actions.single_target+=/dragon_roar,if=cooldown.odyns_fury.remains>=10|cooldown.odyns_fury.remains<=3
actions.single_target+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.single_target+=/rampage,if=buff.enrage.down&buff.juggernaut.down
actions.single_target+=/furious_slash,if=talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
actions.single_target+=/raging_blow,if=buff.juggernaut.down&buff.enrage.up
actions.single_target+=/whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
actions.single_target+=/execute,if=talent.inner_rage.enabled|!talent.inner_rage.enabled&rage>50
actions.single_target+=/bloodthirst,if=buff.enrage.down
actions.single_target+=/raging_blow,if=buff.enrage.down
actions.single_target+=/execute,if=artifact.juggernaut.enabled
actions.single_target+=/raging_blow
actions.single_target+=/bloodthirst
actions.single_target+=/furious_slash
actions.single_target+=/call_action_list,name=bladestorm
actions.single_target+=/bloodbath,if=buff.frothing_berserker.up|(rage>80&!talent.frothing_berserker.enabled)

actions.two_targets=whirlwind,if=buff.meat_cleaver.down
actions.two_targets+=/call_action_list,name=bladestorm
actions.two_targets+=/rampage,if=buff.enrage.down|(rage=100&buff.juggernaut.down)|buff.massacre.up
actions.two_targets+=/bloodthirst,if=buff.enrage.down
actions.two_targets+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.two_targets+=/raging_blow,if=talent.inner_rage.enabled&spell_targets.whirlwind=2
actions.two_targets+=/whirlwind,if=spell_targets.whirlwind>2
actions.two_targets+=/dragon_roar
actions.two_targets+=/bloodthirst
actions.two_targets+=/whirlwind

head=warhelm_of_the_obsidian_aspect,id=138357,bonus_id=3443
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3443,enchant=mark_of_the_hidden_satyr
shoulders=shoulderplates_of_the_obsidian_aspect,id=138363,bonus_id=3443
back=astromancers_greatcloak,id=140909,bonus_id=1806,enchant=binding_of_strength
chest=chestplate_of_the_obsidian_aspect,id=138351,bonus_id=3443
wrists=dragonbone_wristclamps,id=138218,bonus_id=1806
hands=gauntlets_of_the_obsidian_aspect,id=138354,bonus_id=3443
waist=waistplate_of_nameless_horror,id=139227,bonus_id=1806
legs=legplates_of_the_obsidian_aspect,id=138360,bonus_id=3443
feet=immaculately_polished_boots,id=140904,bonus_id=3443
finger1=ring_of_braided_stems,id=140896,bonus_id=3443,enchant=binding_of_mastery
finger2=ayalas_stone_heart,id=137052,bonus_id=1811,enchant=binding_of_mastery
trinket1=ursocs_rending_paw,id=139328,bonus_id=1806
trinket2=draught_of_souls,id=140808,bonus_id=3443
main_hand=warswords_of_the_valarjar,id=128908,bonus_id=751,gem_id=139256/139262/139255,relic_id=1806/1806/1806
off_hand=warswords_of_the_valarjar,id=134553

# Gear Summary
# gear_ilvl=878.56
# gear_strength=17625
# gear_stamina=27995
# gear_crit_rating=6802
# gear_haste_rating=9093
# gear_mastery_rating=4414
# gear_versatility_rating=558
# gear_armor=4262
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length: 225 - 377 ( 300.5 )

Performance:
Total Events Processed: 507728491
Max Event Queue: 510
Sim Seconds: 2254409
CPU Seconds: 1041.9400
Physical Seconds: 525.0749
Speed Up: 2164

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Hunter_BM_T19M Hunter_BM_T19M a_murder_of_crows 131894 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.33sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M crow_peck 131900 8169550 27182 17.08 74233 151239 0.0 85.6 27.6% 0.0% 0.0% 0.0% 0.00sec 12010012 300.55sec
Hunter_BM_T19M Hunter_BM_T19M aspect_of_the_wild 193530 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 127.30sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M auto_shot 0 5060446 16837 24.51 29923 62405 122.8 122.8 34.8% 0.0% 0.0% 0.0% 2.46sec 7439335 300.55sec
Hunter_BM_T19M Hunter_BM_T19M bestial_wrath 19574 0 0 0.00 0 0 8.9 0.0 0.0% 0.0% 0.0% 0.0% 35.38sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M cobra_shot 193455 11496396 38251 13.97 117226 241865 70.2 70.0 37.7% 0.0% 0.0% 0.0% 4.25sec 16900791 300.55sec
Hunter_BM_T19M Hunter_BM_T19M deadly_grace 188091 3651402 12149 5.69 99422 202991 28.5 28.5 27.7% 0.0% 0.0% 0.0% 3.23sec 3651402 300.55sec
Hunter_BM_T19M Hunter_BM_T19M dire_beast 120679 0 0 0.00 0 0 34.2 0.0 0.0% 0.0% 0.0% 0.0% 8.87sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast dire_beast_melee 0 7438797 32285 47.72 32049 64091 183.3 183.3 26.7% 0.0% 0.0% 0.0% 1.64sec 10935736 230.41sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast stomp 201754 7262181 31519 8.91 168189 336553 34.2 34.2 26.2% 0.0% 0.0% 0.0% 8.87sec 10676093 230.41sec
Hunter_BM_T19M Hunter_BM_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M kill_command 34026 0 0 0.00 0 0 73.3 0.0 0.0% 0.0% 0.0% 0.0% 4.10sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_cat kill_command 83381 26872636 89412 14.64 260472 530620 73.3 73.3 39.3% 0.0% 0.0% 0.0% 4.10sec 39505320 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_cat jaws_of_thunder 197162 5378689 17896 5.86 183260 0 29.4 29.4 0.0% 0.0% 0.0% 0.0% 10.09sec 5378689 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_hati kill_command 83381 8172573 27192 14.64 87186 176361 73.3 73.3 27.2% 0.0% 0.0% 0.0% 4.10sec 12014456 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_hati jaws_of_thunder 197162 1636322 5444 5.86 55774 0 29.3 29.3 0.0% 0.0% 0.0% 0.0% 10.11sec 1636322 300.55sec
Hunter_BM_T19M Hunter_BM_T19M pepper_breath ticks -225622 1176475 3922 13.96 16975 0 14.0 69.8 0.0% 0.0% 0.0% 0.0% 21.17sec 1176475 300.55sec
Hunter_BM_T19M Hunter_BM_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M titans_thunder 207068 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.04sec 0 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_cat titans_thunder ticks -207068 1677973 5593 8.49 30778 62464 5.4 42.5 27.6% 0.0% 0.0% 0.0% 61.04sec 1677973 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 2136289 7121 8.12 41231 82442 5.1 40.6 27.7% 0.0% 0.0% 0.0% 63.75sec 2136289 230.41sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 190929 636 0.73 41301 82602 0.5 3.7 26.2% 0.0% 0.0% 0.0% 112.11sec 190929 47.65sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 21253 71 0.08 41354 82515 0.1 0.4 26.5% 0.0% 0.0% 0.0% 63.14sec 21253 10.66sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 6144 20 0.03 40631 82046 0.0 0.1 16.1% 0.0% 0.0% 0.0% 0.00sec 6144 8.33sec
Hunter_BM_T19M Hunter_BM_T19M_hati titans_thunder ticks -207068 2145735 7152 8.49 39311 79882 5.4 42.5 27.6% 0.0% 0.0% 0.0% 61.04sec 2145735 300.55sec
Hunter_BM_T19M Hunter_BM_T19M tormenting_cyclone 221857 1684379 5604 14.27 18523 37521 10.4 71.5 26.5% 0.0% 0.0% 0.0% 28.04sec 1684379 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_cat claw 16827 6398433 21289 20.10 45589 93481 100.7 100.7 37.5% 0.0% 0.0% 0.0% 3.00sec 9406303 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_cat melee 0 6395619 21280 40.15 22847 46610 201.1 201.1 37.7% 0.0% 0.0% 0.0% 1.49sec 9402166 300.55sec
Hunter_BM_T19M Hunter_BM_T19M_hati hati_melee 0 6817403 22683 36.70 29226 59118 182.8 183.8 26.3% 0.0% 0.0% 0.0% 1.64sec 10022228 300.55sec
Hunter_MM_T19M Hunter_MM_T19M aimed_shot 19434 44489089 148027 18.26 325732 775139 91.6 91.4 35.8% 0.0% 0.0% 0.0% 3.26sec 65403175 300.55sec
Hunter_MM_T19M Hunter_MM_T19M legacy_of_the_windrunners 19434 7629688 25386 16.34 62295 148961 0.0 81.9 35.7% 0.0% 0.0% 0.0% 0.00sec 11216365 300.55sec
Hunter_MM_T19M Hunter_MM_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_MM_T19M Hunter_MM_T19M auto_shot 0 4824586 16053 23.81 29694 65651 119.3 119.3 29.9% 0.0% 0.0% 0.0% 2.52sec 7092599 300.55sec
Hunter_MM_T19M Hunter_MM_T19M barrage ticks -120360 12840012 42800 43.66 44093 93349 13.7 218.3 29.9% 0.0% 0.0% 0.0% 22.85sec 18876033 300.55sec
Hunter_MM_T19M Hunter_MM_T19M deadly_grace 188091 4319695 14373 6.77 79173 204849 33.9 33.9 38.4% 0.0% 0.0% 0.0% 8.94sec 4319695 300.55sec
Hunter_MM_T19M Hunter_MM_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_MM_T19M Hunter_MM_T19M marked_shot 185901 16348366 54395 5.78 375562 843249 28.9 28.9 40.5% 0.0% 0.0% 0.0% 10.43sec 24033646 300.55sec
Hunter_MM_T19M Hunter_MM_T19M call_of_the_hunter 191070 1194188 3973 2.40 70835 163219 12.0 12.0 30.9% 0.0% 0.0% 0.0% 46.84sec 1755569 300.55sec
Hunter_MM_T19M Hunter_MM_T19M pepper_breath ticks -225622 1219233 4064 14.46 16972 0 14.5 72.3 0.0% 0.0% 0.0% 0.0% 20.40sec 1219233 300.55sec
Hunter_MM_T19M Hunter_MM_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_MM_T19M Hunter_MM_T19M sidewinders 214579 5187956 17262 6.60 114546 255597 33.1 33.1 30.0% 0.0% 0.0% 0.0% 9.15sec 5187956 300.55sec
Hunter_MM_T19M Hunter_MM_T19M tormenting_cyclone 221857 1556492 5179 14.88 15351 33680 10.8 74.5 30.2% 0.0% 0.0% 0.0% 26.79sec 1556492 300.55sec
Hunter_MM_T19M Hunter_MM_T19M trueshot 193526 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 157.65sec 0 300.55sec
Hunter_MM_T19M Hunter_MM_T19M windburst 204147 8311228 27654 2.83 440776 931924 13.2 14.2 29.6% 0.0% 0.0% 0.0% 21.88sec 12218292 300.55sec
Hunter_SV_T19M Hunter_SV_T19M aspect_of_the_eagle 186289 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.05sec 0 300.55sec
Hunter_SV_T19M Hunter_SV_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_SV_T19M Hunter_SV_T19M auto_attack_mh 0 5675737 18885 20.81 37485 74981 104.2 104.2 45.3% 0.0% 0.0% 0.0% 2.88sec 8343871 300.55sec
Hunter_SV_T19M Hunter_SV_T19M talon_strike 203525 1522759 5067 4.14 50501 100978 20.8 20.8 45.3% 0.0% 0.0% 0.0% 26.52sec 2238601 300.55sec
Hunter_SV_T19M Hunter_SV_T19M cleansed_drakes_breath 222520 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 62.99sec 0 300.55sec
Hunter_SV_T19M Hunter_SV_T19M dragonsfire_grenade 194855 1027772 3420 2.04 100428 0 10.3 10.2 0.0% 0.0% 0.0% 0.0% 30.57sec 5984901 300.55sec
Hunter_SV_T19M Hunter_SV_T19M dragonsfire_grenade ticks -194855 4957129 16524 16.14 42250 84529 10.3 80.7 45.3% 0.0% 0.0% 0.0% 30.57sec 5984901 300.55sec
Hunter_SV_T19M Hunter_SV_T19M explosive_trap 13812 8021050 26688 4.94 223176 446111 24.8 24.8 45.2% 0.0% 0.0% 0.0% 12.37sec 16226665 300.55sec
Hunter_SV_T19M Hunter_SV_T19M explosive_trap ticks -13812 8205615 27352 48.64 23222 46451 24.8 243.2 45.3% 0.0% 0.0% 0.0% 12.37sec 16226665 300.55sec
Hunter_SV_T19M Hunter_SV_T19M flanking_strike 202800 7867714 26178 5.90 167878 335940 29.6 29.6 58.4% 0.0% 0.0% 0.0% 9.78sec 11566285 300.55sec
Hunter_SV_T19M Hunter_SV_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_SV_T19M Hunter_SV_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_SV_T19M Hunter_SV_T19M fury_of_the_eagle ticks -203415 8890083 29634 11.75 104060 208455 6.6 58.8 45.2% 0.0% 0.0% 0.0% 47.93sec 13069264 300.55sec
Hunter_SV_T19M Hunter_SV_T19M harpoon 190925 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_SV_T19M Hunter_SV_T19M lacerate 185855 1623844 5403 5.03 44348 88708 25.2 25.2 45.3% 0.0% 0.0% 0.0% 11.86sec 14090264 300.55sec
Hunter_SV_T19M Hunter_SV_T19M lacerate ticks -185855 11703059 39010 57.56 27991 55979 25.2 287.8 45.3% 0.0% 0.0% 0.0% 11.86sec 14090264 300.55sec
Hunter_SV_T19M Hunter_SV_T19M mongoose_bite 190928 13764472 45798 8.96 211127 422392 44.9 44.9 45.2% 0.0% 0.0% 0.0% 6.61sec 20235078 300.55sec
Hunter_SV_T19M Hunter_SV_T19M on_the_trail ticks -204081 2452058 8174 60.01 8172 0 0.0 300.1 0.0% 0.0% 0.0% 0.0% 0.00sec 2452058 300.55sec
Hunter_SV_T19M Hunter_SV_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_SV_T19M Hunter_SV_T19M potion_of_the_old_war 188028 4780465 15906 4.66 140942 282060 23.3 23.3 45.3% 0.0% 0.0% 0.0% 3.78sec 7027737 300.55sec
Hunter_SV_T19M Hunter_SV_T19M raptor_strike 186270 8567995 28508 9.85 119613 239199 49.3 49.3 45.3% 0.0% 0.0% 0.0% 6.12sec 12595765 300.55sec
Hunter_SV_T19M Hunter_SV_T19M snake_hunter 201078 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 95.61sec 0 300.55sec
Hunter_SV_T19M Hunter_SV_T19M summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Hunter_SV_T19M Hunter_SV_T19M_cat claw 16827 3485955 11599 20.10 22313 44645 100.7 100.7 55.1% 0.0% 0.0% 0.0% 3.00sec 5124685 300.55sec
Hunter_SV_T19M Hunter_SV_T19M_cat flanking_strike 204740 3536162 11766 5.90 71109 142198 29.6 29.6 68.2% 0.0% 0.0% 0.0% 9.78sec 5198493 300.55sec
Hunter_SV_T19M Hunter_SV_T19M_cat melee 0 4162080 13848 47.32 11305 22611 237.0 237.0 55.3% 0.0% 0.0% 0.0% 1.26sec 6118652 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M aegwynns_ascendance 187677 1143011 3803 0.66 345191 0 3.3 3.3 0.0% 0.0% 0.0% 0.0% 98.52sec 1143011 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_barrage 44425 3261764 10853 1.95 262326 524731 9.8 9.7 27.6% 0.0% 0.0% 0.0% 27.24sec 3261764 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_blast 30451 46520567 154786 19.46 374525 748254 96.5 97.5 27.5% 0.0% 0.0% 0.0% 3.11sec 46520567 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_explosion 1449 652947 2173 0.50 204755 411177 2.5 2.5 26.7% 0.0% 0.0% 0.0% 69.72sec 652947 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_missiles ticks -5143 36358428 121195 55.10 103855 207662 46.0 275.5 27.5% 0.0% 0.0% 0.0% 6.30sec 36358428 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.16sec 0 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.24sec 0 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M deadly_grace 188091 6353043 21138 7.85 126699 253487 39.3 39.3 27.5% 0.0% 0.0% 0.0% 5.94sec 6353043 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M evocation 12051 0 0 0.00 0 0 3.3 0.0 0.0% 0.0% 0.0% 0.0% 98.08sec 0 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M mark_of_aluneth ticks -224968 2940957 9803 6.20 74463 148663 5.2 31.0 27.5% 0.0% 0.0% 0.0% 62.24sec 2940957 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M mark_of_aluneth_explosion 210726 2710790 9019 1.04 407858 817251 5.2 5.2 27.2% 0.0% 0.0% 0.0% 62.18sec 2710790 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M mark_of_the_hidden_satyr 191259 3134718 10430 4.24 115935 231181 21.2 21.2 27.5% 0.0% 0.0% 0.0% 14.04sec 3134718 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M nether_tempest ticks -114923 6388030 21293 84.37 11875 23754 25.8 421.9 27.5% 0.0% 0.0% 0.0% 11.61sec 6388030 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M nether_tempest_aoe ticks -114954 6391093 21304 0.00 11938 23875 421.9 0.0 27.5% 0.0% 0.0% 0.0% 0.70sec 6391093 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M plague_swarm ticks -221812 5092767 16976 14.42 55404 110736 17.0 72.1 27.5% 0.0% 0.0% 0.0% 17.43sec 5092767 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M rune_of_power 116011 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 35.30sec 0 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M summon_arcane_familiar 205022 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M supernova 157980 2293344 7631 1.88 190746 380313 9.4 9.4 27.5% 0.0% 0.0% 0.0% 31.11sec 2293344 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M tormenting_cyclone 221857 2217199 7377 17.39 19978 39985 12.7 87.1 27.4% 0.0% 0.0% 0.0% 22.92sec 2217199 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M touch_of_the_magi 210833 3655545 12163 1.65 441506 0 8.3 8.3 0.0% 0.0% 0.0% 0.0% 33.98sec 3655545 300.55sec
Mage_Arcane_T19M Mage_Arcane_T19M_arcane_familiar arcane_assault 205235 3173526 10559 29.46 16869 33733 148.2 147.6 27.5% 0.0% 0.0% 0.0% 2.04sec 3173526 300.55sec
Mage_Fire_T19M Mage_Fire_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Fire_T19M Mage_Fire_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 238.41sec 0 300.55sec
Mage_Fire_T19M Mage_Fire_T19M blast_furance ticks -194522 1376862 4590 44.51 3041 7892 36.3 222.5 64.9% 0.0% 0.0% 0.0% 8.33sec 1376862 300.55sec
Mage_Fire_T19M Mage_Fire_T19M combustion 190319 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 79.56sec 0 300.55sec
Mage_Fire_T19M Mage_Fire_T19M deadly_grace 188091 5494163 18280 4.88 94535 262986 24.5 24.5 77.2% 0.0% 0.0% 0.0% 4.62sec 5494163 300.55sec
Mage_Fire_T19M Mage_Fire_T19M fire_blast 108853 7921860 26358 7.25 0 218007 36.3 36.3 100.0% 0.0% 0.0% 0.0% 8.33sec 7921860 300.55sec
Mage_Fire_T19M Mage_Fire_T19M fireball 133 10939629 36399 15.06 79199 175830 75.5 75.4 68.1% 0.0% 0.0% 0.0% 3.68sec 10939629 300.55sec
Mage_Fire_T19M Mage_Fire_T19M flame_on 205029 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 76.37sec 0 300.55sec
Mage_Fire_T19M Mage_Fire_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Fire_T19M Mage_Fire_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Fire_T19M Mage_Fire_T19M ignite ticks -12846 26424009 88080 59.86 88292 0 223.9 299.3 0.0% 0.0% 0.0% 0.0% 1.35sec 26424009 300.55sec
Mage_Fire_T19M Mage_Fire_T19M maddening_whispers 222050 6256628 20817 0.46 730373 2738474 2.3 2.3 100.0% 0.0% 0.0% 0.0% 160.08sec 6256628 300.55sec
Mage_Fire_T19M Mage_Fire_T19M mark_of_the_hidden_satyr 191259 3355047 11163 3.39 97956 251145 17.0 17.0 65.1% 0.0% 0.0% 0.0% 17.59sec 3355047 300.55sec
Mage_Fire_T19M Mage_Fire_T19M phoenix_reborn 215773 1076748 3583 4.99 21645 55055 25.0 25.0 64.1% 0.0% 0.0% 0.0% 11.67sec 1076748 300.55sec
Mage_Fire_T19M Mage_Fire_T19M phoenixs_flames 194466 5906204 19651 2.71 0 435441 13.6 13.6 100.0% 0.0% 0.0% 0.0% 22.93sec 5906204 300.55sec
Mage_Fire_T19M Mage_Fire_T19M phoenixs_flames_splash 224637 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 22.95sec 0 300.55sec
Mage_Fire_T19M Mage_Fire_T19M plague_swarm ticks -221812 5848786 19496 12.27 48409 121032 13.6 61.4 64.6% 0.0% 0.0% 0.0% 21.76sec 5848786 300.55sec
Mage_Fire_T19M Mage_Fire_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Fire_T19M Mage_Fire_T19M pyroblast 11366 52286553 173971 19.56 272455 622821 97.2 98.0 74.6% 0.0% 0.0% 0.0% 3.08sec 52286553 300.55sec
Mage_Fire_T19M Mage_Fire_T19M rune_of_power 116011 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 37.73sec 0 300.55sec
Mage_Fire_T19M Mage_Fire_T19M scorch 2948 54248 180 0.14 0 76641 0.7 0.7 100.0% 0.0% 0.0% 0.0% 150.76sec 54248 300.55sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_arcane_blast 0 331917 1104 0.09 671842 1408881 0.4 0.4 10.1% 0.0% 0.0% 0.0% 318.26sec 331917 300.55sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_fireball 0 199424 664 0.09 383910 803378 0.5 0.5 11.3% 0.0% 0.0% 0.0% 318.61sec 403401 300.55sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_fireball ticks 0 203976 680 0.75 54551 0 0.5 3.7 0.0% 0.0% 0.0% 0.0% 318.61sec 403401 300.55sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_frostbolt 0 324342 1079 0.09 633383 1325294 0.5 0.5 10.4% 0.0% 0.0% 0.0% 318.62sec 324342 300.55sec
Mage_Fire_T19M Mage_Fire_T19M unstable_magic_explosion 157976 1364635 4540 3.76 72477 0 18.8 18.8 0.0% 0.0% 0.0% 0.0% 14.23sec 1364635 300.55sec
Mage_Fire_T19M Mage_Fire_T19M wanton_sorcery 222276 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 318.41sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.59sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M blizzard ticks -190356 2468799 8229 13.26 25378 50474 8.4 66.3 47.2% 0.0% 0.0% 0.0% 11.66sec 2468799 300.55sec
Mage_Frost_T19M Mage_Frost_T19M comet_storm 153595 0 0 0.00 0 0 9.1 0.0 0.0% 0.0% 0.0% 0.0% 32.96sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M comet_storm_projectile 153596 4045939 13462 12.63 48598 97137 63.5 63.3 31.6% 0.0% 0.0% 0.0% 4.29sec 4045939 300.55sec
Mage_Frost_T19M Mage_Frost_T19M deadly_grace 188091 6212672 20671 8.10 116568 233053 40.6 40.6 31.4% 0.0% 0.0% 0.0% 2.18sec 6212672 300.55sec
Mage_Frost_T19M Mage_Frost_T19M ebonbolt 214634 3130959 10418 1.17 404397 812178 5.9 5.9 31.5% 0.0% 0.0% 0.0% 52.04sec 3130959 300.55sec
Mage_Frost_T19M Mage_Frost_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M flurry 44614 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 23.85sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M flurry_bolt 228354 6339473 21093 6.74 110248 220766 33.8 33.8 70.1% 0.0% 0.0% 0.0% 7.49sec 6339473 300.55sec
Mage_Frost_T19M Mage_Frost_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M frost_bomb 112948 0 0 0.00 0 0 16.6 0.0 0.0% 0.0% 0.0% 0.0% 17.73sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M frost_bomb_explosion 113092 6399795 21294 13.17 71431 140727 66.0 66.0 36.9% 0.0% 0.0% 0.0% 4.30sec 6399795 300.55sec
Mage_Frost_T19M Mage_Frost_T19M frostbolt 116 11502431 38272 15.14 98634 196128 75.1 75.8 54.4% 0.0% 0.0% 0.0% 3.67sec 11502431 300.55sec
Mage_Frost_T19M Mage_Frost_T19M icicle 148022 5316613 17690 17.78 59694 0 89.6 89.1 0.0% 0.0% 0.0% 0.0% 3.21sec 5316613 300.55sec
Mage_Frost_T19M Mage_Frost_T19M frozen_orb 84714 0 0 0.00 0 0 5.1 0.0 0.0% 0.0% 0.0% 0.0% 61.61sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M frozen_orb_bolt ticks -84721 1615234 5384 0.00 12263 24516 0.0 0.0 31.5% 0.0% 0.0% 0.0% 0.00sec 1615234 300.55sec
Mage_Frost_T19M Mage_Frost_T19M ice_lance 30455 20671633 68780 13.94 101018 337053 70.0 69.8 82.6% 0.0% 0.0% 0.0% 4.07sec 20671633 300.55sec
Mage_Frost_T19M Mage_Frost_T19M ice_nova 157997 6099296 20294 2.07 431541 823794 10.4 10.4 40.0% 0.0% 0.0% 0.0% 28.92sec 6099296 300.55sec
Mage_Frost_T19M Mage_Frost_T19M icy_veins 12472 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 149.81sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M maddening_whispers 222050 3601263 11982 0.57 952363 1903457 2.9 2.9 31.8% 0.0% 0.0% 0.0% 115.86sec 3601263 300.55sec
Mage_Frost_T19M Mage_Frost_T19M mark_of_the_hidden_satyr 191259 3163104 10524 4.27 112402 225225 21.4 21.4 31.6% 0.0% 0.0% 0.0% 14.18sec 3163104 300.55sec
Mage_Frost_T19M Mage_Frost_T19M plague_swarm ticks -221812 5334004 17780 15.14 53565 107206 17.2 75.7 31.5% 0.0% 0.0% 0.0% 17.50sec 5334004 300.55sec
Mage_Frost_T19M Mage_Frost_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M ray_of_frost ticks -205021 29920859 99736 17.31 262754 525290 4.5 86.6 31.6% 0.0% 0.0% 0.0% 72.61sec 29920859 300.55sec
Mage_Frost_T19M Mage_Frost_T19M rune_of_power 116011 0 0 0.00 0 0 8.9 0.0 0.0% 0.0% 0.0% 0.0% 36.84sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_arcane_blast 0 384752 1280 0.10 721951 1469410 0.5 0.5 9.7% 0.0% 0.0% 0.0% 303.37sec 384752 300.55sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_fireball 0 230070 766 0.10 416259 827155 0.5 0.5 10.1% 0.0% 0.0% 0.0% 303.08sec 621754 300.55sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_fireball ticks 0 391685 1306 1.24 63325 0 0.5 6.2 0.0% 0.0% 0.0% 0.0% 303.08sec 621754 300.55sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_frostbolt 0 367333 1222 0.10 684042 1368072 0.5 0.5 11.0% 0.0% 0.0% 0.0% 302.74sec 367333 300.55sec
Mage_Frost_T19M Mage_Frost_T19M time_warp 80353 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 262.03sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M wanton_sorcery 222276 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 303.03sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M water_elemental 31687 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Mage_Frost_T19M Mage_Frost_T19M_water_elemental water_jet ticks -135029 1442234 4807 7.23 30347 60683 9.1 36.2 31.4% 0.0% 0.0% 0.0% 31.77sec 1442234 300.55sec
Mage_Frost_T19M Mage_Frost_T19M_water_elemental waterbolt 31707 12491418 41562 32.78 57861 115681 165.2 164.2 31.5% 0.0% 0.0% 0.0% 1.81sec 12491418 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M arcane_torrent 155145 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.58sec 0 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M blade_of_justice 184575 11431657 38036 9.77 188407 376424 48.9 48.9 24.1% 0.0% 0.0% 0.0% 6.11sec 16805619 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M blessing_of_might_proc 205729 9934030 33053 32.45 61121 0 189.1 162.5 0.0% 0.0% 0.0% 0.0% 1.99sec 9934030 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M brutal_haymaker 214169 761409 2533 0.94 129348 258129 4.7 4.7 24.6% 0.0% 0.0% 0.0% 54.37sec 1119343 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M brutal_haymaker_vulnerability 228784 2517935 8378 10.27 48937 0 53.6 51.5 0.0% 0.0% 0.0% 0.0% 4.04sec 2517935 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M cleansed_drakes_breath 222520 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 64.17sec 0 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M crusade 231895 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.41sec 0 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M crusader_strike 35395 15133391 50353 21.20 92508 185059 106.2 106.2 54.0% 0.0% 0.0% 0.0% 2.81sec 22247518 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M echoed_verdict 224266 5231512 17407 17.70 47593 95193 88.7 88.7 24.0% 0.0% 0.0% 0.0% 3.38sec 5231512 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M greater_blessing_of_might 203528 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M judgment 20271 8874254 29527 6.87 207745 415024 34.4 34.4 24.1% 0.0% 0.0% 0.0% 8.82sec 8874254 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M judgment_aoe 228288 0 0 0.00 0 0 34.4 0.0 0.0% 0.0% 0.0% 0.0% 8.82sec 0 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M melee 0 5657932 18825 25.33 35935 71837 126.9 126.9 24.1% 0.0% 0.0% 0.0% 2.36sec 8317696 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M potion_of_the_old_war 188028 7884008 26232 7.33 172951 345950 36.7 36.7 24.1% 0.0% 0.0% 0.0% 4.04sec 11590239 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M shield_of_vengeance 184662 0 0 0.76 0 0 3.8 3.8 23.8% 0.0% 0.0% 0.0% 90.00sec 2625460 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M shield_of_vengeance_proc 184689 3724961 12394 0.72 833082 1653410 3.8 3.6 24.2% 0.0% 0.0% 0.0% 89.46sec 3724961 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M templars_verdict 85256 49587486 164990 17.71 450559 901293 88.7 88.7 24.1% 0.0% 0.0% 0.0% 3.38sec 49587486 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M wake_of_ashes 205273 2554459 8499 1.95 211012 422128 9.8 9.8 23.9% 0.0% 0.0% 0.0% 32.48sec 5134603 300.55sec
Paladin_Retribution_T19M Paladin_Retribution_T19M wake_of_ashes ticks -205273 2580144 8600 11.60 35843 71672 9.8 58.0 24.2% 0.0% 0.0% 0.0% 32.48sec 5134603 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.93sec 0 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M deadly_grace 188091 4872915 16213 8.17 95399 190737 40.9 40.9 24.8% 0.0% 0.0% 0.0% 7.49sec 4872915 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M mental_fortitude 194018 0 0 35.39 0 0 177.3 177.3 24.8% 0.0% 0.0% 0.0% 1.68sec 13033605 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M mind_blast 8092 27623389 91910 22.22 198896 397605 110.3 111.3 24.8% 0.0% 0.0% 0.0% 2.71sec 27623389 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M mind_flay ticks -15407 10017529 33392 44.79 35834 71666 75.9 223.9 24.8% 0.0% 0.0% 0.0% 3.89sec 10017529 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M plague_swarm ticks -221812 5295699 17652 16.89 50282 100542 20.5 84.4 24.8% 0.0% 0.0% 0.0% 14.45sec 5295699 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M power_infusion 10060 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 126.18sec 0 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M shadow_word_death 32379 1605098 5341 1.07 240637 482021 5.3 5.3 24.8% 0.0% 0.0% 0.0% 10.69sec 1605098 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M shadow_word_pain 589 164029 546 0.71 36902 73975 3.6 3.6 24.9% 0.0% 0.0% 0.0% 107.58sec 16707936 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M shadow_word_pain ticks -589 16543907 55146 52.98 50037 100123 3.6 264.9 24.8% 0.0% 0.0% 0.0% 107.58sec 16707936 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M sphere_of_insanity 194182 1944104 6469 20.79 18665 0 188.8 104.2 0.0% 0.0% 0.0% 0.0% 1.53sec 0 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M shadowfiend 34433 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 199.11sec 0 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M shadowy_apparitions 78203 1670836 5559 16.80 15920 31835 85.4 84.2 24.7% 0.0% 0.0% 0.0% 3.48sec 1670836 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M tormenting_cyclone 221857 2998533 9977 21.08 22761 45532 15.4 105.6 24.7% 0.0% 0.0% 0.0% 19.00sec 2998533 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M vampiric_touch ticks -34914 20884363 69615 35.45 94408 188858 1.0 177.3 24.8% 0.0% 0.0% 0.0% 0.00sec 20884363 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M void_bolt 205448 19281946 64156 15.07 204827 409479 75.8 75.5 24.7% 0.0% 0.0% 0.0% 3.76sec 19281946 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M void_eruption 228360 1308257 4353 2.91 71780 143549 7.3 14.6 25.0% 0.0% 0.0% 0.0% 42.56sec 1308257 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M void_torrent ticks -205065 6450002 21500 8.03 128922 257382 5.1 40.1 24.8% 0.0% 0.0% 0.0% 62.67sec 6450002 300.55sec
Priest_Shadow_T19M Priest_Shadow_T19M_shadowfiend melee 0 2844262 127700 74.75 82073 164141 27.7 27.7 24.9% 0.0% 0.0% 0.0% 7.00sec 2844262 22.27sec
Priest_Shadow_T19M Priest_Shadow_T19M_shadowfiend shadowcrawl 63619 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 66.77sec 0 22.27sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 3168370 10561 12.97 39147 78294 7.3 64.8 24.8% 0.0% 0.0% 0.0% 38.43sec 3168370 72.03sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 776273 2588 3.18 39147 78294 1.8 15.9 24.8% 0.0% 0.0% 0.0% 85.90sec 776273 17.66sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 459788 1533 1.88 39147 78294 1.1 9.4 25.1% 0.0% 0.0% 0.0% 88.95sec 459788 10.43sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 424500 1415 1.76 39147 78294 1.0 8.8 23.5% 0.0% 0.0% 0.0% 0.00sec 424500 9.76sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 508911 1696 1.80 39147 78294 1.0 9.0 44.4% 0.0% 0.0% 0.0% 0.00sec 508911 10.00sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M berserking 26297 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 258.75sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M deadly_grace 188091 5567443 18524 9.18 97193 194248 46.0 46.0 24.6% 0.0% 0.0% 0.0% 6.33sec 5567443 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M dispersion 47585 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 90.19sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mental_fortitude 194018 0 0 34.88 0 0 174.7 174.7 24.9% 0.0% 0.0% 0.0% 1.68sec 18133618 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mind_blast 8092 25956338 86363 20.32 204372 408588 100.8 101.8 24.8% 0.0% 0.0% 0.0% 2.80sec 25956338 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mind_flay ticks -15407 7656149 25520 34.48 35596 71176 58.9 172.4 24.8% 0.0% 0.0% 0.0% 4.23sec 7656149 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mindbender 200174 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 64.44sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M plague_swarm ticks -221812 5264861 17550 16.71 50485 100931 20.3 83.6 24.8% 0.0% 0.0% 0.0% 14.31sec 5264861 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadow_word_death 32379 2649005 8814 1.70 249406 498716 8.5 8.5 24.8% 0.0% 0.0% 0.0% 10.69sec 2649005 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadow_word_pain 589 111777 372 0.55 32453 65139 2.8 2.8 25.0% 0.0% 0.0% 0.0% 73.38sec 23324066 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadow_word_pain ticks -589 23212289 77374 52.50 70861 141769 2.8 262.5 24.8% 0.0% 0.0% 0.0% 73.38sec 23324066 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M sphere_of_insanity 194182 2068175 6881 22.32 18500 0 206.0 111.8 0.0% 0.0% 0.0% 0.0% 1.35sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadowy_apparitions 78203 1711043 5693 16.68 16422 32834 84.5 83.5 24.7% 0.0% 0.0% 0.0% 3.46sec 1711043 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M surrender_to_madness 193223 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M tormenting_cyclone 221857 3063304 10192 21.01 23312 46653 15.3 105.2 24.8% 0.0% 0.0% 0.0% 18.76sec 3063304 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M vampiric_touch ticks -34914 29051501 96838 34.95 133189 266320 1.2 174.7 24.8% 0.0% 0.0% 0.0% 147.87sec 29051501 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M void_bolt 205448 20630703 68644 15.72 209855 419862 78.9 78.8 24.8% 0.0% 0.0% 0.0% 3.51sec 20630703 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M void_eruption 228360 869529 2893 2.06 67271 134545 5.2 10.3 25.0% 0.0% 0.0% 0.0% 38.73sec 869529 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M void_torrent ticks -205065 4568165 15227 5.56 131624 263348 3.3 27.8 24.7% 0.0% 0.0% 0.0% 78.04sec 4568165 300.55sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_mindbender melee 0 6806613 94391 68.43 66273 132542 82.2 82.2 24.9% 0.0% 0.0% 0.0% 3.25sec 6806613 72.11sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_mindbender shadowcrawl 63619 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 19.42sec 0 72.11sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 2712450 9042 11.10 39147 78294 6.2 55.5 24.8% 0.0% 0.0% 0.0% 40.20sec 2712450 61.68sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 703517 2345 2.89 39147 78294 1.6 14.4 24.5% 0.0% 0.0% 0.0% 84.26sec 703517 16.04sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 456213 1521 1.87 39147 78294 1.0 9.4 24.4% 0.0% 0.0% 0.0% 93.60sec 456213 10.41sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 448625 1495 1.80 39147 78294 1.0 9.0 27.3% 0.0% 0.0% 0.0% 0.00sec 448625 10.00sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 391470 1305 1.80 39147 78294 1.0 9.0 11.1% 0.0% 0.0% 0.0% 0.00sec 391470 10.00sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M auto_attack_mh 0 4932172 16411 39.03 20148 40300 195.5 195.5 44.2% 19.0% 0.0% 0.0% 1.54sec 7250761 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M auto_attack_oh 1 2438677 8114 38.63 10064 20128 193.5 193.5 44.2% 19.0% 0.0% 0.0% 1.55sec 3585086 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M blood_fury 20572 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.78sec 0 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M deadly_poison_dot ticks -2818 4334012 14447 19.90 30183 60379 359.4 99.5 44.3% 0.0% 0.0% 0.0% 0.96sec 4334012 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M deadly_poison_instant 113780 9849612 32772 71.55 19051 38093 358.4 358.4 44.3% 0.0% 0.0% 0.0% 0.96sec 9849612 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M envenom 32645 10885814 36220 5.42 278479 556310 27.1 27.1 44.2% 0.0% 0.0% 0.0% 10.82sec 10885814 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M exsanguinate 200806 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 46.51sec 0 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M from_the_shadows 192434 2896587 9638 28.42 14103 28208 142.4 142.4 44.3% 0.0% 0.0% 0.0% 3.77sec 2896587 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M from_the_shadows_driver 192432 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.59sec 0 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M garrote ticks -703 9759389 32531 34.60 39114 78213 20.0 173.0 44.2% 0.0% 0.0% 0.0% 15.47sec 9759389 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M kingsbane ticks -192759 4500703 15002 9.28 67210 134510 6.8 46.4 44.2% 0.0% 0.0% 0.0% 46.51sec 4500703 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M kingsbane_mh 222062 1099990 3660 1.36 112067 224184 6.8 6.8 44.1% 0.0% 0.0% 0.0% 46.51sec 1099990 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M kingsbane_oh 192760 551744 1836 1.36 56035 112087 6.8 6.8 44.6% 0.0% 0.0% 0.0% 46.51sec 551744 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mark_of_the_hidden_satyr 191259 1640482 5458 3.33 68165 136376 16.7 16.7 44.2% 0.0% 0.0% 0.0% 17.86sec 1640482 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mutilate 1329 0 0 0.00 0 0 90.3 0.0 0.0% 0.0% 0.0% 0.0% 3.33sec 0 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mutilate_mh 5374 11089973 36899 18.03 81684 163421 90.3 90.3 50.3% 0.0% 0.0% 0.0% 3.33sec 16303311 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mutilate_oh 27576 5543353 18444 18.03 40841 81704 90.3 90.3 50.2% 0.0% 0.0% 0.0% 3.33sec 8149254 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M poison_bomb 192660 4306851 14330 6.66 89593 179153 33.3 33.3 44.2% 0.0% 0.0% 0.0% 6.45sec 4306851 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M potion_of_the_old_war 188028 5505065 18317 4.71 161674 323347 23.6 23.6 44.4% 0.0% 0.0% 0.0% 5.54sec 8092967 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M rupture ticks -1943 34963577 116545 41.45 109334 218699 20.6 207.3 54.3% 0.0% 0.0% 0.0% 14.81sec 34963577 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M vanish 1856 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 139.55sec 0 300.55sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M vendetta 79140 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.59sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M agonizing_poison 200803 0 0 0.00 0 0 200.1 0.0 0.0% 0.0% 0.0% 0.0% 1.60sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M auto_attack_mh 0 6354362 21143 39.69 26263 52503 198.8 198.8 40.7% 19.0% 0.0% 0.0% 1.52sec 9341514 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M auto_attack_oh 1 3151381 10485 39.33 13128 26265 197.0 197.0 40.8% 19.0% 0.0% 0.0% 1.53sec 4632829 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M blood_fury 20572 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 124.17sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M envenom 32645 17989065 59854 6.62 385483 771129 33.2 33.2 40.7% 0.0% 0.0% 0.0% 8.90sec 17989065 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M from_the_shadows 192434 5257882 17494 40.69 18325 36650 203.8 203.8 40.8% 0.0% 0.0% 0.0% 2.77sec 5257882 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M from_the_shadows_driver 192432 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 62.06sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M garrote ticks -703 10856787 36189 29.96 51526 102997 17.5 149.8 40.7% 0.0% 0.0% 0.0% 17.84sec 10856787 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M horrific_slam 222168 6067345 20188 23.80 36149 72294 119.2 119.2 40.8% 0.0% 0.0% 0.0% 2.18sec 6067345 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M kingsbane ticks -192759 4393219 14644 9.37 66634 133047 6.9 46.9 40.8% 0.0% 0.0% 0.0% 46.49sec 4393219 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M kingsbane_mh 222062 1453415 4836 1.37 150129 300278 6.9 6.9 40.9% 0.0% 0.0% 0.0% 46.49sec 1453415 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M kingsbane_oh 192760 726936 2419 1.37 75176 150373 6.9 6.9 40.7% 0.0% 0.0% 0.0% 46.49sec 726936 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mark_of_the_hidden_satyr 191259 2120022 7054 3.40 88347 176817 17.0 17.0 40.9% 0.0% 0.0% 0.0% 17.62sec 2120022 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mutilate 1329 0 0 0.00 0 0 78.6 0.0 0.0% 0.0% 0.0% 0.0% 3.82sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mutilate_mh 5374 12131599 40365 15.70 105072 210146 78.6 78.6 46.8% 0.0% 0.0% 0.0% 3.82sec 17834600 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mutilate_oh 27576 6064330 20178 15.70 52563 105130 78.6 78.6 46.7% 0.0% 0.0% 0.0% 3.82sec 8915139 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M poison_bomb 192660 7059137 23488 7.56 132564 265162 37.9 37.9 40.6% 0.0% 0.0% 0.0% 5.96sec 7059137 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M potion_of_the_old_war 188028 6931274 23062 4.81 204324 408660 24.1 24.1 40.8% 0.0% 0.0% 0.0% 4.10sec 10189629 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M rupture ticks -1943 29421414 98071 29.36 132956 265611 11.8 146.8 50.9% 0.0% 0.0% 0.0% 26.11sec 29421414 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.65sec 0 300.55sec
Rogue_Assassination_T19M Rogue_Assassination_T19M vendetta 79140 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 62.06sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M adrenaline_rush 13750 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 46.51sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M ambush 8676 958179 3188 1.06 124239 248479 5.3 5.3 45.0% 0.0% 0.0% 0.0% 52.86sec 1408614 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M auto_attack_mh 0 7644543 25435 40.72 29431 58863 204.0 204.0 46.4% 19.0% 0.0% 0.0% 1.48sec 11238202 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M auto_attack_oh 1 3749387 12475 39.94 14716 29431 200.1 200.1 46.4% 19.0% 0.0% 0.0% 1.50sec 5511955 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M curse_of_the_dreadblades 202665 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 86.98sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M darkstrikes 215659 2610577 8686 7.30 48583 97166 36.6 36.6 46.9% 0.0% 0.0% 0.0% 7.75sec 2610577 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M darkstrikes_absorb 215659 0 0 7.30 0 0 36.6 36.6 0.0% 0.0% 0.0% 0.0% 7.75sec 1974477 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M greed 202822 4531252 15077 6.39 96631 193261 32.0 32.0 46.4% 0.0% 0.0% 0.0% 9.22sec 6661370 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M greed_oh 202823 2266386 7541 6.39 48315 96631 32.0 32.0 46.5% 0.0% 0.0% 0.0% 9.22sec 3331803 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M main_gauche 86392 9434165 31390 34.13 37688 75376 171.0 171.0 46.4% 0.0% 0.0% 0.0% 1.76sec 13869115 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M mark_of_the_hidden_satyr 191259 1570076 5224 4.07 52626 105252 20.4 20.4 46.5% 0.0% 0.0% 0.0% 14.55sec 1570076 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M marked_for_death 137619 0 0 0.00 0 0 15.0 0.0 0.0% 0.0% 0.0% 0.0% 18.86sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M pistol_shot 185763 3637713 12104 5.60 78945 157889 28.1 28.1 64.2% 0.0% 0.0% 0.0% 9.92sec 5347782 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M blunderbuss 202895 5636799 18755 13.54 50619 101353 17.0 67.8 64.1% 0.0% 0.0% 0.0% 16.36sec 8286629 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M potion_of_the_old_war 188028 5031062 16740 5.56 122869 245738 27.9 27.9 47.0% 0.0% 0.0% 0.0% 4.12sec 7396138 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M roll_the_bones 193316 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 25.11sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M run_through 2098 50479572 167959 18.25 377293 754524 91.4 91.4 46.4% 0.0% 0.0% 0.0% 3.27sec 74209752 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M saber_slash 193315 27650371 92000 39.33 95885 191770 197.0 197.0 46.4% 0.0% 0.0% 0.0% 1.53sec 40648665 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M shadowmeld 58984 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 139.48sec 0 300.55sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M vanish 1856 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 52.86sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M auto_attack_mh 0 3416052 11366 32.40 18153 36307 162.3 162.3 35.0% 19.0% 0.0% 0.0% 1.86sec 5021920 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M auto_attack_oh 1 1682787 5599 31.88 9077 18153 159.7 159.7 35.0% 18.9% 0.0% 0.0% 1.88sec 2473856 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M backstab 53 5807953 19325 9.32 92179 184362 44.1 46.7 34.9% 0.0% 0.0% 0.0% 6.14sec 8538241 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M eviscerate 196819 37059504 123307 11.08 445488 890848 52.5 55.5 49.9% 0.0% 0.0% 0.0% 5.69sec 54480981 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M goremaws_bite 209782 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 63.70sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M goremaws_bite_mh 209783 1621452 5395 1.03 237618 455827 4.9 5.2 35.3% 0.0% 0.0% 0.0% 63.70sec 1621452 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M goremaws_bite_oh 209784 780041 2595 1.02 112526 226430 4.9 5.1 34.7% 0.0% 0.0% 0.0% 63.70sec 780041 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M horrific_slam 222168 4308430 14335 23.66 26916 53833 118.5 118.5 35.1% 0.0% 0.0% 0.0% 2.19sec 4308430 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M mark_of_the_hidden_satyr 191259 1465315 4875 3.39 64007 128012 17.0 17.0 35.0% 0.0% 0.0% 0.0% 17.64sec 1465315 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M nightblade ticks -195452 25499371 84998 28.82 130972 262068 17.3 144.1 35.1% 0.0% 0.0% 0.0% 17.26sec 25499371 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M weaponmaster 193536 1492214 4965 1.68 177290 0 8.4 8.4 0.0% 0.0% 0.0% 0.0% 30.67sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M potion_of_the_old_war 188028 5070362 16870 4.82 155498 310999 24.1 24.1 35.0% 0.0% 0.0% 0.0% 9.28sec 7453912 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_blades 121471 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.92sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_blade_mh 121473 1355106 4509 7.50 26705 53411 35.5 37.6 35.1% 0.0% 0.0% 0.0% 6.09sec 1355106 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_blade_offhand 121474 676748 2252 7.49 13353 26706 35.6 37.5 35.0% 0.0% 0.0% 0.0% 6.07sec 676748 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_dance 185313 0 0 0.00 0 0 25.9 0.0 0.0% 0.0% 0.0% 0.0% 11.63sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_nova 197800 2364804 7868 6.21 56334 112668 29.4 31.1 35.0% 0.0% 0.0% 0.0% 10.24sec 2364804 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadowmeld 58984 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 122.64sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadowstrike 185438 26157114 87031 20.94 177822 355648 99.1 104.9 40.3% 0.0% 0.0% 0.0% 3.05sec 38453435 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M soul_rip 220893 6563776 21839 20.69 46951 93901 103.6 103.6 34.9% 0.0% 0.0% 0.0% 3.02sec 6563776 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M symbols_of_death 212283 0 0 0.00 0 0 9.0 0.0 0.0% 0.0% 0.0% 0.0% 35.51sec 0 300.55sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.57sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.47sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M deadly_grace 188091 3708615 12340 6.89 80915 161830 35.0 34.5 32.8% 0.0% 0.0% 0.0% 8.76sec 3708615 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M earth_shock 8042 16592204 55207 5.23 425097 1062458 26.2 26.2 32.8% 0.0% 0.0% 0.0% 11.41sec 16592204 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M earthquake 61882 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 23.53sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M earthquake_ 77478 8006710 26640 35.99 29785 74472 180.3 180.3 32.7% 0.0% 0.0% 0.0% 1.51sec 8006710 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M elemental_mastery 16166 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.48sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 236.02sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M flame_shock 188389 1487003 4948 4.08 48871 122168 20.4 20.4 32.5% 0.0% 0.0% 0.0% 15.00sec 10049862 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M flame_shock ticks -188389 8562860 28543 43.13 26651 66634 20.4 215.7 32.7% 0.0% 0.0% 0.0% 15.00sec 10049862 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lava_burst 51505 11663552 38808 8.21 0 283752 41.2 41.1 100.0% 0.0% 0.0% 0.0% 7.31sec 11663552 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lava_burst_overload 77451 3924288 13057 3.36 0 233028 16.9 16.8 100.0% 0.0% 0.0% 0.0% 17.21sec 3924288 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lightning_bolt 188196 20151286 67049 26.45 102101 255298 132.5 132.5 32.6% 0.0% 0.0% 0.0% 2.25sec 20151286 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lightning_bolt_overload 45284 10979907 36533 16.95 86879 217030 84.9 84.9 32.6% 0.0% 0.0% 0.0% 3.91sec 10979907 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lightning_rod 197568 9914255 32987 35.01 56530 0 175.4 175.4 0.0% 0.0% 0.0% 0.0% 1.75sec 9914255 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M mark_of_the_hidden_satyr 191259 2516108 8372 4.17 90596 181192 20.9 20.9 32.8% 0.0% 0.0% 0.0% 14.38sec 2516108 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M pepper_breath ticks -225622 1400659 4669 16.60 16968 0 16.7 83.0 0.0% 0.0% 0.0% 0.0% 17.94sec 1400659 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M plague_swarm ticks -221812 4292750 14309 14.34 45087 90185 16.7 71.7 32.8% 0.0% 0.0% 0.0% 18.00sec 4292750 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M stormkeeper 205495 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 62.00sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M tormenting_cyclone 221857 1768491 5884 16.97 15689 31377 12.4 85.0 32.6% 0.0% 0.0% 0.0% 23.92sec 1768491 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 111.66sec 0 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M volcanic_inferno 205533 975496 3246 6.11 24009 48019 30.6 30.6 32.8% 0.0% 0.0% 0.0% 8.51sec 975496 300.55sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_primal_fire_elemental fire_blast 57984 13288582 125687 29.23 194435 388870 51.5 51.5 32.7% 0.0% 0.0% 0.0% 5.38sec 13288582 105.73sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_primal_fire_elemental immolate 118297 411792 3895 3.06 57610 115221 5.4 5.4 32.6% 0.0% 0.0% 0.0% 60.42sec 2038661 105.73sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_primal_fire_elemental immolate ticks -118297 1626868 5423 12.04 20369 40756 5.4 60.2 32.7% 0.0% 0.0% 0.0% 60.42sec 2038661 105.73sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_greater_lightning_elemental lightning_blast 191726 4535545 107751 60.93 80014 160029 42.7 42.7 32.6% 0.0% 0.0% 0.0% 6.57sec 4535545 42.09sec
Warrior_Arms_T19M Warrior_Arms_T19M arcane_torrent 69179 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.26sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M auto_attack_mh 0 8596383 28602 19.82 64437 129233 99.3 99.3 34.2% 0.0% 0.0% 0.0% 3.05sec 12637497 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M avatar 107574 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 90.02sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M battle_cry 1719 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 27.65sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M bladestorm 227847 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 122.72sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M bladestorm_mh 50622 876012 2915 1.22 120926 242861 0.0 6.1 18.6% 0.0% 0.0% 0.0% 0.00sec 1287820 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M colossus_smash 167105 19060275 63418 10.82 275228 542027 54.2 54.2 28.7% 0.0% 0.0% 0.0% 5.60sec 28020410 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M corrupted_blood_of_zakajz ticks -209569 12651298 42171 12.15 208273 0 0.0 60.7 0.0% 0.0% 0.0% 0.0% 0.00sec 12651298 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M execute 163201 18659135 62084 5.32 428676 913922 26.6 26.6 56.0% 0.0% 0.0% 0.0% 2.11sec 27430697 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M focused_rage 207982 0 0 0.00 0 0 196.0 0.0 0.0% 0.0% 0.0% 0.0% 1.49sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M heroic_leap 6544 0 0 0.00 0 0 10.2 0.0 0.0% 0.0% 0.0% 0.0% 30.96sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M horrific_slam 222168 7124363 23705 23.89 44474 89121 119.6 119.6 33.8% 0.0% 0.0% 0.0% 2.18sec 7124363 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M mortal_strike 12294 52456286 174536 12.83 492573 1061711 64.3 64.3 56.8% 0.0% 0.0% 0.0% 4.61sec 77115709 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M potion_of_the_old_war 188028 8747867 29106 4.68 270300 558214 23.4 23.4 35.8% 0.0% 0.0% 0.0% 12.93sec 12860193 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M shadow_wave 215047 5941552 19769 2.62 332389 674116 13.1 13.1 35.1% 0.0% 0.0% 0.0% 19.64sec 5941552 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M slam 1464 16971974 56470 15.68 158956 313586 78.6 78.6 36.9% 0.0% 0.0% 0.0% 3.07sec 24950409 300.55sec
Warrior_Arms_T19M Warrior_Arms_T19M warbreaker 209577 1759829 5855 0.87 302766 623643 4.4 4.4 31.3% 0.0% 0.0% 0.0% 70.34sec 1759829 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M auto_attack_mh 0 15197139 50565 45.11 46356 99752 225.9 225.9 40.1% 1.1% 0.0% 0.0% 1.33sec 22341234 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M auto_attack_oh 1 7602448 25295 45.11 23176 49877 225.9 225.9 40.1% 1.1% 0.0% 0.0% 1.33sec 11176318 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M avatar 107574 0 0 0.00 0 0 4.1 0.0 0.0% 0.0% 0.0% 0.0% 85.99sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M battle_cry 1719 0 0 0.00 0 0 7.5 0.0 0.0% 0.0% 0.0% 0.0% 43.60sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.64sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M bloodthirst 23881 9946975 33096 10.10 129223 265336 50.6 50.6 49.5% 0.0% 0.0% 0.0% 5.24sec 14622996 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M dragon_roar 118000 2024460 6736 2.73 0 147785 13.7 13.7 100.0% 0.0% 0.0% 0.0% 22.63sec 2024460 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M execute 5308 20753702 69053 8.77 302230 630014 43.9 43.9 51.9% 0.0% 0.0% 0.0% 6.85sec 30509907 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M execute_offhand 163558 10388059 34564 8.77 151110 314989 0.0 43.9 52.0% 0.0% 0.0% 0.0% 0.00sec 15271431 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M felcrazed_rage 225777 436187 1451 0.57 78323 156369 2.9 2.9 94.5% 0.0% 0.0% 0.0% 129.06sec 436187 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M furious_slash 100130 3176822 10570 5.52 84148 178102 27.6 27.6 32.8% 0.0% 0.0% 0.0% 8.67sec 4670229 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M heroic_leap 6544 0 0 0.00 0 0 11.9 0.0 0.0% 0.0% 0.0% 0.0% 26.32sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M mark_of_the_hidden_satyr 191259 2028825 6750 3.88 71490 156025 19.4 19.4 38.9% 0.0% 0.0% 0.0% 15.54sec 2028825 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury 205545 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 44.26sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury_mh 205546 3145991 10468 1.45 0 434413 0.0 7.2 100.0% 0.0% 0.0% 0.0% 0.00sec 6087901 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury_mh ticks -205546 2941910 9806 5.74 52940 112584 0.0 28.7 83.0% 0.0% 0.0% 0.0% 0.00sec 6087901 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury_oh 205547 1572995 5234 1.45 0 217207 0.0 7.2 100.0% 0.0% 0.0% 0.0% 0.00sec 1572995 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M potion_of_the_old_war 188028 7833973 26066 5.51 180369 403573 27.6 27.6 46.4% 0.0% 0.0% 0.0% 11.01sec 11516682 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M raging_blow 85288 0 0 0.00 0 0 61.7 0.0 0.0% 0.0% 0.0% 0.0% 4.72sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M raging_blow_oh 85384 9396037 31263 12.31 108095 230895 0.0 61.7 36.0% 0.0% 0.0% 0.0% 0.00sec 13813065 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M raging_blow_mh 96103 18800669 62555 12.31 216175 461793 0.0 61.7 36.1% 0.0% 0.0% 0.0% 0.00sec 27638764 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage 184367 0 0 0.00 0 0 49.4 0.0 0.0% 0.0% 0.0% 0.0% 6.11sec 0 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage1 218617 1853760 6168 9.86 25950 55383 0.0 49.4 39.4% 0.0% 0.0% 0.0% 0.00sec 2725203 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage2 184707 2943583 9794 9.85 41310 87896 0.0 49.3 39.4% 0.0% 0.0% 0.0% 0.00sec 4327345 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage3 184709 3896671 12965 9.84 54662 116369 0.0 49.3 39.5% 0.0% 0.0% 0.0% 0.00sec 5728476 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage4 201364 5907130 19655 9.82 82601 176972 0.0 49.2 39.7% 0.0% 0.0% 0.0% 0.00sec 8684041 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage5 201363 6880021 22892 9.82 96272 206163 0.0 49.2 39.7% 0.0% 0.0% 0.0% 0.00sec 10114283 300.55sec
Warrior_Fury_T19M Warrior_Fury_T19M rend_flesh ticks -221770 3385639 11285 26.52 17412 37973 45.4 132.6 39.5% 0.0% 0.0% 0.0% 6.66sec 3385639 300.55sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.50% 9.50% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.32% 9.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.72% 10.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.36% 11.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.40% 11.40% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.40% 11.40% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.43% 11.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.68% 11.68% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.68%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.00% 8.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.18% 5.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Agonizing Poison 1.0 199.0 169.5sec 1.5sec 99.40% 100.00% 195.0(195.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_agonizing_poison
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • agonizing_poison_1:0.61%
  • agonizing_poison_2:0.58%
  • agonizing_poison_3:0.52%
  • agonizing_poison_4:0.44%
  • agonizing_poison_5:97.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:200803
  • name:Agonizing Poison
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=20}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${$200803s1}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Blood of the Assassinated 4.0 0.1 61.4sec 59.9sec 13.42% 12.78% 0.1(0.1) 3.9

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:13.42%

Trigger Attempt Success

  • trigger_pct:34.84%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood of the Assassinated 6.4 0.8 44.6sec 38.9sec 22.63% 18.99% 0.8(0.8) 6.2

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:22.63%

Trigger Attempt Success

  • trigger_pct:35.02%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Brutal Haymaker 4.7 0.0 54.6sec 54.6sec 19.45% 19.45% 0.0(0.0) 2.4

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_brutal_haymaker
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:605058.69

Stack Uptimes

  • brutal_haymaker_1:19.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214169
  • name:Brutal Haymaker
  • tooltip:Damage taken from the caster increased by $s2%.
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal $214169s1 Physical damage and increase all damage the target takes from you by $214169s2% for {$214169d=15 seconds}, up to $214169s3 extra damage dealt.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Chilled 2.5 273.6 136.7sec 1.1sec 98.43% 98.43% 273.6(273.6) 1.5

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_chilled
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chilled_1:98.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205708
  • name:Chilled
  • tooltip:Movement speed reduced by $s1%.
  • description:Chilled, reducing movement speed by $s1% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 8.7 49.9 35.4sec 5.2sec 89.98% 90.11% 49.9(49.9) 7.7

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:89.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Frost Bomb 16.6 0.0 17.7sec 17.7sec 64.67% 64.67% 32.1(32.1) 15.9

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_frost_bomb
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frost_bomb_1:64.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112948
  • name:Frost Bomb
  • tooltip:The Mage's Ice Lances that hit the target while frozen will cause the Frost Bomb to release a wave of freezing ice that deals $113092s1 Frost damage to the target, $113092s2 Frost damage to all other enemies within $113092A2 yards.
  • description:Places a Frost Bomb on the target for {$d=12 seconds}. Limit 1 target. Your Ice Lances that benefit from Shatter will trigger the release of a wave of freezing ice, dealing $113092s1 Frost damage to the target and $113092s2 Frost damage to all other enemies within $113092A2 yards.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 29.1 0.1 10.3sec 10.3sec 52.40% 100.00% 0.1(0.1) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:52.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 26.4 42.5 11.5sec 4.3sec 86.59% 100.00% 42.5(42.5) 25.5

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:86.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Kingsbane 6.8 61.2 46.5sec 4.2sec 44.10% 84.45% 0.0(0.0) 6.4

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:3.18%
  • kingsbane_2:3.54%
  • kingsbane_3:3.42%
  • kingsbane_4:3.43%
  • kingsbane_5:3.49%
  • kingsbane_6:3.58%
  • kingsbane_7:3.68%
  • kingsbane_8:3.62%
  • kingsbane_9:3.43%
  • kingsbane_10:3.10%
  • kingsbane_11:2.66%
  • kingsbane_12:2.15%
  • kingsbane_13:1.66%
  • kingsbane_14:1.20%
  • kingsbane_15:0.81%
  • kingsbane_16:0.50%
  • kingsbane_17:0.31%
  • kingsbane_18:0.17%
  • kingsbane_19:0.09%
  • kingsbane_20:0.04%
  • kingsbane_21:0.02%
  • kingsbane_22:0.01%
  • kingsbane_23:0.00%
  • kingsbane_24:0.00%
  • kingsbane_25:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%. |cFFFFFFFFAwards $s6 combo $lpoint:points;.|r}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Kingsbane 6.8 133.8 46.5sec 2.0sec 43.79% 86.98% 0.0(0.0) 6.4

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:1.25%
  • kingsbane_2:1.71%
  • kingsbane_3:1.63%
  • kingsbane_4:1.63%
  • kingsbane_5:1.64%
  • kingsbane_6:1.61%
  • kingsbane_7:1.59%
  • kingsbane_8:1.60%
  • kingsbane_9:1.57%
  • kingsbane_10:1.54%
  • kingsbane_11:1.53%
  • kingsbane_12:1.52%
  • kingsbane_13:1.53%
  • kingsbane_14:1.56%
  • kingsbane_15:1.66%
  • kingsbane_16:1.78%
  • kingsbane_17:1.99%
  • kingsbane_18:2.15%
  • kingsbane_19:2.31%
  • kingsbane_20:2.37%
  • kingsbane_21:2.26%
  • kingsbane_22:2.02%
  • kingsbane_23:1.63%
  • kingsbane_24:1.28%
  • kingsbane_25:0.93%
  • kingsbane_26:0.62%
  • kingsbane_27:0.40%
  • kingsbane_28:0.23%
  • kingsbane_29:0.14%
  • kingsbane_30:0.06%
  • kingsbane_31:0.03%
  • kingsbane_32:0.01%
  • kingsbane_33:0.01%
  • kingsbane_34:0.00%
  • kingsbane_35:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%. |cFFFFFFFFAwards $s6 combo $lpoint:points;.|r}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lacerate 8.8 16.4 34.7sec 11.9sec 91.08% 91.08% 16.4(16.4) 8.0

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_lacerate
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lacerate_1:91.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185855
  • name:Lacerate
  • tooltip:Bleeding for $s1 damage every $t1 sec.
  • description:Tears a bleeding wound in the target, dealing ${$o1+$s2} Physical damage over {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:10.00
  • default_chance:0.00%
Lightning Rod 10.5 29.2 29.1sec 7.4sec 76.49% 80.85% 29.2(29.2) 9.8

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_lightning_rod
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.40

Stack Uptimes

  • lightning_rod_1:76.49%

Trigger Attempt Success

  • trigger_pct:29.98%

Spelldata details

  • id:197209
  • name:Lightning Rod
  • tooltip:Casting Shaman's Lightning Bolt and Chain Lightning also deal $210689s2% of their damage to the Lightning Rod.
  • description:{$@spelldesc210689=Your Lightning Bolt and Chain Lightning have a $s1% chance to make the primary target a Lightning Rod for {$197209d=10 seconds}. Lightning Rods take $s2% of all damage you deal with Lightning Bolt and Chain Lightning.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Maddening Whispers 2.4 20.9 158.7sec 10.0sec 4.63% 4.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.50%
  • maddening_whispers_2:0.45%
  • maddening_whispers_3:0.47%
  • maddening_whispers_4:0.45%
  • maddening_whispers_5:0.47%
  • maddening_whispers_6:0.46%
  • maddening_whispers_7:0.47%
  • maddening_whispers_8:0.59%
  • maddening_whispers_9:0.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222050
  • name:Maddening Whispers
  • tooltip:Deals $222046s1 Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals $s1 Shadow damage.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Maddening Whispers 3.0 26.2 121.0sec 8.8sec 12.18% 12.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:5.35%
  • maddening_whispers_2:0.92%
  • maddening_whispers_3:0.79%
  • maddening_whispers_4:0.92%
  • maddening_whispers_5:0.95%
  • maddening_whispers_6:0.90%
  • maddening_whispers_7:0.83%
  • maddening_whispers_8:0.75%
  • maddening_whispers_9:0.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222050
  • name:Maddening Whispers
  • tooltip:Deals $222046s1 Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals $s1 Shadow damage.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Marked for Death 1.7 13.3 148.2sec 19.0sec 99.69% 99.69% 13.3(13.3) 0.7

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:99.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Surge of Toxins 33.1 11.9 9.1sec 6.7sec 70.18% 71.29% 11.9(11.9) 32.4

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_surge_of_toxins
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • surge_of_toxins_1:70.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192425
  • name:Surge of Toxins
  • tooltip:Damage taken from Poison effects increased by $w1%.
  • description:{$@spelldesc192424=Finishing moves increase Poison damage you deal to the target by $192425s1% for {$192425d=5 seconds}.{$?s200802=false}[ Agonizing Poison's effect is increased by ${$m1/10}.1% increased damage per application on the target.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Surge of Toxins 35.5 12.2 8.5sec 6.3sec 74.25% 100.00% 12.2(12.2) 34.7

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_surge_of_toxins
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • surge_of_toxins_1:74.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192425
  • name:Surge of Toxins
  • tooltip:Damage taken from Poison effects increased by $w1%.
  • description:{$@spelldesc192424=Finishing moves increase Poison damage you deal to the target by $192425s1% for {$192425d=5 seconds}.{$?s200802=false}[ Agonizing Poison's effect is increased by ${$m1/10}.1% increased damage per application on the target.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Touch of the Magi 8.3 0.0 34.2sec 34.3sec 16.36% 16.36% 0.0(0.0) 8.1

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • touch_of_the_magi_1:16.36%

Trigger Attempt Success

  • trigger_pct:10.14%

Spelldata details

  • id:210824
  • name:Touch of the Magi
  • tooltip:Accumulating Damage...
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=6 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Vendetta 5.3 0.0 62.0sec 62.0sec 33.96% 32.78% 0.0(0.0) 4.9

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:33.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Vendetta 3.6 0.0 93.6sec 93.6sec 23.74% 22.56% 0.0(0.0) 3.5

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:23.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Vulnerable (vulnerability) 8.7 67.6 34.6sec 4.0sec 96.02% 99.06% 67.6(67.6) 7.7

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:96.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Water Jet 9.1 0.0 31.8sec 31.8sec 8.11% 23.99% 0.0(0.0) 0.2

Buff details

  • buff initial source:Mage_Frost_T19M_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • water_jet_1:8.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $w1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, {$?s198146=false}[slowing the target by $m2% and ][]dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
winters_chill 11.3 22.5 23.9sec 7.5sec 5.21% 14.29% 22.5(22.5) 11.2

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_winters_chill
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • winters_chill_1:5.21%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 6699920.67
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 12151
death count pct 161.99
avg death time 300.04
min death time 225.48
max death time 376.67
dmg taken 2013954154.56

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7499
Mean 300.55
Minimum 225.48
Maximum 376.67
Spread ( max - min ) 151.19
Range [ ( max - min ) / 2 * 100% ] 25.15%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 6712697.88
Minimum 6329228.52
Maximum 7181845.56
Spread ( max - min ) 852617.04
Range [ ( max - min ) / 2 * 100% ] 6.35%
Standard Deviation 114639.7688
5th Percentile 6518772.35
95th Percentile 6896334.41
( 95th Percentile - 5th Percentile ) 377562.06
Mean Distribution
Standard Deviation 1323.8343
95.00% Confidence Intervall ( 6710103.21 - 6715292.55 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1120
0.1 Scale Factor Error with Delta=300 112190032
0.05 Scale Factor Error with Delta=300 448760128
0.01 Scale Factor Error with Delta=300 -
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 3743
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 2415300371 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.