close

SimulationCraft 710-01

for World of Warcraft 7.1.0 Live (wow build level 22900, git build 354ae31)

Current simulator hotfixes

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mark of the Hidden Satyr

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 In-game testing shows that the damage from this ability is roughly 10% higher than what spelldata shows.
Mark of the Hidden Satyr (effect#1) average 29.13 26.49

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Hunter_BM_T19M : 379409 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
379409.2 379409.2 265.2 / 0.070% 45605.7 / 12.0% 6989.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.9 14.9 Focus 30.74% 40.4 100.0% 100%
Talents
  • 15: Big Game Hunter (Beast Mastery Hunter)
  • 30: Stomp (Beast Mastery Hunter)
  • 60: Bestial Fury (Beast Mastery Hunter)
  • 90: A Murder of Crows
  • 100: Killer Cobra (Beast Mastery Hunter)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hunter_BM_T19M 379409
A Murder of Crows 0 (27287) 0.0% (7.2%) 5.5 60.33sec 1489653 1211502

Stats details: a_murder_of_crows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.49 0.00 85.55 0.00 1.2296 0.9358 0.00 0.00 0.00 94242.36 1211502.02
 
 

Action details: a_murder_of_crows

Static Values
  • id:131894
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131894
  • name:A Murder of Crows
  • school:physical
  • tooltip:Under attack by a flock of crows.
  • description:Summons a flock of crows to attack your target, dealing ${{$131900s1=1}*16} Physical damage over {$d=15 seconds}. When a target dies while affected by this ability, its cooldown will reset.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    A Murder of Crows (crow_peck) 27287 7.2% 0.0 0.00sec 0 0 Direct 85.6 74278 151398 95631 27.7%  

Stats details: crow_peck

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 85.55 0.00 0.00 0.0000 0.0000 8181273.16 12027246.50 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.86 72.31% 74278.42 58455 104905 74339.67 65068 85573 4595188 6755362 31.98
crit 23.69 27.69% 151398.35 116909 209811 151539.70 128860 179907 3586085 5271884 31.98
 
 

Action details: crow_peck

Static Values
  • id:131900
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131900
  • name:A Murder of Crows
  • school:physical
  • tooltip:
  • description:Deals {$s1=1} physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.620000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
auto_shot 16874 4.5% 122.8 2.46sec 41278 16959 Direct 122.8 29929 62392 41278 35.0%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.81 122.81 0.00 0.00 2.4341 0.0000 5069434.87 7452549.45 31.98 16958.55 16958.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.88 65.04% 29928.85 25164 36740 29937.29 28058 32065 2390584 3514385 31.98
crit 42.94 34.96% 62391.94 50328 73479 62427.98 56502 69745 2678851 3938164 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Cobra Shot 38349 10.1% 70.2 4.25sec 163941 134477 Direct 70.0 117246 241841 164459 37.9%  

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.24 70.02 0.00 0.00 1.2191 0.0000 11514754.57 16927779.92 31.98 134477.31 134477.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.48 62.11% 117245.58 89840 131167 117277.16 109416 126001 5098359 7495070 31.98
crit 26.53 37.89% 241841.37 179680 262333 241978.43 217828 262333 6416396 9432710 31.98
 
 

Action details: cobra_shot

Static Values
  • id:193455
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90
Spelldata
  • id:193455
  • name:Cobra Shot
  • school:physical
  • tooltip:
  • description:A quick shot causing ${$sw2*$<mult>} Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.40
 
Deadly Grace 12354 3.2% 28.5 3.23sec 128184 0 Direct 28.5 99498 202995 128189 27.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.50 28.50 0.00 0.00 0.0000 0.0000 3653599.25 3653599.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.60 72.28% 99498.30 79173 115593 99403.14 79173 111951 2049890 2049890 0.00
crit 7.90 27.72% 202994.55 158346 231185 203027.71 158346 231185 1603709 1603709 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Dire Beast 0 (48980) 0.0% (12.9%) 34.2 8.87sec 429626 419205

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.24 0.00 0.00 0.00 1.0249 0.0000 0.00 0.00 0.00 419205.40 419205.40
 
 

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.bestial_wrath.remains>2
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:
  • description:Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r
 
    dire_beast_melee (dire_beast) 32349 6.5% 183.4 1.64sec 40552 25059 Direct 183.4 32044 64093 40552 26.5%  

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.41 183.41 0.00 0.00 1.6182 0.0000 7437562.11 10933920.81 31.98 25059.26 25059.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.72 73.45% 32044.22 31174 38319 32044.85 31174 33764 4317100 6346546 31.98
crit 48.69 26.55% 64093.45 62347 76638 64092.71 62347 68063 3120462 4587374 31.98
 
 

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stomp (dire_beast) 31627 6.4% 34.2 8.87sec 212431 0 Direct 34.2 168162 336547 212430 26.3%  

Stats details: stomp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.24 34.24 0.00 0.00 0.0000 0.0000 7274451.43 10694132.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.24 73.71% 168161.88 163671 201186 168162.84 163671 178675 4244611 6239980 31.98
crit 9.00 26.29% 336546.95 327341 402372 336508.25 0 402372 3029840 4454152 31.97
 
 

Action details: stomp

Static Values
  • id:201754
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201754
  • name:Stomp
  • school:physical
  • tooltip:
  • description:{$@spelldesc199530=When your Dire Beasts charge in, they will stomp the ground, dealing ${($76657m1/100+1)*({$201754s1=1})*1.35} Physical damage to all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Kill Command 0 (140164) 0.0% (37.0%) 73.3 4.10sec 573729 561105

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.33 0.00 0.00 0.00 1.0225 0.0000 0.00 0.00 0.00 561105.13 561105.13
 
 

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:7.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.
 
    Kill Command (cat) 89546 23.6% 73.3 4.10sec 366538 0 Direct 73.3 260492 530424 366533 39.3%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.33 73.33 0.00 0.00 0.0000 0.0000 26877977.67 39513173.13 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.52 60.71% 260492.30 194844 349677 260495.09 239449 284770 11597525 17049461 31.98
crit 28.81 39.29% 530424.01 389689 699354 530681.05 468837 605524 15280452 22463712 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (cat) 17935 4.7% 29.3 10.11sec 183467 0 Direct 29.3 183464 0 183464 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.34 29.34 0.00 0.00 0.0000 0.0000 5382530.38 5382530.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.34 100.00% 183464.32 97422 349677 183530.19 132089 237695 5382530 5382530 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:284472.87
  • base_dd_max:284472.87
 
    Kill Command (hati) 27245 7.2% 73.3 4.10sec 111526 0 Direct 73.3 87201 176217 111525 27.3%  

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.33 73.33 0.00 0.00 0.0000 0.0000 8178126.80 12022621.06 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.29 72.67% 87200.70 64948 116559 87209.19 81722 94173 4647041 6831590 31.98
crit 20.04 27.33% 176217.25 129896 233118 176252.77 147822 212472 3531086 5191031 31.98
 
 

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
 
    Jaws of Thunder (hati) 5438 1.4% 29.3 10.11sec 55725 0 Direct 29.3 55724 0 55724 0.0%  

Stats details: jaws_of_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.30 29.30 0.00 0.00 0.0000 0.0000 1632466.45 1632466.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.30 100.00% 55724.23 32474 116559 55739.69 41171 74983 1632466 1632466 0.00
 
 

Action details: jaws_of_thunder

Static Values
  • id:197162
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197162
  • name:Jaws of Thunder
  • school:physical
  • tooltip:
  • description:Kill Command has a {$s1=10}% chance to deal an additional {$197163s2=50}% of its damage as Nature damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:47412.15
  • base_dd_max:47412.15
 
Pepper Breath 3908 1.0% 14.0 21.17sec 83950 0 Periodic 69.2 16974 0 16974 0.0% 5.8%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.98 0.00 69.65 69.15 0.0000 0.2498 1173816.89 1173816.89 0.00 67480.13 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.2 100.00% 16973.79 136 16990 16974.98 16541 16990 1173817 1173817 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Titan's Thunder 0 (20621) 0.0% (5.4%) 5.4 61.04sec 1146803 0

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
 
    Titan's Thunder (cat) 5615 1.5% 5.4 61.04sec 312089 0 Periodic 42.5 30795 62525 39624 27.8% 14.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 42.48 42.48 0.0000 1.0000 1683048.29 1683048.29 0.00 39624.44 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.7 72.18% 30795.01 23873 42843 30826.16 25703 36877 944095 944095 0.00
crit 11.8 27.82% 62525.25 47745 85686 62624.76 47745 82491 738954 738954 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 9282 1.9% 5.1 63.92sec 415218 0 Periodic 40.5 41246 82396 52699 27.8% 13.5%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.14 0.00 40.49 40.49 0.0000 1.0000 2134008.25 2134008.25 0.00 52699.37 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.2 72.17% 41245.60 40104 49296 41244.68 40104 46371 1205373 1205373 0.00
crit 11.3 27.83% 82396.21 80207 98592 82389.20 80207 97671 928636 928636 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 3956 0.2% 0.5 110.30sec 408230 0 Periodic 3.8 41326 82602 52189 26.3% 1.3%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.48 0.00 3.78 3.78 0.0000 1.0000 197145.83 197145.83 0.00 52196.41 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.8 73.68% 41326.15 40104 49296 16370.13 0 49296 115018 115018 0.00
crit 1.0 26.32% 82601.51 80207 98592 30305.09 0 98592 82128 82128 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 1845 0.0% 0.1 0.00sec 408210 0 Periodic 0.4 41214 82361 52191 26.6% 0.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.05 0.00 0.42 0.42 0.0000 1.0000 21790.23 21790.23 0.00 52254.74 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.3 73.43% 41214.16 40104 49296 2146.83 0 48070 12646 12646 0.00
crit 0.1 26.57% 82360.80 80207 98592 3867.78 0 98592 9144 9144 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (dire_beast) 353 0.0% 0.0 0.00sec 412371 0 Periodic 0.1 41891 80512 51546 25.0% 0.0%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.01 0.00 0.06 0.06 0.0000 1.0000 3002.70 3002.70 0.00 51770.77 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.0 75.00% 41891.10 40104 47459 303.17 0 44700 1830 1830 0.00
crit 0.0 25.00% 80512.41 80207 82039 588.48 0 82039 1173 1173 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Titan's Thunder (hati) 7158 1.9% 5.4 61.04sec 397850 0 Periodic 42.5 39349 79892 50512 27.5% 14.1%

Stats details: titans_thunder

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 0.00 42.48 42.48 0.0000 1.0000 2145545.19 2145545.19 0.00 50513.13 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.8 72.47% 39348.95 30502 54741 39386.02 32424 47841 1211178 1211178 0.00
crit 11.7 27.53% 79891.71 61005 109482 80032.33 61005 102677 934367 934367 0.00
 
 

Action details: titans_thunder

Static Values
  • id:207068
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207068
  • name:Titan's Thunder
  • school:physical
  • tooltip:
  • description:Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.500000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: titans_thunder_tick

Static Values
  • id:207097
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207097
  • name:Titan's Thunder
  • school:nature
  • tooltip:
  • description:{$@spelldesc207068=Discharge a massive jolt of electricity from |cFFFFCC99Titanstrike|r into all your pets{$?s217200=false}[][ and Dire Beasts], causing them to deal up to ${$RAP*1.15*0.5*$<bmMastery>} Nature damage to their target every $207094t sec. for {$207094d=8 seconds}.{$?s217200=false}[ Also causes your next Dire Frenzy to deal {$218635s1=1} additional Nature damage on each of the 5 Dire Frenzy attacks.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 5628 1.5% 10.4 27.74sec 162364 0 Direct 71.6 18552 37544 23595 26.6%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.41 71.62 0.00 0.00 0.0000 0.0000 1689876.28 1689876.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.60 73.44% 18551.50 15351 22412 18548.54 15351 22130 975815 975815 0.00
crit 19.02 26.56% 37543.61 30702 44825 37510.13 30702 44825 714061 714061 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
pet - cat 155672 / 155672
Claw 21278 5.6% 100.7 3.00sec 63487 63203 Direct 100.7 45572 93522 63487 37.4%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.72 100.72 0.00 0.00 1.0045 0.0000 6394214.23 9400100.60 31.98 63202.67 63202.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.09 62.64% 45571.73 19845 71231 45581.81 41523 50893 2875050 4226596 31.98
crit 37.63 37.36% 93522.05 39691 142461 93561.33 79560 110066 3519164 5173504 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
melee 21298 5.6% 201.2 1.49sec 31801 21333 Direct 201.2 22850 46602 31801 37.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.16 201.16 0.00 0.00 1.4907 0.0000 6397193.00 9404479.66 31.98 21333.36 21333.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.36 62.32% 22849.82 18557 33303 22854.05 21638 24473 2864440 4210999 31.98
crit 75.81 37.68% 46602.29 37113 66605 46619.05 43004 51528 3532753 5193481 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - hati 62553 / 62553
hati_melee 22712 6.0% 182.9 1.64sec 37304 22754 Direct 183.9 29222 59131 37101 26.3%  

Stats details: hati_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 182.87 183.87 0.00 0.00 1.6394 0.0000 6821785.92 10028671.48 31.98 22754.46 22754.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 135.43 73.66% 29222.42 23435 42551 29228.27 27790 31146 3957724 5818229 31.98
crit 48.44 26.34% 59131.38 46870 85102 59147.27 52900 67101 2864062 4210443 31.98
 
 

Action details: hati_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Hunter_BM_T19M
Aspect of the Wild 2.8 127.40sec

Stats details: aspect_of_the_wild

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 37.48 0.00 0.0000 0.7446 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_wild

Static Values
  • id:193530
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bestial_wrath.up
Spelldata
  • id:193530
  • name:Aspect of the Wild
  • school:physical
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_BM_T19M
  • harmful:false
  • if_expr:
 
Bestial Wrath 8.9 35.37sec

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.93 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=true}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_BM_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Wild 2.8 0.0 127.4sec 127.4sec 12.06% 7.14% 36.1(36.1) 2.7

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:13.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:12.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bestial Wrath 8.9 0.0 35.4sec 35.4sec 43.59% 62.07% 0.0(0.0) 8.5

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • bestial_wrath_1:43.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=true}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=true}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Big Game Hunter 1.0 0.0 0.0sec 0.0sec 13.66% 18.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_big_game_hunter
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • big_game_hunter_1:13.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204308
  • name:Big Game Hunter
  • tooltip:
  • description:Increases the critical strike chance of your auto shot and Cobra Shot by {$s1=50}% on targets who are above {$s2=80}% health.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 11.63% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dire Beast 34.2 0.0 12.2sec 8.9sec 81.25% 77.79% 0.0(0.0) 24.2

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_dire_beast
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.50

Stack Uptimes

  • dire_beast_1:73.07%
  • dire_beast_2:7.62%
  • dire_beast_3:0.54%
  • dire_beast_4:0.03%
  • dire_beast_5:0.00%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:120694
  • name:Dire Beast
  • tooltip:Your Dire Beast is granting you {$s1=3} Focus every $t1 sec.
  • description:{$@spelldesc120679=Summons a powerful wild beast to attack your target for {$d=8 seconds}. |cFFFFFFFFGenerates ${$120694m1*4} Focus over its duration.|r}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Focused Lightning 3.5 0.0 69.8sec 68.9sec 22.29% 22.29% 3.4(3.4) 0.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_focused_lightning
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:643.16

Stack Uptimes

  • focused_lightning_1:2.23%
  • focused_lightning_2:2.23%
  • focused_lightning_3:2.23%
  • focused_lightning_4:2.23%
  • focused_lightning_5:2.23%
  • focused_lightning_6:2.23%
  • focused_lightning_7:2.23%
  • focused_lightning_8:2.23%
  • focused_lightning_9:2.23%
  • focused_lightning_10:2.23%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:215632
  • name:Focused Lightning
  • tooltip:Mastery increased by {$s1=608}.
  • description:{$@spelldesc215630=Your ranged attacks and spells have a chance to trigger Focused Lightning, granting you {$215632s1=608} Mastery every $215631t1 sec. After {$215631d=10 seconds}, this bonus decreases every $215632t2 sec.}
  • max_stacks:10
  • duration:11.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.4 2.9 25.9sec 20.3sec 25.75% 25.75% 2.9(2.9) 11.1

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 58.3sec 0.0sec 19.62% 19.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
cat: Aspect of the Wild 2.8 0.0 127.4sec 127.4sec 12.06% 14.69% 36.1(36.1) 2.7

Buff details

  • buff initial source:Hunter_BM_T19M_cat
  • cooldown name:buff_aspect_of_the_wild
  • max_stacks:1
  • duration:13.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • aspect_of_the_wild_1:12.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193530
  • name:Aspect of the Wild
  • tooltip:Critical Strike chance for you and your pet increased by {$s1=10}%.
  • description:Grants you and your pet {$s2=10} Focus per $t2 sec and {$s1=10}% increased critical strike chance on all attacks for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
cat: Bestial Wrath 8.9 0.0 35.4sec 35.4sec 43.59% 49.54% 0.0(0.0) 8.5

Buff details

  • buff initial source:Hunter_BM_T19M_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • bestial_wrath_1:43.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=false}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
hati: Bestial Wrath 8.9 0.0 35.4sec 35.4sec 43.59% 51.34% 0.0(0.0) 8.5

Buff details

  • buff initial source:Hunter_BM_T19M_hati
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.46

Stack Uptimes

  • bestial_wrath_1:43.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Damage dealt increased by {$s1=25}%.
  • description:Sends you and your pet into a rage, increasing all damage you both deal by {$s1=25}% for {$d=10 seconds}. {$?s231548=false}&s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Frenzy.]{$?s231548=false}&!s217200[ Bestial Wrath's remaining cooldown is reduced by {$s3=15} sec each time you use Dire Beast.]
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Hunter_BM_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_BM_T19M
a_murder_of_crows Focus 5.5 154.3 28.1 28.1 53034.7
cobra_shot Focus 70.2 2418.0 34.4 34.4 4762.0
kill_command Focus 73.3 1903.7 26.0 26.0 22100.1
pet - cat
claw Focus 100.7 4725.6 46.9 46.9 1353.1
Resource Gains Type Count Total Average Overflow
dire_beast Focus 1159.29 390.54 (8.87%) 0.34 1.80 0.46%
aspect_of_the_wild Focus 106.01 353.42 (8.02%) 3.33 8.27 2.29%
focus_regen Focus 1491.33 3661.28 (83.11%) 2.46 4.16 0.11%
pet - cat
focus_regen Focus 625.69 4382.03 (94.29%) 7.00 197.52 4.31%
aspect_of_the_wild Focus 91.59 265.48 (5.71%) 2.90 96.21 26.60%
Resource RPS-Gain RPS-Loss
Focus 14.65 14.89
Combat End Resource Mean Min Max
Focus 69.61 0.00 140.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 87.6%
Uptimes %
Focus Cap 0.1%
cat-Focus Cap 2.2%

Procs

Count Interval
starved: a_murder_of_crows 3.0 5.3sec
wild_call 8.6 32.0sec

Statistics & Data Analysis

Fight Length
Sample Data Hunter_BM_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Hunter_BM_T19M Damage Per Second
Count 7499
Mean 379409.22
Minimum 343083.87
Maximum 434191.87
Spread ( max - min ) 91108.01
Range [ ( max - min ) / 2 * 100% ] 12.01%
Standard Deviation 11719.3774
5th Percentile 361230.89
95th Percentile 399454.20
( 95th Percentile - 5th Percentile ) 38223.31
Mean Distribution
Standard Deviation 135.3327
95.00% Confidence Intervall ( 379143.97 - 379674.46 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3665
0.1 Scale Factor Error with Delta=300 1172445
0.05 Scale Factor Error with Delta=300 4689782
0.01 Scale Factor Error with Delta=300 117244573
Priority Target DPS
Sample Data Hunter_BM_T19M Priority Target Damage Per Second
Count 7499
Mean 379409.22
Minimum 343083.87
Maximum 434191.87
Spread ( max - min ) 91108.01
Range [ ( max - min ) / 2 * 100% ] 12.01%
Standard Deviation 11719.3774
5th Percentile 361230.89
95th Percentile 399454.20
( 95th Percentile - 5th Percentile ) 38223.31
Mean Distribution
Standard Deviation 135.3327
95.00% Confidence Intervall ( 379143.97 - 379674.46 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3665
0.1 Scale Factor Error with Delta=300 1172445
0.05 Scale Factor Error with Delta=300 4689782
0.01 Scale Factor Error with Delta=300 117244573
DPS(e)
Sample Data Hunter_BM_T19M Damage Per Second (Effective)
Count 7499
Mean 379409.22
Minimum 343083.87
Maximum 434191.87
Spread ( max - min ) 91108.01
Range [ ( max - min ) / 2 * 100% ] 12.01%
Damage
Sample Data Hunter_BM_T19M Damage
Count 7499
Mean 31282755.02
Minimum 23215781.43
Maximum 40256497.28
Spread ( max - min ) 17040715.85
Range [ ( max - min ) / 2 * 100% ] 27.24%
DTPS
Sample Data Hunter_BM_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hunter_BM_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hunter_BM_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hunter_BM_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hunter_BM_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hunter_BM_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hunter_BM_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hunter_BM_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
7 1.00 potion,name=deadly_grace
8 5.49 a_murder_of_crows
0.00 stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
9 34.25 dire_beast,if=cooldown.bestial_wrath.remains>2
0.00 dire_frenzy,if=cooldown.bestial_wrath.remains>2
A 2.84 aspect_of_the_wild,if=buff.bestial_wrath.up
0.00 barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
B 5.39 titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
C 8.93 bestial_wrath
0.00 multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
D 73.34 kill_command
0.00 multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
0.00 chimaera_shot,if=focus<90
E 70.24 cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

Sample Sequence

024568C9ABD9EDEDEDED9E9DEDEDE9CEDEDEDED9EDED9D9EDE9CDEDEDE7D89BEDD9ED9EDEE9CDEDEDED9EDED9DE89BDED9CAEDE9DEDEDEDE9DEED9ED9CEDEDEDED9EDE89BDD9EDED9CEDEDEDED9EDED9DE9DE89CDBEDEDED9AEDEDE9DEED9EDE9CD9EDEDED9EDED9

Sample Sequence Table

time name target resources buffs
Pre flask Hunter_BM_T19M 140.0/140: 100% focus
Pre summon_pet Fluffy_Pillow 140.0/140: 100% focus
Pre potion Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
Pre augmentation Hunter_BM_T19M 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 140.0/140: 100% focus potion_of_deadly_grace
0:00.000 a_murder_of_crows Fluffy_Pillow 140.0/140: 100% focus bloodlust, potion_of_deadly_grace
0:00.990 bestial_wrath Fluffy_Pillow 125.0/140: 89% focus bloodlust, potion_of_deadly_grace
0:00.990 dire_beast Fluffy_Pillow 125.0/140: 89% focus bloodlust, bestial_wrath, potion_of_deadly_grace
0:01.743 aspect_of_the_wild Fluffy_Pillow 137.6/140: 98% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:01.743 titans_thunder Fluffy_Pillow 137.6/140: 98% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:01.743 kill_command Fluffy_Pillow 137.6/140: 98% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:02.499 dire_beast Fluffy_Pillow 133.8/140: 96% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, potion_of_deadly_grace
0:03.254 cobra_shot Fluffy_Pillow 140.0/140: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_deadly_grace
0:04.245 kill_command Fluffy_Pillow 135.9/140: 97% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_deadly_grace
0:04.999 cobra_shot Fluffy_Pillow 133.2/140: 95% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_deadly_grace
0:05.990 kill_command Fluffy_Pillow 129.1/140: 92% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_deadly_grace
0:06.744 cobra_shot Fluffy_Pillow 126.4/140: 90% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_deadly_grace
0:07.736 kill_command Fluffy_Pillow 122.4/140: 87% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_deadly_grace
0:08.490 cobra_shot Fluffy_Pillow 119.6/140: 85% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), potion_of_deadly_grace
0:09.481 kill_command Fluffy_Pillow 115.0/140: 82% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:10.236 dire_beast Fluffy_Pillow 111.3/140: 79% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:11.128 cobra_shot Fluffy_Pillow 135.3/140: 97% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:12.104 dire_beast Fluffy_Pillow 129.6/140: 93% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw, potion_of_deadly_grace
0:12.857 kill_command Fluffy_Pillow 140.0/140: 100% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), mark_of_the_claw, potion_of_deadly_grace
0:13.612 cobra_shot Fluffy_Pillow 137.5/140: 98% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), mark_of_the_claw, potion_of_deadly_grace
0:14.588 kill_command Fluffy_Pillow 133.2/140: 95% focus bloodlust, aspect_of_the_wild, bestial_wrath, dire_beast(2), mark_of_the_claw, potion_of_deadly_grace
0:15.347 cobra_shot Fluffy_Pillow 124.6/140: 89% focus bloodlust, bestial_wrath, dire_beast(2), potion_of_deadly_grace
0:16.340 kill_command Fluffy_Pillow 110.7/140: 79% focus bloodlust, dire_beast(2), potion_of_deadly_grace
0:17.094 Waiting 1.400 sec 94.4/140: 67% focus bloodlust, dire_beast(2), potion_of_deadly_grace
0:18.494 cobra_shot Fluffy_Pillow 119.8/140: 86% focus bloodlust, dire_beast, potion_of_deadly_grace
0:19.486 Waiting 0.300 sec 96.3/140: 69% focus bloodlust, dire_beast, potion_of_deadly_grace
0:19.786 dire_beast Fluffy_Pillow 101.3/140: 72% focus bloodlust, dire_beast, potion_of_deadly_grace
0:20.713 bestial_wrath Fluffy_Pillow 116.8/140: 83% focus bloodlust, dire_beast, potion_of_deadly_grace
0:20.713 Waiting 0.200 sec 116.8/140: 83% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:20.913 cobra_shot Fluffy_Pillow 120.1/140: 86% focus bloodlust, bestial_wrath, dire_beast, potion_of_deadly_grace
0:21.904 kill_command Fluffy_Pillow 104.7/140: 75% focus bloodlust, bestial_wrath, dire_beast, focused_lightning, potion_of_deadly_grace
0:22.657 cobra_shot Fluffy_Pillow 93.3/140: 67% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(2), potion_of_deadly_grace
0:23.650 kill_command Fluffy_Pillow 77.8/140: 56% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(3), potion_of_deadly_grace
0:24.406 cobra_shot Fluffy_Pillow 66.5/140: 47% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(3), potion_of_deadly_grace
0:25.398 kill_command Fluffy_Pillow 51.0/140: 36% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(4), potion_of_deadly_grace
0:26.151 cobra_shot Fluffy_Pillow 39.6/140: 28% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(5), potion_of_deadly_grace
0:27.143 kill_command Fluffy_Pillow 24.2/140: 17% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(6), potion_of_deadly_grace
0:27.898 dire_beast Fluffy_Pillow 12.8/140: 9% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(7), potion_of_deadly_grace
0:28.654 Waiting 0.400 sec 25.4/140: 18% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(8)
0:29.054 cobra_shot Fluffy_Pillow 32.1/140: 23% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(8)
0:30.045 Waiting 0.500 sec 16.6/140: 12% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(9)
0:30.545 kill_command Fluffy_Pillow 25.0/140: 18% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(9)
0:31.301 Waiting 1.100 sec 13.6/140: 10% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(10)
0:32.401 cobra_shot Fluffy_Pillow 32.2/140: 23% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(10), mark_of_the_claw
0:33.377 Waiting 0.500 sec 16.7/140: 12% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(9), mark_of_the_claw
0:33.877 kill_command Fluffy_Pillow 25.1/140: 18% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(8), mark_of_the_claw
0:34.632 Waiting 0.900 sec 13.9/140: 10% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(7), mark_of_the_claw
0:35.532 dire_beast Fluffy_Pillow 29.1/140: 21% focus bloodlust, bestial_wrath, dire_beast, focused_lightning(7), mark_of_the_claw
0:36.486 Waiting 2.100 sec 45.3/140: 32% focus bloodlust, dire_beast, focused_lightning(6), mark_of_the_claw
0:38.586 kill_command Fluffy_Pillow 80.8/140: 58% focus bloodlust, dire_beast, focused_lightning(4), mark_of_the_claw
0:39.496 dire_beast Fluffy_Pillow 66.2/140: 47% focus bloodlust, dire_beast, focused_lightning(3)
0:40.323 Waiting 2.800 sec 78.3/140: 56% focus dire_beast(2), focused_lightning(2)
0:43.123 cobra_shot Fluffy_Pillow 119.4/140: 85% focus dire_beast(2)
0:44.411 Waiting 0.200 sec 96.4/140: 69% focus dire_beast, focused_lightning(2)
0:44.611 kill_command Fluffy_Pillow 99.1/140: 71% focus dire_beast, focused_lightning(2)
0:45.865 Waiting 2.700 sec 85.6/140: 61% focus dire_beast, focused_lightning(3)
0:48.565 cobra_shot Fluffy_Pillow 119.6/140: 85% focus focused_lightning(6)
0:49.853 dire_beast Fluffy_Pillow 94.6/140: 68% focus focused_lightning(7)
0:50.955 bestial_wrath Fluffy_Pillow 109.2/140: 78% focus dire_beast, focused_lightning(8)
0:50.955 kill_command Fluffy_Pillow 109.2/140: 78% focus bestial_wrath, dire_beast, focused_lightning(8)
0:52.283 cobra_shot Fluffy_Pillow 102.7/140: 73% focus bestial_wrath, dire_beast, focused_lightning(10)
0:53.571 kill_command Fluffy_Pillow 87.7/140: 63% focus bestial_wrath, dire_beast, focused_lightning(10)
0:54.673 cobra_shot Fluffy_Pillow 78.2/140: 56% focus bestial_wrath, dire_beast, focused_lightning(9)
0:55.961 kill_command Fluffy_Pillow 63.2/140: 45% focus bestial_wrath, dire_beast, focused_lightning(8)
0:57.062 cobra_shot Fluffy_Pillow 53.7/140: 38% focus bestial_wrath, dire_beast, focused_lightning(7)
0:58.350 potion Fluffy_Pillow 36.8/140: 26% focus bestial_wrath, focused_lightning(5)
0:58.350 kill_command Fluffy_Pillow 36.8/140: 26% focus bestial_wrath, focused_lightning(5), potion_of_deadly_grace
0:59.450 Waiting 0.300 sec 25.6/140: 18% focus bestial_wrath, focused_lightning(4), potion_of_deadly_grace
0:59.750 a_murder_of_crows Fluffy_Pillow 29.1/140: 21% focus bestial_wrath, focused_lightning(4), potion_of_deadly_grace
1:01.287 dire_beast Fluffy_Pillow 23.1/140: 16% focus bestial_wrath, focused_lightning(2), potion_of_deadly_grace
1:02.388 titans_thunder Fluffy_Pillow 37.6/140: 27% focus bestial_wrath, dire_beast, focused_lightning, potion_of_deadly_grace
1:02.388 cobra_shot Fluffy_Pillow 37.6/140: 27% focus bestial_wrath, dire_beast, focused_lightning, potion_of_deadly_grace
1:03.676 Waiting 0.200 sec 22.6/140: 16% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:03.876 kill_command Fluffy_Pillow 25.2/140: 18% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:04.978 Waiting 5.100 sec 15.8/140: 11% focus bestial_wrath, dire_beast, potion_of_deadly_grace
1:10.078 kill_command Fluffy_Pillow 82.2/140: 59% focus mark_of_the_claw, potion_of_deadly_grace
1:11.330 dire_beast Fluffy_Pillow 67.0/140: 48% focus mark_of_the_claw, potion_of_deadly_grace
1:12.573 Waiting 2.700 sec 83.4/140: 60% focus dire_beast, mark_of_the_claw, potion_of_deadly_grace
1:15.273 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast, potion_of_deadly_grace
1:16.560 kill_command Fluffy_Pillow 96.2/140: 69% focus dire_beast, potion_of_deadly_grace
1:17.722 Waiting 2.300 sec 81.5/140: 58% focus dire_beast, potion_of_deadly_grace
1:20.022 dire_beast Fluffy_Pillow 111.1/140: 79% focus potion_of_deadly_grace
1:21.122 cobra_shot Fluffy_Pillow 125.6/140: 90% focus dire_beast, potion_of_deadly_grace
1:22.409 Waiting 0.400 sec 102.6/140: 73% focus dire_beast, potion_of_deadly_grace
1:22.809 kill_command Fluffy_Pillow 107.9/140: 77% focus dire_beast, potion_of_deadly_grace
1:24.136 Waiting 1.800 sec 95.4/140: 68% focus dire_beast, potion_of_deadly_grace
1:25.936 cobra_shot Fluffy_Pillow 119.1/140: 85% focus dire_beast, potion_of_deadly_grace
1:27.224 Waiting 1.900 sec 96.1/140: 69% focus dire_beast, potion_of_deadly_grace
1:29.124 cobra_shot Fluffy_Pillow 119.5/140: 85% focus
1:30.411 dire_beast Fluffy_Pillow 94.6/140: 68% focus
1:31.513 bestial_wrath Fluffy_Pillow 109.1/140: 78% focus dire_beast
1:31.513 kill_command Fluffy_Pillow 109.1/140: 78% focus bestial_wrath, dire_beast
1:32.614 cobra_shot Fluffy_Pillow 99.6/140: 71% focus bestial_wrath, dire_beast
1:33.902 kill_command Fluffy_Pillow 84.6/140: 60% focus bestial_wrath, dire_beast
1:35.003 cobra_shot Fluffy_Pillow 75.1/140: 54% focus bestial_wrath, dire_beast
1:36.291 kill_command Fluffy_Pillow 60.1/140: 43% focus bestial_wrath, dire_beast
1:37.392 cobra_shot Fluffy_Pillow 50.7/140: 36% focus bestial_wrath, dire_beast
1:38.678 kill_command Fluffy_Pillow 34.6/140: 25% focus bestial_wrath
1:39.780 Waiting 0.700 sec 23.4/140: 17% focus bestial_wrath
1:40.480 dire_beast Fluffy_Pillow 31.6/140: 23% focus bestial_wrath
1:41.778 cobra_shot Fluffy_Pillow 48.5/140: 35% focus bestial_wrath, dire_beast
1:43.065 kill_command Fluffy_Pillow 33.4/140: 24% focus bestial_wrath, dire_beast
1:44.167 Waiting 0.700 sec 24.0/140: 17% focus bestial_wrath, dire_beast
1:44.867 cobra_shot Fluffy_Pillow 33.2/140: 24% focus bestial_wrath, dire_beast
1:46.155 Waiting 0.900 sec 18.4/140: 13% focus bestial_wrath, dire_beast, mark_of_the_claw
1:47.055 kill_command Fluffy_Pillow 30.4/140: 22% focus dire_beast, mark_of_the_claw
1:48.124 Waiting 2.500 sec 14.7/140: 11% focus dire_beast, mark_of_the_claw
1:50.624 dire_beast Fluffy_Pillow 45.1/140: 32% focus mark_of_the_claw
1:51.924 Waiting 1.300 sec 62.1/140: 44% focus dire_beast, mark_of_the_claw
1:53.224 kill_command Fluffy_Pillow 79.5/140: 57% focus dire_beast, mark_of_the_claw
1:54.452 Waiting 4.100 sec 65.9/140: 47% focus dire_beast
1:58.552 cobra_shot Fluffy_Pillow 119.9/140: 86% focus dire_beast
1:59.842 a_murder_of_crows Fluffy_Pillow 95.0/140: 68% focus
2:01.288 dire_beast Fluffy_Pillow 81.9/140: 59% focus
2:02.389 titans_thunder Fluffy_Pillow 96.4/140: 69% focus dire_beast
2:02.389 kill_command Fluffy_Pillow 96.4/140: 69% focus dire_beast
2:03.492 Waiting 2.900 sec 81.0/140: 58% focus dire_beast
2:06.392 cobra_shot Fluffy_Pillow 119.2/140: 85% focus dire_beast
2:07.678 Waiting 0.900 sec 96.2/140: 69% focus dire_beast
2:08.578 kill_command Fluffy_Pillow 108.1/140: 77% focus dire_beast
2:09.905 Waiting 1.400 sec 94.4/140: 67% focus
2:11.305 dire_beast Fluffy_Pillow 110.7/140: 79% focus
2:12.656 bestial_wrath Fluffy_Pillow 128.2/140: 92% focus dire_beast
2:12.656 aspect_of_the_wild Fluffy_Pillow 128.2/140: 92% focus bestial_wrath, dire_beast
2:12.656 cobra_shot Fluffy_Pillow 128.2/140: 92% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:13.943 kill_command Fluffy_Pillow 126.0/140: 90% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:15.044 cobra_shot Fluffy_Pillow 127.5/140: 91% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:16.331 dire_beast Fluffy_Pillow 125.4/140: 90% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:17.432 kill_command Fluffy_Pillow 140.0/140: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast(2)
2:18.532 cobra_shot Fluffy_Pillow 140.0/140: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast(2)
2:19.821 kill_command Fluffy_Pillow 138.4/140: 99% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:20.922 cobra_shot Fluffy_Pillow 140.0/140: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:22.210 kill_command Fluffy_Pillow 137.8/140: 98% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:23.314 cobra_shot Fluffy_Pillow 139.4/140: 100% focus aspect_of_the_wild, bestial_wrath, dire_beast
2:24.601 kill_command Fluffy_Pillow 136.4/140: 97% focus aspect_of_the_wild, bestial_wrath
2:25.702 cobra_shot Fluffy_Pillow 135.8/140: 97% focus bestial_wrath
2:26.989 dire_beast Fluffy_Pillow 118.9/140: 85% focus bestial_wrath
2:28.091 kill_command Fluffy_Pillow 133.4/140: 95% focus dire_beast
2:29.192 Waiting 0.100 sec 117.9/140: 84% focus dire_beast
2:29.292 cobra_shot Fluffy_Pillow 119.3/140: 85% focus dire_beast
2:30.579 Waiting 1.800 sec 96.2/140: 69% focus dire_beast
2:32.379 cobra_shot Fluffy_Pillow 120.0/140: 86% focus dire_beast
2:33.667 Waiting 0.600 sec 97.0/140: 69% focus dire_beast
2:34.267 kill_command Fluffy_Pillow 104.9/140: 75% focus dire_beast
2:35.608 Waiting 1.400 sec 90.9/140: 65% focus
2:37.008 dire_beast Fluffy_Pillow 107.3/140: 77% focus
2:38.355 cobra_shot Fluffy_Pillow 124.7/140: 89% focus dire_beast
2:39.642 Waiting 1.100 sec 101.7/140: 73% focus dire_beast, mark_of_the_claw
2:40.742 kill_command Fluffy_Pillow 116.4/140: 83% focus dire_beast, mark_of_the_claw
2:41.968 dire_beast Fluffy_Pillow 102.8/140: 73% focus dire_beast, mark_of_the_claw
2:43.038 bestial_wrath Fluffy_Pillow 118.7/140: 85% focus dire_beast(2), mark_of_the_claw
2:43.038 cobra_shot Fluffy_Pillow 118.7/140: 85% focus bestial_wrath, dire_beast(2), mark_of_the_claw
2:44.307 kill_command Fluffy_Pillow 105.5/140: 75% focus bestial_wrath, dire_beast(2), mark_of_the_claw
2:45.377 cobra_shot Fluffy_Pillow 96.1/140: 69% focus bestial_wrath, dire_beast, mark_of_the_claw
2:46.644 kill_command Fluffy_Pillow 80.8/140: 58% focus bestial_wrath, dire_beast
2:47.746 cobra_shot Fluffy_Pillow 71.3/140: 51% focus bestial_wrath, dire_beast
2:49.032 kill_command Fluffy_Pillow 56.3/140: 40% focus bestial_wrath, dire_beast
2:50.133 cobra_shot Fluffy_Pillow 46.0/140: 33% focus bestial_wrath
2:51.423 kill_command Fluffy_Pillow 29.1/140: 21% focus bestial_wrath
2:52.523 dire_beast Fluffy_Pillow 17.9/140: 13% focus bestial_wrath
2:53.624 cobra_shot Fluffy_Pillow 32.5/140: 23% focus bestial_wrath, dire_beast
2:54.911 Waiting 0.500 sec 17.4/140: 12% focus bestial_wrath, dire_beast
2:55.411 kill_command Fluffy_Pillow 24.0/140: 17% focus bestial_wrath, dire_beast
2:56.514 Waiting 1.400 sec 14.6/140: 10% focus bestial_wrath, dire_beast
2:57.914 cobra_shot Fluffy_Pillow 33.0/140: 24% focus bestial_wrath, dire_beast
2:59.200 Waiting 1.000 sec 18.0/140: 13% focus dire_beast
3:00.200 a_murder_of_crows Fluffy_Pillow 31.2/140: 22% focus dire_beast
3:01.488 Waiting 1.100 sec 16.6/140: 12% focus
3:02.588 dire_beast Fluffy_Pillow 29.5/140: 21% focus
3:03.890 titans_thunder Fluffy_Pillow 46.4/140: 33% focus dire_beast
3:03.890 kill_command Fluffy_Pillow 46.4/140: 33% focus dire_beast
3:04.994 Waiting 5.100 sec 30.9/140: 22% focus dire_beast
3:10.094 kill_command Fluffy_Pillow 98.5/140: 70% focus dire_beast, mark_of_the_claw
3:11.343 Waiting 1.400 sec 83.6/140: 60% focus mark_of_the_claw
3:12.743 dire_beast Fluffy_Pillow 100.2/140: 72% focus mark_of_the_claw
3:14.052 Waiting 0.200 sec 117.3/140: 84% focus dire_beast, mark_of_the_claw
3:14.252 cobra_shot Fluffy_Pillow 120.0/140: 86% focus dire_beast
3:15.538 Waiting 0.900 sec 96.9/140: 69% focus dire_beast
3:16.438 kill_command Fluffy_Pillow 108.8/140: 78% focus dire_beast
3:17.734 Waiting 1.800 sec 95.9/140: 69% focus dire_beast
3:19.534 cobra_shot Fluffy_Pillow 119.6/140: 85% focus dire_beast
3:20.821 Waiting 2.000 sec 96.6/140: 69% focus dire_beast
3:22.821 kill_command Fluffy_Pillow 120.2/140: 86% focus
3:24.114 dire_beast Fluffy_Pillow 105.5/140: 75% focus mark_of_the_claw
3:25.185 bestial_wrath Fluffy_Pillow 119.8/140: 86% focus dire_beast, mark_of_the_claw
3:25.185 cobra_shot Fluffy_Pillow 119.8/140: 86% focus bestial_wrath, dire_beast, mark_of_the_claw
3:26.454 kill_command Fluffy_Pillow 104.7/140: 75% focus bestial_wrath, dire_beast, mark_of_the_claw
3:27.523 cobra_shot Fluffy_Pillow 95.0/140: 68% focus bestial_wrath, dire_beast, mark_of_the_claw
3:28.792 kill_command Fluffy_Pillow 80.0/140: 57% focus bestial_wrath, dire_beast, mark_of_the_claw
3:29.877 cobra_shot Fluffy_Pillow 70.3/140: 50% focus bestial_wrath, dire_beast
3:31.165 kill_command Fluffy_Pillow 55.3/140: 39% focus bestial_wrath, dire_beast, focused_lightning(2)
3:32.268 cobra_shot Fluffy_Pillow 44.2/140: 32% focus bestial_wrath, focused_lightning(3)
3:33.555 kill_command Fluffy_Pillow 27.2/140: 19% focus bestial_wrath, focused_lightning(4)
3:34.656 dire_beast Fluffy_Pillow 16.1/140: 11% focus bestial_wrath, focused_lightning(5)
3:35.758 Waiting 0.200 sec 30.6/140: 22% focus bestial_wrath, dire_beast, focused_lightning(6)
3:35.958 cobra_shot Fluffy_Pillow 33.3/140: 24% focus bestial_wrath, dire_beast, focused_lightning(7)
3:37.246 Waiting 0.500 sec 18.3/140: 13% focus bestial_wrath, dire_beast, focused_lightning(8)
3:37.746 kill_command Fluffy_Pillow 24.8/140: 18% focus bestial_wrath, dire_beast, focused_lightning(8)
3:38.847 Waiting 1.300 sec 15.4/140: 11% focus bestial_wrath, dire_beast, focused_lightning(9)
3:40.147 cobra_shot Fluffy_Pillow 32.5/140: 23% focus bestial_wrath, dire_beast, focused_lightning(10)
3:41.434 Waiting 1.000 sec 17.5/140: 12% focus dire_beast, focused_lightning(9)
3:42.434 kill_command Fluffy_Pillow 30.7/140: 22% focus dire_beast, focused_lightning(8)
3:43.535 Waiting 1.200 sec 13.5/140: 10% focus focused_lightning(7)
3:44.735 dire_beast Fluffy_Pillow 27.6/140: 20% focus focused_lightning(6)
3:46.024 Waiting 2.600 sec 44.3/140: 32% focus dire_beast, focused_lightning(4)
3:48.624 kill_command Fluffy_Pillow 78.6/140: 56% focus dire_beast, focused_lightning(2)
3:49.948 Waiting 4.200 sec 66.1/140: 47% focus dire_beast
3:54.148 cobra_shot Fluffy_Pillow 119.5/140: 85% focus
3:55.436 dire_beast Fluffy_Pillow 94.6/140: 68% focus
3:56.539 kill_command Fluffy_Pillow 109.1/140: 78% focus dire_beast
3:57.640 Waiting 2.000 sec 93.6/140: 67% focus dire_beast
3:59.640 cobra_shot Fluffy_Pillow 120.0/140: 86% focus dire_beast
4:00.926 a_murder_of_crows Fluffy_Pillow 97.0/140: 69% focus dire_beast
4:02.213 dire_beast Fluffy_Pillow 83.9/140: 60% focus dire_beast
4:03.314 bestial_wrath Fluffy_Pillow 100.1/140: 72% focus dire_beast(2)
4:03.314 kill_command Fluffy_Pillow 100.1/140: 72% focus bestial_wrath, dire_beast(2)
4:04.415 titans_thunder Fluffy_Pillow 90.6/140: 65% focus bestial_wrath, dire_beast
4:04.415 cobra_shot Fluffy_Pillow 90.6/140: 65% focus bestial_wrath, dire_beast
4:05.702 kill_command Fluffy_Pillow 75.6/140: 54% focus bestial_wrath, dire_beast
4:06.804 cobra_shot Fluffy_Pillow 66.1/140: 47% focus bestial_wrath, dire_beast
4:08.092 kill_command Fluffy_Pillow 51.1/140: 37% focus bestial_wrath, dire_beast
4:09.193 cobra_shot Fluffy_Pillow 41.7/140: 30% focus bestial_wrath, dire_beast
4:10.481 kill_command Fluffy_Pillow 25.8/140: 18% focus bestial_wrath
4:11.582 Waiting 0.700 sec 14.7/140: 10% focus bestial_wrath
4:12.282 dire_beast Fluffy_Pillow 22.9/140: 16% focus bestial_wrath
4:13.570 aspect_of_the_wild Fluffy_Pillow 39.7/140: 28% focus bestial_wrath, dire_beast, mark_of_the_claw
4:13.570 cobra_shot Fluffy_Pillow 39.7/140: 28% focus aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw
4:14.839 kill_command Fluffy_Pillow 37.3/140: 27% focus aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw
4:15.910 cobra_shot Fluffy_Pillow 38.3/140: 27% focus aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw
4:17.179 kill_command Fluffy_Pillow 36.0/140: 26% focus aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw
4:18.249 cobra_shot Fluffy_Pillow 37.0/140: 26% focus aspect_of_the_wild, bestial_wrath, dire_beast, mark_of_the_claw
4:19.517 dire_beast Fluffy_Pillow 34.5/140: 25% focus aspect_of_the_wild, dire_beast
4:20.617 kill_command Fluffy_Pillow 60.0/140: 43% focus aspect_of_the_wild, dire_beast
4:21.720 Waiting 2.800 sec 55.6/140: 40% focus aspect_of_the_wild, dire_beast
4:24.520 cobra_shot Fluffy_Pillow 120.5/140: 86% focus aspect_of_the_wild, dire_beast, focused_lightning
4:25.809 Waiting 0.400 sec 110.4/140: 79% focus aspect_of_the_wild, dire_beast, focused_lightning(2)
4:26.209 cobra_shot Fluffy_Pillow 119.7/140: 85% focus aspect_of_the_wild, dire_beast, focused_lightning(2)
4:27.498 kill_command Fluffy_Pillow 100.3/140: 72% focus dire_beast, focused_lightning(4)
4:28.597 Waiting 1.000 sec 83.1/140: 59% focus focused_lightning(5)
4:29.597 dire_beast Fluffy_Pillow 94.8/140: 68% focus focused_lightning(6)
4:30.883 Waiting 0.600 sec 111.5/140: 80% focus dire_beast, focused_lightning(7)
4:31.483 cobra_shot Fluffy_Pillow 119.4/140: 85% focus dire_beast, focused_lightning(8)
4:32.770 Waiting 0.900 sec 96.4/140: 69% focus dire_beast, focused_lightning(9)
4:33.670 kill_command Fluffy_Pillow 108.3/140: 77% focus dire_beast, focused_lightning(10)
4:35.012 Waiting 1.800 sec 96.0/140: 69% focus dire_beast, focused_lightning(10)
4:36.812 cobra_shot Fluffy_Pillow 119.7/140: 86% focus dire_beast, focused_lightning(8)
4:38.101 Waiting 1.700 sec 96.0/140: 69% focus focused_lightning(7)
4:39.801 dire_beast Fluffy_Pillow 115.8/140: 83% focus focused_lightning(5)
4:41.148 bestial_wrath Fluffy_Pillow 133.2/140: 95% focus dire_beast, focused_lightning(4)
4:41.148 kill_command Fluffy_Pillow 133.2/140: 95% focus bestial_wrath, dire_beast, focused_lightning(4)
4:42.251 dire_beast Fluffy_Pillow 123.8/140: 88% focus bestial_wrath, dire_beast, focused_lightning(3)
4:43.353 cobra_shot Fluffy_Pillow 140.0/140: 100% focus bestial_wrath, dire_beast(2), focused_lightning
4:44.642 kill_command Fluffy_Pillow 126.9/140: 91% focus bestial_wrath, dire_beast(2)
4:45.729 cobra_shot Fluffy_Pillow 119.0/140: 85% focus bestial_wrath, dire_beast(2), mark_of_the_claw
4:46.998 kill_command Fluffy_Pillow 105.9/140: 76% focus bestial_wrath, dire_beast(2), mark_of_the_claw
4:48.067 cobra_shot Fluffy_Pillow 97.8/140: 70% focus bestial_wrath, dire_beast(2), mark_of_the_claw
4:49.335 kill_command Fluffy_Pillow 82.7/140: 59% focus bestial_wrath, dire_beast, mark_of_the_claw
4:50.404 dire_beast Fluffy_Pillow 72.2/140: 52% focus bestial_wrath, mark_of_the_claw
4:51.472 cobra_shot Fluffy_Pillow 86.4/140: 62% focus bestial_wrath, dire_beast, mark_of_the_claw
4:52.742 kill_command Fluffy_Pillow 71.4/140: 51% focus bestial_wrath, dire_beast, mark_of_the_claw
4:53.813 cobra_shot Fluffy_Pillow 61.7/140: 44% focus bestial_wrath, dire_beast, mark_of_the_claw
4:55.081 kill_command Fluffy_Pillow 46.5/140: 33% focus bestial_wrath, dire_beast
4:56.183 Waiting 4.200 sec 37.0/140: 26% focus dire_beast
5:00.383 dire_beast Fluffy_Pillow 89.4/140: 64% focus focused_lightning

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6231 6231 0
Agility 29075 27710 17363 (13690)
Stamina 41882 41882 25957
Intellect 6005 6005 0
Spirit 2 2 0
Health 2512920 2512920 0
Focus 140 140 0
Crit 24.67% 24.67% 3384
Haste 16.90% 16.90% 5491
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 29075 27710 0
Mastery 80.32% 80.32% 9694
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1448 Sta, +1115 Mastery, +939 Haste }, enchant: mark_of_the_claw
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 880, stats: { 341 Armor, +1930 Sta, +1287 AgiInt, +735 Mastery, +360 Haste }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist Roar of the Seven Lions
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 Agi, +626 Haste, +469 Mastery }
Local Legs Singular Chain Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +1012 Mastery, +448 Haste }
Local Feet Black Venom Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +759 Haste, +336 Mastery }
Local Wrists Manacles of the Nightmare Colossus
ilevel: 880, stats: { 199 Armor, +1447 Sta, +965 AgiInt, +481 Haste, +340 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Finger1 Mindrend Band
ilevel: 880, stats: { +1448 Sta, +1292 Mastery, +763 Haste }, enchant: { +200 Mastery }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Trinket2 Stormsinger Fulmination Charge
ilevel: 840, stats: { +1123 AgiInt }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand Titanstrike
ilevel: 906, weapon: { 11779 - 11781, 3 }, stats: { +2186 Agi, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Big Game Hunter (Beast Mastery Hunter) Way of the Cobra (Beast Mastery Hunter) Dire Stable (Beast Mastery Hunter)
30 Stomp (Beast Mastery Hunter) Dire Frenzy (Beast Mastery Hunter) Chimaera Shot (Beast Mastery Hunter)
45 Posthaste Farstrider Trailblazer
60 One with the Pack (Beast Mastery Hunter) Bestial Fury (Beast Mastery Hunter) Blink Strikes (Beast Mastery Hunter)
75 Binding Shot Wyvern Sting Intimidation (Beast Mastery Hunter)
90 A Murder of Crows Barrage Volley
100 Stampede (Beast Mastery Hunter) Killer Cobra (Beast Mastery Hunter) Aspect of the Beast

Profile

hunter="Hunter_BM_T19M"
level=110
race=pandaren
role=attack
position=ranged_back
talents=1102012
artifact=56:0:0:0:0:868:3:869:3:870:3:871:3:872:3:873:3:874:3:875:3:876:1:877:1:878:1:879:1:880:1:881:1:882:1:1095:3:1336:1
spec=beast_mastery

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=deadly_grace
actions+=/a_murder_of_crows
actions+=/stampede,if=buff.bloodlust.up|buff.bestial_wrath.up|cooldown.bestial_wrath.remains<=2|target.time_to_die<=14
actions+=/dire_beast,if=cooldown.bestial_wrath.remains>2
actions+=/dire_frenzy,if=cooldown.bestial_wrath.remains>2
actions+=/aspect_of_the_wild,if=buff.bestial_wrath.up
actions+=/barrage,if=spell_targets.barrage>1|(spell_targets.barrage=1&focus>90)
actions+=/titans_thunder,if=cooldown.dire_beast.remains>=3|buff.bestial_wrath.up&pet.dire_beast.active
actions+=/bestial_wrath
actions+=/multi_shot,if=spell_targets.multi_shot>4&(pet.buff.beast_cleave.remains<gcd.max|pet.buff.beast_cleave.down)
actions+=/kill_command
actions+=/multi_shot,if=spell_targets.multi_shot>1&(pet.buff.beast_cleave.remains<gcd.max*2|pet.buff.beast_cleave.down)
actions+=/chimaera_shot,if=focus<90
actions+=/cobra_shot,if=talent.killer_cobra.enabled&(cooldown.bestial_wrath.remains>=4&(buff.bestial_wrath.up&cooldown.kill_command.remains>=2)|focus>119)|!talent.killer_cobra.enabled&focus>90

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806,enchant=mark_of_the_claw
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=manacles_of_the_nightmare_colossus,id=139222,bonus_id=1806
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1806
waist=roar_of_the_seven_lions,id=137080,bonus_id=1806
legs=singular_chain_leggings,id=139215,bonus_id=1806
feet=black_venom_sabatons,id=139219,bonus_id=1806
finger1=mindrend_band,id=138220,bonus_id=1806,enchant=200mastery
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200mastery
trinket1=twisting_wind,id=139323,bonus_id=1806
trinket2=stormsinger_fulmination_charge,id=137367,bonus_id=1727
main_hand=titanstrike,id=128861,gem_id=139262/139269/139255,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=879.07
# gear_agility=17363
# gear_stamina=25957
# gear_crit_rating=3384
# gear_haste_rating=5491
# gear_mastery_rating=9694
# gear_armor=2758
summon_pet=cat

Hunter_MM_T19M : 359874 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
359873.6 359873.6 367.9 / 0.102% 64320.8 / 17.9% 19220.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
18.7 18.7 Focus 12.89% 37.0 100.0% 100%
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 60: Patient Sniper (Marksmanship Hunter)
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hunter_MM_T19M 359874
Aimed Shot 148368 (173831) 41.2% (48.3%) 91.7 3.26sec 569332 384659 Direct 91.6 325693 775662 486587 35.8%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.67 91.55 0.00 0.00 1.4801 0.0000 44548869.73 65491058.29 31.98 384659.47 384659.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.82 64.24% 325692.64 122561 456909 325721.01 305722 349906 19156106 28161290 31.98
crit 32.74 35.76% 775662.34 261055 1460387 776250.71 690688 890284 25392764 37329769 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 25463 7.1% 0.0 0.00sec 0 0 Direct 82.1 62302 149057 93144 35.6%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 82.06 0.00 0.00 0.0000 0.0000 7643651.02 11236891.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.89 64.45% 62301.65 24032 89590 62309.86 47935 72757 3295100 4844109 31.98
crit 29.17 35.55% 149057.23 51187 292063 148955.72 103576 211228 4348551 6392782 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 16078 4.5% 119.4 2.52sec 40456 16170 Direct 119.4 29694 65695 40456 29.9%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.37 119.37 0.00 0.00 2.5018 0.0000 4829215.13 7099403.67 31.98 16170.47 16170.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.69 70.11% 29693.72 29694 29694 29693.72 29694 29694 2484951 3653114 31.98
crit 35.68 29.89% 65694.74 59387 89081 65743.93 59387 72997 2344264 3446290 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 42706 11.9% 13.7 22.85sec 936937 355374 Periodic 218.2 44086 93380 58795 29.8% 10.9%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.70 0.00 218.24 218.24 2.6365 0.1496 12831507.00 18863530.72 31.98 355374.50 355374.50
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.1 70.16% 44086.25 42914 53327 44082.59 42914 48403 6750314 9923601 31.98
crit 65.1 29.84% 93380.11 85827 159982 93361.19 85827 109854 6081193 8939930 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 14606 4.0% 33.9 8.96sec 127301 0 Direct 33.9 79173 204942 127481 38.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.94 33.89 0.00 0.00 0.0000 0.0000 4320339.38 4320339.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.87 61.59% 79173.00 79173 79173 79173.00 79173 79173 1652593 1652593 0.00
crit 13.02 38.41% 204942.44 158346 237519 205015.85 167143 237519 2667747 2667747 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 54417 (58406) 15.1% (16.2%) 29.0 10.42sec 605354 520667 Direct 29.0 375348 844111 563969 40.2%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.97 28.97 0.00 0.00 1.1627 0.0000 16338906.91 24019740.82 31.98 520666.82 520666.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.31 59.76% 375347.84 147515 458282 375322.72 319617 413535 6497898 9552526 31.98
crit 11.66 40.24% 844111.49 295031 1374846 845530.73 611135 1186895 9841009 14467215 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Call of the Hunter 3989 1.1% 12.1 46.78sec 99186 0 Direct 12.1 70835 163027 99187 30.8%  

Stats details: call_of_the_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.08 12.08 0.00 0.00 0.0000 0.0000 1198192.93 1761457.10 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.37 69.25% 70834.77 70835 70835 70825.32 0 70835 592569 871133 31.97
crit 3.71 30.75% 163027.24 141670 212504 157965.50 0 212504 605624 890324 31.01
 
 

Action details: call_of_the_hunter

Static Values
  • id:191070
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191070
  • name:Call of the Hunter
  • school:physical
  • tooltip:
  • description:{$@spelldesc191048=When you Marked Shot, |cFFFFCC99Thas'dorah|r has a chance to call forth a barrage of wind arrows to strike all Vulnerable targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 4073 1.1% 14.6 20.24sec 83865 0 Periodic 72.1 16973 0 16973 0.0% 6.0%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.59 0.00 72.58 72.09 0.0000 0.2497 1223503.40 1223503.40 0.00 67499.91 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.1 100.00% 16972.55 68 16990 16973.61 16585 16990 1223503 1223503 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Sidewinders 17280 4.8% 33.1 9.14sec 156823 134592 Direct 33.1 114546 255814 156822 29.9%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.08 33.08 0.00 0.00 1.1652 0.0000 5187712.05 5187712.05 0.00 134591.95 134591.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.18 70.07% 114545.90 114546 114546 114545.90 114546 114546 2655207 2655207 0.00
crit 9.90 29.93% 255813.58 229092 343638 256105.41 229092 343638 2532505 2532505 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Tormenting Cyclone 5211 1.4% 10.9 26.71sec 143676 0 Direct 75.0 15351 33693 20873 30.1%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.90 75.01 0.00 0.00 0.0000 0.0000 1565740.59 1565740.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.43 69.89% 15351.00 15351 15351 15351.00 15351 15351 804780 804780 0.00
crit 22.59 30.11% 33692.93 30702 46053 33650.19 30702 43495 760960 760960 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Windburst 27683 7.7% 13.2 21.88sec 628561 510606 Direct 14.2 440680 933322 586042 29.5%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.24 14.20 0.00 0.00 1.2310 0.0000 8319822.03 12230926.46 31.98 510606.48 510606.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.01 70.49% 440680.18 429136 533273 440666.96 429136 499066 4410150 6483339 31.98
crit 4.19 29.51% 933322.43 858272 1599820 931858.51 0 1506114 3909672 5747588 31.82
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Hunter_MM_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_MM_T19M
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_MM_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.3 157.41sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:140.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 17.82% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 1.0 112.3 0.0sec 0.5sec 18.21% 18.21% 83.3(83.3) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.23%
  • bullseye_2:0.25%
  • bullseye_3:0.22%
  • bullseye_4:0.21%
  • bullseye_5:0.21%
  • bullseye_6:0.19%
  • bullseye_7:0.18%
  • bullseye_8:0.18%
  • bullseye_9:0.17%
  • bullseye_10:0.17%
  • bullseye_11:0.17%
  • bullseye_12:0.16%
  • bullseye_13:0.16%
  • bullseye_14:0.15%
  • bullseye_15:0.14%
  • bullseye_16:0.14%
  • bullseye_17:0.14%
  • bullseye_18:0.14%
  • bullseye_19:0.14%
  • bullseye_20:0.14%
  • bullseye_21:0.15%
  • bullseye_22:0.15%
  • bullseye_23:0.16%
  • bullseye_24:0.16%
  • bullseye_25:0.16%
  • bullseye_26:0.16%
  • bullseye_27:0.15%
  • bullseye_28:0.14%
  • bullseye_29:0.13%
  • bullseye_30:13.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Lightning 3.4 0.0 70.0sec 69.3sec 22.14% 22.14% 3.3(3.3) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_focused_lightning
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:643.16

Stack Uptimes

  • focused_lightning_1:2.21%
  • focused_lightning_2:2.21%
  • focused_lightning_3:2.21%
  • focused_lightning_4:2.21%
  • focused_lightning_5:2.21%
  • focused_lightning_6:2.21%
  • focused_lightning_7:2.21%
  • focused_lightning_8:2.21%
  • focused_lightning_9:2.21%
  • focused_lightning_10:2.21%

Trigger Attempt Success

  • trigger_pct:99.96%

Spelldata details

  • id:215632
  • name:Focused Lightning
  • tooltip:Mastery increased by {$s1=608}.
  • description:{$@spelldesc215630=Your ranged attacks and spells have a chance to trigger Focused Lightning, granting you {$215632s1=608} Mastery every $215631t1 sec. After {$215631d=10 seconds}, this bonus decreases every $215632t2 sec.}
  • max_stacks:10
  • duration:11.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 9.3 0.3 29.9sec 28.9sec 7.07% 11.13% 0.3(0.3) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.14%
  • lock_and_load_2:2.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.4 2.9 26.0sec 20.4sec 25.59% 25.59% 2.9(2.9) 11.1

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Marking Targets 27.6 8.4 11.0sec 8.4sec 35.08% 49.44% 8.4(8.4) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:35.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 258.8sec 0.0sec 19.58% 19.58% 0.0(0.0) 2.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rapid Killing 2.3 0.0 199.0sec 157.5sec 11.48% 19.25% 0.0(0.0) 2.3

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:11.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Sentinel's Sight 32.9 0.2 9.2sec 9.1sec 37.42% 33.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_sentinels_sight
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • sentinels_sight_1:37.27%
  • sentinels_sight_2:0.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208913
  • name:Sentinel's Sight
  • tooltip:Increases the damage of your next Aimed Shot by {$s1=10}%.
  • description:{$@spelldesc208912=Each enemy you hit with Multi-Shot increases the damage of your next Aimed Shot by {$208913s1=10}%, stacking up to {$208913u=20} times.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Trueshot 2.3 0.0 199.0sec 157.5sec 11.48% 19.94% 0.0(0.0) 2.3

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:11.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_MM_T19M
aimed_shot Focus 91.7 3643.8 39.7 39.7 14323.7
barrage Focus 13.7 821.7 60.0 60.0 15615.5
marked_shot Focus 29.0 869.1 30.0 30.0 20178.5
windburst Focus 14.2 284.7 20.0 21.5 29220.6
Resource Gains Type Count Total Average Overflow
sidewinders Focus 33.08 1801.47 (32.47%) 54.46 17.93 0.99%
focus_regen Focus 1160.70 3746.06 (67.53%) 3.23 100.90 2.62%
Resource RPS-Gain RPS-Loss
Focus 18.45 18.69
Combat End Resource Mean Min Max
Focus 77.96 2.53 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 1.9%

Procs

Count Interval
starved: barrage 228.4 2.2sec
lock_and_load 9.6 28.9sec
no_vuln_aimed_shot 2.1 78.0sec
no_vuln_marked_shot 0.5 85.9sec
marking_targets 36.0 8.4sec
wasted_marking_targets 8.4 32.3sec

Statistics & Data Analysis

Fight Length
Sample Data Hunter_MM_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Hunter_MM_T19M Damage Per Second
Count 7499
Mean 359873.64
Minimum 310872.29
Maximum 426621.87
Spread ( max - min ) 115749.58
Range [ ( max - min ) / 2 * 100% ] 16.08%
Standard Deviation 16254.0392
5th Percentile 334201.68
95th Percentile 387792.34
( 95th Percentile - 5th Percentile ) 53590.66
Mean Distribution
Standard Deviation 187.6980
95.00% Confidence Intervall ( 359505.76 - 360241.52 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 78
0.1% Error 7836
0.1 Scale Factor Error with Delta=300 2255310
0.05 Scale Factor Error with Delta=300 9021240
0.01 Scale Factor Error with Delta=300 225531013
Priority Target DPS
Sample Data Hunter_MM_T19M Priority Target Damage Per Second
Count 7499
Mean 359873.64
Minimum 310872.29
Maximum 426621.87
Spread ( max - min ) 115749.58
Range [ ( max - min ) / 2 * 100% ] 16.08%
Standard Deviation 16254.0392
5th Percentile 334201.68
95th Percentile 387792.34
( 95th Percentile - 5th Percentile ) 53590.66
Mean Distribution
Standard Deviation 187.6980
95.00% Confidence Intervall ( 359505.76 - 360241.52 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 78
0.1% Error 7836
0.1 Scale Factor Error with Delta=300 2255310
0.05 Scale Factor Error with Delta=300 9021240
0.01 Scale Factor Error with Delta=300 225531013
DPS(e)
Sample Data Hunter_MM_T19M Damage Per Second (Effective)
Count 7499
Mean 359873.64
Minimum 310872.29
Maximum 426621.87
Spread ( max - min ) 115749.58
Range [ ( max - min ) / 2 * 100% ] 16.08%
Damage
Sample Data Hunter_MM_T19M Damage
Count 7499
Mean 108007460.16
Minimum 76538437.42
Maximum 143073985.71
Spread ( max - min ) 66535548.29
Range [ ( max - min ) / 2 * 100% ] 30.80%
DTPS
Sample Data Hunter_MM_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hunter_MM_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hunter_MM_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hunter_MM_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hunter_MM_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hunter_MM_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hunter_MM_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hunter_MM_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
0.00 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
8 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
9 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
A 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
B 4.17 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
C 8.52 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
D 13.30 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
E 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
F 8.13 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
0.00 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
G 52.44 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
H 28.87 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
I 21.76 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
J 2.95 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
K 20.47 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
L 0.40 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
M 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
N 1.31 trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
O 1.00 trueshot
P 1.72 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
Q 3.43 marked_shot
R 1.06 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
S 1.00 barrage
T 7.92 aimed_shot,if=execute_time<debuff.vulnerability.remains
U 1.96 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
V 0.82 marked_shot
0.00 windburst
W 1.38 aimed_shot,if=execute_time<debuff.vulnerability.remains
X 0.81 sidewinders
Y 0.02 aimed_shot
0.00 arcane_shot

Sample Sequence

04567ORRSTTPQTTRTTPQTTTKGGDGCGGIFGGJKGGIHKCDGJKGGIKGGIKCDGGIKGGIKCGDGIKGGIHHHKCDGGIKGGIHDFCGIKGGIKGGIDHBKGGIHKDGGIHBFHHHKGDGGJKGCIHHKGGIDKGGIHKCGIHDKGGIKCGIMNHFGDGGGGIFCGIHHHKGDGGIHFCVX

Sample Sequence Table

time name target resources buffs
Pre flask Hunter_MM_T19M 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Hunter_MM_T19M 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus bloodlust, potion_of_deadly_grace
0:00.000 aimed_shot Fluffy_Pillow 130.0/150: 87% focus bloodlust, lock_and_load(2), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:00.755 aimed_shot Fluffy_Pillow 146.1/150: 97% focus bloodlust, lock_and_load, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:01.508 barrage Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.145 aimed_shot Fluffy_Pillow 124.8/150: 83% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.089 aimed_shot Fluffy_Pillow 94.9/150: 63% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:05.035 sidewinders Fluffy_Pillow 65.0/150: 43% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:05.790 marked_shot Fluffy_Pillow 136.1/150: 91% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:06.544 aimed_shot Fluffy_Pillow 122.1/150: 81% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:07.489 aimed_shot Fluffy_Pillow 92.2/150: 61% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:08.432 aimed_shot Fluffy_Pillow 112.3/150: 75% focus bloodlust, lock_and_load, rapid_killing, trueshot, potion_of_deadly_grace
0:09.185 aimed_shot Fluffy_Pillow 128.3/150: 86% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:10.130 aimed_shot Fluffy_Pillow 98.4/150: 66% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:11.077 sidewinders Fluffy_Pillow 68.6/150: 46% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:11.831 marked_shot Fluffy_Pillow 139.6/150: 93% focus bloodlust, rapid_killing, trueshot, sentinels_sight, potion_of_deadly_grace
0:12.584 aimed_shot Fluffy_Pillow 125.6/150: 84% focus bloodlust, rapid_killing, trueshot, sentinels_sight, focused_lightning, potion_of_deadly_grace
0:13.528 aimed_shot Fluffy_Pillow 95.7/150: 64% focus bloodlust, marking_targets, rapid_killing, trueshot, focused_lightning(2), potion_of_deadly_grace
0:14.472 aimed_shot Fluffy_Pillow 65.8/150: 44% focus bloodlust, marking_targets, rapid_killing, trueshot, focused_lightning(3), potion_of_deadly_grace
0:15.418 sidewinders Fluffy_Pillow 33.4/150: 22% focus bloodlust, marking_targets, focused_lightning(4), potion_of_deadly_grace
0:16.410 aimed_shot Fluffy_Pillow 103.5/150: 69% focus bloodlust, sentinels_sight, focused_lightning(5), potion_of_deadly_grace
0:17.730 aimed_shot Fluffy_Pillow 73.5/150: 49% focus bloodlust, focused_lightning(6), potion_of_deadly_grace
0:19.050 Waiting 0.700 sec 43.6/150: 29% focus bloodlust, focused_lightning(8), potion_of_deadly_grace
0:19.750 windburst Fluffy_Pillow 54.2/150: 36% focus bloodlust, focused_lightning(8), potion_of_deadly_grace
0:20.993 aimed_shot Fluffy_Pillow 53.1/150: 35% focus bloodlust, focused_lightning(10), potion_of_deadly_grace
0:22.314 barrage Fluffy_Pillow 73.2/150: 49% focus bloodlust, lock_and_load, marking_targets, focused_lightning(10), potion_of_deadly_grace
0:24.562 aimed_shot Fluffy_Pillow 47.3/150: 32% focus bloodlust, lock_and_load, marking_targets, focused_lightning(8), potion_of_deadly_grace
0:25.553 aimed_shot Fluffy_Pillow 62.4/150: 42% focus bloodlust, marking_targets, focused_lightning(7), potion_of_deadly_grace
0:26.874 marked_shot Fluffy_Pillow 32.5/150: 22% focus bloodlust, marking_targets, focused_lightning(5), potion_of_deadly_grace
0:27.865 sidewinders Fluffy_Pillow 17.5/150: 12% focus bloodlust, marking_targets, focused_lightning(4), potion_of_deadly_grace
0:28.856 aimed_shot Fluffy_Pillow 87.6/150: 58% focus bloodlust, marking_targets, sentinels_sight, focused_lightning(3)
0:30.176 aimed_shot Fluffy_Pillow 57.7/150: 38% focus bloodlust, marking_targets, focused_lightning(2)
0:31.496 Waiting 0.200 sec 27.7/150: 18% focus bloodlust, marking_targets, focused_lightning
0:31.696 marked_shot Fluffy_Pillow 30.8/150: 21% focus bloodlust, marking_targets, focused_lightning
0:32.689 sidewinders Fluffy_Pillow 15.9/150: 11% focus bloodlust, marking_targets
0:33.680 aimed_shot Fluffy_Pillow 85.9/150: 57% focus bloodlust, sentinels_sight
0:34.999 aimed_shot Fluffy_Pillow 56.0/150: 37% focus bloodlust
0:36.319 Waiting 1.400 sec 26.0/150: 17% focus bloodlust
0:37.719 marked_shot Fluffy_Pillow 47.3/150: 32% focus bloodlust
0:38.710 Waiting 1.200 sec 32.3/150: 22% focus bloodlust
0:39.910 aimed_shot Fluffy_Pillow 50.6/150: 34% focus bloodlust
0:41.229 sidewinders Fluffy_Pillow 16.0/150: 11% focus marking_targets
0:42.516 barrage Fluffy_Pillow 86.0/150: 57% focus sentinels_sight
0:45.312 windburst Fluffy_Pillow 58.7/150: 39% focus sentinels_sight
0:46.601 aimed_shot Fluffy_Pillow 53.8/150: 36% focus marking_targets, sentinels_sight
0:48.316 Waiting 0.600 sec 23.8/150: 16% focus marking_targets
0:48.916 marked_shot Fluffy_Pillow 30.9/150: 21% focus marking_targets
0:50.203 sidewinders Fluffy_Pillow 15.9/150: 11% focus marking_targets
0:51.491 aimed_shot Fluffy_Pillow 86.0/150: 57% focus sentinels_sight
0:53.204 aimed_shot Fluffy_Pillow 56.0/150: 37% focus mark_of_the_claw
0:54.894 Waiting 0.400 sec 26.0/150: 17% focus mark_of_the_claw
0:55.294 marked_shot Fluffy_Pillow 30.8/150: 21% focus mark_of_the_claw
0:56.562 Waiting 1.800 sec 15.8/150: 11% focus mark_of_the_claw
0:58.362 sidewinders Fluffy_Pillow 37.2/150: 25% focus marking_targets, mark_of_the_claw
0:59.630 aimed_shot Fluffy_Pillow 107.1/150: 71% focus sentinels_sight
1:01.344 aimed_shot Fluffy_Pillow 77.2/150: 51% focus
1:03.058 Waiting 0.400 sec 47.2/150: 31% focus mark_of_the_claw
1:03.458 marked_shot Fluffy_Pillow 51.9/150: 35% focus marking_targets, mark_of_the_claw
1:04.727 sidewinders Fluffy_Pillow 37.0/150: 25% focus marking_targets, mark_of_the_claw
1:05.994 barrage Fluffy_Pillow 107.0/150: 71% focus sentinels_sight, mark_of_the_claw
1:08.778 windburst Fluffy_Pillow 80.0/150: 53% focus sentinels_sight, mark_of_the_claw
1:10.046 aimed_shot Fluffy_Pillow 75.1/150: 50% focus sentinels_sight, mark_of_the_claw
1:11.737 Waiting 0.500 sec 45.1/150: 30% focus marking_targets, mark_of_the_claw
1:12.237 aimed_shot Fluffy_Pillow 51.0/150: 34% focus marking_targets
1:13.950 Waiting 1.100 sec 21.1/150: 14% focus marking_targets
1:15.050 marked_shot Fluffy_Pillow 33.9/150: 23% focus marking_targets
1:16.338 sidewinders Fluffy_Pillow 19.0/150: 13% focus marking_targets
1:17.627 aimed_shot Fluffy_Pillow 89.0/150: 59% focus marking_targets, sentinels_sight
1:19.343 aimed_shot Fluffy_Pillow 59.1/150: 39% focus marking_targets
1:21.056 Waiting 0.300 sec 29.1/150: 19% focus marking_targets
1:21.356 marked_shot Fluffy_Pillow 32.6/150: 22% focus marking_targets
1:22.644 Waiting 1.700 sec 17.7/150: 12% focus marking_targets
1:24.344 sidewinders Fluffy_Pillow 37.6/150: 25% focus marking_targets
1:25.787 barrage Fluffy_Pillow 109.4/150: 73% focus sentinels_sight
1:28.800 aimed_shot Fluffy_Pillow 85.1/150: 57% focus sentinels_sight, mark_of_the_claw
1:30.491 windburst Fluffy_Pillow 55.2/150: 37% focus marking_targets, mark_of_the_claw
1:31.759 aimed_shot Fluffy_Pillow 50.2/150: 33% focus marking_targets, mark_of_the_claw
1:33.451 Waiting 2.100 sec 20.0/150: 13% focus marking_targets
1:35.551 marked_shot Fluffy_Pillow 44.6/150: 30% focus marking_targets
1:36.839 sidewinders Fluffy_Pillow 29.6/150: 20% focus marking_targets
1:38.128 aimed_shot Fluffy_Pillow 99.7/150: 66% focus sentinels_sight
1:39.842 aimed_shot Fluffy_Pillow 69.7/150: 46% focus
1:41.556 Waiting 0.300 sec 39.8/150: 27% focus
1:41.856 marked_shot Fluffy_Pillow 43.3/150: 29% focus lock_and_load(2), marking_targets
1:43.142 aimed_shot Fluffy_Pillow 28.3/150: 19% focus lock_and_load(2), marking_targets
1:44.429 aimed_shot Fluffy_Pillow 43.4/150: 29% focus lock_and_load, marking_targets
1:45.717 aimed_shot Fluffy_Pillow 58.4/150: 39% focus marking_targets
1:47.431 sidewinders Fluffy_Pillow 28.4/150: 19% focus marking_targets
1:48.718 barrage Fluffy_Pillow 98.5/150: 66% focus sentinels_sight
1:51.507 windburst Fluffy_Pillow 71.1/150: 47% focus sentinels_sight
1:53.044 aimed_shot Fluffy_Pillow 69.1/150: 46% focus sentinels_sight
1:54.758 Waiting 1.000 sec 39.1/150: 26% focus marking_targets
1:55.758 aimed_shot Fluffy_Pillow 50.8/150: 34% focus marking_targets
1:57.472 Waiting 0.800 sec 20.8/150: 14% focus marking_targets
1:58.272 marked_shot Fluffy_Pillow 30.2/150: 20% focus marking_targets
1:59.560 sidewinders Fluffy_Pillow 15.2/150: 10% focus marking_targets
2:00.847 aimed_shot Fluffy_Pillow 85.3/150: 57% focus sentinels_sight
2:02.562 aimed_shot Fluffy_Pillow 55.3/150: 37% focus
2:04.276 Waiting 0.400 sec 25.4/150: 17% focus
2:04.676 marked_shot Fluffy_Pillow 30.0/150: 20% focus
2:05.964 Waiting 3.000 sec 15.1/150: 10% focus
2:08.964 aimed_shot Fluffy_Pillow 50.2/150: 33% focus
2:10.680 Waiting 2.200 sec 20.4/150: 14% focus mark_of_the_claw
2:12.880 windburst Fluffy_Pillow 46.5/150: 31% focus mark_of_the_claw
2:14.307 Waiting 0.500 sec 43.4/150: 29% focus mark_of_the_claw
2:14.807 sidewinders Fluffy_Pillow 49.3/150: 33% focus marking_targets, mark_of_the_claw
2:16.074 barrage Fluffy_Pillow 119.3/150: 80% focus sentinels_sight
2:18.928 aimed_shot Fluffy_Pillow 93.0/150: 62% focus sentinels_sight, mark_of_the_claw
2:20.617 marked_shot Fluffy_Pillow 63.1/150: 42% focus marking_targets, mark_of_the_claw
2:21.886 sidewinders Fluffy_Pillow 48.1/150: 32% focus marking_targets, mark_of_the_claw
2:23.154 aimed_shot Fluffy_Pillow 118.1/150: 79% focus sentinels_sight
2:24.869 aimed_shot Fluffy_Pillow 88.2/150: 59% focus marking_targets, mark_of_the_claw
2:26.558 Waiting 0.400 sec 58.3/150: 39% focus marking_targets, focused_lightning, mark_of_the_claw
2:26.958 marked_shot Fluffy_Pillow 63.0/150: 42% focus marking_targets, focused_lightning, mark_of_the_claw
2:28.225 sidewinders Fluffy_Pillow 48.0/150: 32% focus marking_targets, focused_lightning(2), mark_of_the_claw
2:29.491 aimed_shot Fluffy_Pillow 118.0/150: 79% focus sentinels_sight, focused_lightning(3), mark_of_the_claw
2:31.181 aimed_shot Fluffy_Pillow 87.9/150: 59% focus focused_lightning(5)
2:32.895 Waiting 0.400 sec 57.9/150: 39% focus focused_lightning(7)
2:33.295 marked_shot Fluffy_Pillow 62.6/150: 42% focus focused_lightning(7)
2:34.583 windburst Fluffy_Pillow 47.7/150: 32% focus focused_lightning(9)
2:35.869 Waiting 0.700 sec 42.7/150: 28% focus focused_lightning(10)
2:36.569 aimed_shot Fluffy_Pillow 50.9/150: 34% focus focused_lightning(10)
2:38.283 Waiting 3.400 sec 20.9/150: 14% focus focused_lightning(9)
2:41.683 barrage Fluffy_Pillow 60.7/150: 40% focus focused_lightning(5)
2:44.584 Waiting 0.200 sec 34.6/150: 23% focus focused_lightning(2)
2:44.784 sidewinders Fluffy_Pillow 36.9/150: 25% focus marking_targets, focused_lightning(2)
2:46.070 aimed_shot Fluffy_Pillow 107.0/150: 71% focus sentinels_sight, focused_lightning
2:47.784 aimed_shot Fluffy_Pillow 77.0/150: 51% focus
2:49.499 Waiting 0.300 sec 47.0/150: 31% focus mark_of_the_claw
2:49.799 marked_shot Fluffy_Pillow 50.6/150: 34% focus mark_of_the_claw
2:51.067 Waiting 1.300 sec 35.6/150: 24% focus mark_of_the_claw
2:52.367 aimed_shot Fluffy_Pillow 51.0/150: 34% focus mark_of_the_claw
2:54.060 Waiting 0.900 sec 21.1/150: 14% focus mark_of_the_claw
2:54.960 sidewinders Fluffy_Pillow 31.8/150: 21% focus marking_targets, mark_of_the_claw
2:56.229 windburst Fluffy_Pillow 101.7/150: 68% focus sentinels_sight
2:57.516 aimed_shot Fluffy_Pillow 96.8/150: 65% focus sentinels_sight
2:59.232 aimed_shot Fluffy_Pillow 66.8/150: 45% focus
3:00.946 Waiting 1.600 sec 36.9/150: 25% focus
3:02.546 marked_shot Fluffy_Pillow 55.6/150: 37% focus
3:03.834 Waiting 0.900 sec 40.6/150: 27% focus
3:04.734 aimed_shot Fluffy_Pillow 51.1/150: 34% focus
3:06.449 barrage Fluffy_Pillow 71.2/150: 47% focus lock_and_load
3:09.131 sidewinders Fluffy_Pillow 42.6/150: 28% focus lock_and_load, mark_of_the_claw
3:10.400 aimed_shot Fluffy_Pillow 112.7/150: 75% focus lock_and_load, marking_targets, sentinels_sight, mark_of_the_claw
3:11.669 aimed_shot Fluffy_Pillow 127.7/150: 85% focus marking_targets, mark_of_the_claw
3:13.360 aimed_shot Fluffy_Pillow 97.8/150: 65% focus marking_targets, mark_of_the_claw
3:15.050 sidewinders Fluffy_Pillow 67.8/150: 45% focus marking_targets, mark_of_the_claw
3:16.318 aimed_shot Fluffy_Pillow 137.8/150: 92% focus sentinels_sight, mark_of_the_claw
3:18.008 windburst Fluffy_Pillow 100.0/150: 67% focus marking_targets, mark_of_the_claw
3:19.276 aimed_shot Fluffy_Pillow 95.1/150: 63% focus marking_targets, mark_of_the_claw
3:20.968 aimed_shot Fluffy_Pillow 65.1/150: 43% focus marking_targets, mark_of_the_claw
3:22.657 marked_shot Fluffy_Pillow 35.2/150: 23% focus marking_targets, mark_of_the_claw
3:23.926 sidewinders Fluffy_Pillow 20.2/150: 13% focus marking_targets, mark_of_the_claw
3:25.193 aimed_shot Fluffy_Pillow 90.3/150: 60% focus sentinels_sight, mark_of_the_claw
3:26.883 barrage Fluffy_Pillow 60.3/150: 40% focus mark_of_the_claw
3:29.691 marked_shot Fluffy_Pillow 33.4/150: 22% focus mark_of_the_claw
3:30.961 aimed_shot Fluffy_Pillow 18.4/150: 12% focus lock_and_load(2), marking_targets, mark_of_the_claw
3:32.228 aimed_shot Fluffy_Pillow 33.5/150: 22% focus lock_and_load, marking_targets, mark_of_the_claw
3:33.496 sidewinders Fluffy_Pillow 48.5/150: 32% focus marking_targets, mark_of_the_claw
3:34.764 aimed_shot Fluffy_Pillow 118.4/150: 79% focus sentinels_sight
3:36.479 aimed_shot Fluffy_Pillow 88.5/150: 59% focus
3:38.195 Waiting 0.400 sec 58.6/150: 39% focus
3:38.595 marked_shot Fluffy_Pillow 63.2/150: 42% focus
3:39.882 windburst Fluffy_Pillow 48.3/150: 32% focus
3:41.170 sidewinders Fluffy_Pillow 43.3/150: 29% focus marking_targets, focused_lightning(2)
3:42.457 aimed_shot Fluffy_Pillow 113.4/150: 76% focus sentinels_sight, focused_lightning(3)
3:44.171 aimed_shot Fluffy_Pillow 83.4/150: 56% focus focused_lightning(5)
3:45.885 Waiting 0.300 sec 53.4/150: 36% focus focused_lightning(6)
3:46.185 marked_shot Fluffy_Pillow 57.0/150: 38% focus focused_lightning(7)
3:47.472 Waiting 0.700 sec 42.0/150: 28% focus focused_lightning(8)
3:48.172 aimed_shot Fluffy_Pillow 50.2/150: 33% focus marking_targets, focused_lightning(9)
3:49.889 sidewinders Fluffy_Pillow 20.3/150: 14% focus marking_targets, focused_lightning(10)
3:51.178 barrage Fluffy_Pillow 90.3/150: 60% focus marking_targets, sentinels_sight, focused_lightning(9)
3:54.020 aimed_shot Fluffy_Pillow 63.5/150: 42% focus marking_targets, sentinels_sight, focused_lightning(7)
3:55.734 marked_shot Fluffy_Pillow 33.6/150: 22% focus marking_targets, focused_lightning(5)
3:57.021 Waiting 2.700 sec 18.6/150: 12% focus marking_targets, focused_lightning(4)
3:59.721 aimed_shot Fluffy_Pillow 50.2/150: 33% focus marking_targets, focused_lightning
4:01.436 windburst Fluffy_Pillow 20.2/150: 13% focus marking_targets
4:02.723 sidewinders Fluffy_Pillow 15.3/150: 10% focus marking_targets
4:04.011 aimed_shot Fluffy_Pillow 85.3/150: 57% focus sentinels_sight
4:05.725 aimed_shot Fluffy_Pillow 55.4/150: 37% focus
4:07.440 Waiting 0.400 sec 25.4/150: 17% focus marking_targets
4:07.840 marked_shot Fluffy_Pillow 30.1/150: 20% focus marking_targets
4:09.128 Waiting 1.000 sec 15.1/150: 10% focus marking_targets
4:10.128 sidewinders Fluffy_Pillow 26.8/150: 18% focus bullseye, marking_targets
4:11.664 barrage Fluffy_Pillow 99.8/150: 67% focus bullseye(2), sentinels_sight
4:14.512 aimed_shot Fluffy_Pillow 73.1/150: 49% focus bullseye(19), sentinels_sight
4:16.226 marked_shot Fluffy_Pillow 43.1/150: 29% focus bullseye(20)
4:17.513 Waiting 0.500 sec 28.2/150: 19% focus bullseye(23), mark_of_the_claw
4:18.013 potion Fluffy_Pillow 34.1/150: 23% focus bullseye(23), mark_of_the_claw
4:18.013 Waiting 1.100 sec 34.1/150: 23% focus bullseye(23), mark_of_the_claw, potion_of_deadly_grace
4:19.113 trueshot Fluffy_Pillow 47.2/150: 31% focus bullseye(29), mark_of_the_claw, potion_of_deadly_grace
4:19.113 Waiting 0.200 sec 47.2/150: 31% focus bullseye(29), rapid_killing, trueshot, mark_of_the_claw, potion_of_deadly_grace
4:19.313 aimed_shot Fluffy_Pillow 50.5/150: 34% focus bullseye(29), rapid_killing, trueshot, mark_of_the_claw, potion_of_deadly_grace
4:20.522 sidewinders Fluffy_Pillow 20.6/150: 14% focus bullseye(30), rapid_killing, trueshot, mark_of_the_claw, potion_of_deadly_grace
4:21.499 aimed_shot Fluffy_Pillow 91.8/150: 61% focus bullseye(30), rapid_killing, trueshot, sentinels_sight, mark_of_the_claw, potion_of_deadly_grace
4:22.707 windburst Fluffy_Pillow 61.8/150: 41% focus bullseye(30), marking_targets, rapid_killing, trueshot, mark_of_the_claw, potion_of_deadly_grace
4:23.626 aimed_shot Fluffy_Pillow 57.0/150: 38% focus bullseye(30), lock_and_load(2), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:24.545 aimed_shot Fluffy_Pillow 72.1/150: 48% focus bullseye(30), lock_and_load, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:25.464 aimed_shot Fluffy_Pillow 87.1/150: 58% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:26.689 aimed_shot Fluffy_Pillow 57.1/150: 38% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:27.916 Waiting 0.200 sec 27.2/150: 18% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:28.116 marked_shot Fluffy_Pillow 30.5/150: 20% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:29.036 Waiting 1.600 sec 15.6/150: 10% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:30.636 sidewinders Fluffy_Pillow 41.7/150: 28% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
4:31.725 barrage Fluffy_Pillow 114.8/150: 77% focus bullseye(30), rapid_killing, trueshot, sentinels_sight, mark_of_the_claw, potion_of_deadly_grace
4:33.843 aimed_shot Fluffy_Pillow 90.0/150: 60% focus bullseye(30), rapid_killing, trueshot, sentinels_sight, mark_of_the_claw, potion_of_deadly_grace
4:35.052 Waiting 0.800 sec 55.6/150: 37% focus bullseye(30), marking_targets, mark_of_the_claw, potion_of_deadly_grace
4:35.852 marked_shot Fluffy_Pillow 65.1/150: 43% focus bullseye(30), lock_and_load(2), marking_targets, mark_of_the_claw, potion_of_deadly_grace
4:37.120 aimed_shot Fluffy_Pillow 50.1/150: 33% focus bullseye(30), lock_and_load(2), marking_targets, mark_of_the_claw, potion_of_deadly_grace
4:38.387 aimed_shot Fluffy_Pillow 65.1/150: 43% focus bullseye(30), lock_and_load, marking_targets, mark_of_the_claw, potion_of_deadly_grace
4:39.657 aimed_shot Fluffy_Pillow 80.2/150: 53% focus bullseye(30), marking_targets, mark_of_the_claw, potion_of_deadly_grace
4:41.347 sidewinders Fluffy_Pillow 50.2/150: 33% focus bullseye(30), marking_targets, mark_of_the_claw, potion_of_deadly_grace
4:42.617 aimed_shot Fluffy_Pillow 120.3/150: 80% focus bullseye(30), sentinels_sight, mark_of_the_claw, potion_of_deadly_grace
4:44.307 windburst Fluffy_Pillow 90.1/150: 60% focus bullseye(30), mark_of_the_claw, potion_of_deadly_grace
4:45.576 aimed_shot Fluffy_Pillow 85.2/150: 57% focus bullseye(30), mark_of_the_claw, potion_of_deadly_grace
4:47.265 aimed_shot Fluffy_Pillow 55.2/150: 37% focus bullseye(30), mark_of_the_claw, potion_of_deadly_grace
4:48.956 Waiting 1.700 sec 25.3/150: 17% focus bullseye(30), mark_of_the_claw
4:50.656 marked_shot Fluffy_Pillow 45.4/150: 30% focus bullseye(30), mark_of_the_claw
4:51.923 Waiting 1.700 sec 30.5/150: 20% focus bullseye(30), mark_of_the_claw
4:53.623 aimed_shot Fluffy_Pillow 50.6/150: 34% focus bullseye(30), mark_of_the_claw
4:55.313 sidewinders Fluffy_Pillow 20.5/150: 14% focus bullseye(30), marking_targets
4:56.599 barrage Fluffy_Pillow 90.6/150: 60% focus bullseye(30), sentinels_sight
4:59.424 marked_shot Fluffy_Pillow 63.8/150: 43% focus bullseye(30), sentinels_sight, mark_of_the_claw
5:00.691 sidewinders Fluffy_Pillow 48.8/150: 33% focus bullseye(30), marking_targets, sentinels_sight, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6231 6231 0
Agility 29075 27710 17363 (13690)
Stamina 41882 41882 25957
Intellect 6005 6005 0
Spirit 2 2 0
Health 2512920 2512920 0
Focus 150 150 0
Crit 24.67% 24.67% 3384
Haste 16.90% 16.90% 5491
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 29075 27710 0
Mastery 22.31% 22.31% 9694
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1448 Sta, +1115 Mastery, +939 Haste }, enchant: mark_of_the_claw
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 880, stats: { 341 Armor, +1930 Sta, +1287 AgiInt, +735 Mastery, +360 Haste }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist War Belt of the Sentinel Army
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 Agi, +626 Haste, +469 Mastery }
Local Legs Singular Chain Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +1012 Mastery, +448 Haste }
Local Feet Black Venom Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +759 Haste, +336 Mastery }
Local Wrists Manacles of the Nightmare Colossus
ilevel: 880, stats: { 199 Armor, +1447 Sta, +965 AgiInt, +481 Haste, +340 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Finger1 Mindrend Band
ilevel: 880, stats: { +1448 Sta, +1292 Mastery, +763 Haste }, enchant: { +200 Mastery }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Trinket2 Stormsinger Fulmination Charge
ilevel: 840, stats: { +1123 AgiInt }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 906, weapon: { 11779 - 11781, 3 }, stats: { +2186 Agi, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Hunter_MM_T19M"
level=110
race=pandaren
role=attack
position=ranged_back
talents=1103021
artifact=55:0:0:0:0:307:1:308:1:309:1:310:1:311:1:312:3:313:3:314:3:315:3:316:3:317:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=/trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806,enchant=mark_of_the_claw
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=manacles_of_the_nightmare_colossus,id=139222,bonus_id=1806
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1806
waist=war_belt_of_the_sentinel_army,id=137081,bonus_id=1806
legs=singular_chain_leggings,id=139215,bonus_id=1806
feet=black_venom_sabatons,id=139219,bonus_id=1806
finger1=mindrend_band,id=138220,bonus_id=1806,enchant=200mastery
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200mastery
trinket1=twisting_wind,id=139323,bonus_id=1806
trinket2=stormsinger_fulmination_charge,id=137367,bonus_id=1727
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,gem_id=139262/139257/138228,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=879.07
# gear_agility=17363
# gear_stamina=25957
# gear_crit_rating=3384
# gear_haste_rating=5491
# gear_mastery_rating=9694
# gear_armor=2758
summon_pet=cat

Hunter_SV_T19M : 334212 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
334211.8 334211.8 177.5 / 0.053% 30334.0 / 9.1% 24803.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.0 12.0 Focus 19.69% 40.5 100.0% 100%
Talents
  • 15: Way of the Mok'Nathal (Survival Hunter)
  • 30: Snake Hunter (Survival Hunter)
  • 60: Improved Traps (Survival Hunter)
  • 90: Dragonsfire Grenade (Survival Hunter)
  • 100: Expert Trapper (Survival Hunter)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Hunter_SV_T19M 334212
auto_attack_mh 18886 (23960) 5.7% (7.2%) 104.3 2.88sec 69049 24028 Direct 104.3 37484 74984 54427 45.2%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.27 104.27 0.00 0.00 2.8737 0.0000 5675265.10 8343177.28 31.98 24028.27 24028.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.16 54.82% 37484.11 33078 46472 37483.74 35911 39286 2142742 3150034 31.98
crit 47.11 45.18% 74984.02 66156 92944 74982.13 70072 79148 3532523 5193143 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Talon Strike 5074 1.5% 20.8 26.45sec 73294 0 Direct 20.8 50469 100907 73296 45.3%  

Stats details: talon_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.80 20.80 0.00 0.00 0.0000 0.0000 1524804.97 2241607.73 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.39 54.74% 50469.27 43262 62990 50431.60 0 62990 574788 844993 31.96
crit 9.41 45.26% 100907.29 86524 125979 100845.13 0 125979 950017 1396615 31.96
 
 

Action details: talon_strike

Static Values
  • id:203525
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203525
  • name:Talon Strike
  • school:physical
  • tooltip:
  • description:Deals $m1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Dragonsfire Grenade 19921 6.0% 10.3 30.56sec 580771 585545 Direct 10.2 100433 0 100433 0.0%  
Periodic 80.8 42255 84560 61405 45.3% 26.9%

Stats details: dragonsfire_grenade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.31 10.24 80.75 80.75 0.9919 1.0000 5986615.42 5986615.42 0.00 65805.06 585545.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.24 100.00% 100432.90 88332 128612 100392.55 93964 107648 1028181 1028181 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.2 54.73% 42255.46 36069 52517 42259.53 39655 45290 1867621 1867621 0.00
crit 36.6 45.27% 84559.81 72138 105033 84570.32 78999 91901 3090814 3090814 0.00
 
 

Action details: dragonsfire_grenade

Static Values
  • id:194855
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194855
  • name:Dragonsfire Grenade
  • school:physical
  • tooltip:
  • description:Hurls a dragonsfire grenade at the target that explodes into flames, inflicting ${$194858o1+{$194858s3=0}} Fire damage over {$194858d=8 seconds} and reducing movement speed by {$194858s2=20}%. The volatile flames on the target also scorch nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.225000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Explosive Trap 54019 16.2% 24.8 12.37sec 655349 656259 Direct 24.8 223191 446222 324101 45.2%  
Periodic 243.3 23225 46451 33739 45.3% 80.9%

Stats details: explosive_trap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.78 24.78 243.28 243.28 0.9986 1.0000 16238482.08 16238482.08 0.00 60586.83 656259.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.57 54.76% 223190.87 198380 288841 223107.58 209687 253133 3028127 3028127 0.00
crit 11.21 45.24% 446222.48 396760 577682 446167.19 417590 520549 5002564 5002564 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.2 54.73% 23224.93 19838 28884 23224.39 22274 24030 3092445 3092445 0.00
crit 110.1 45.27% 46450.70 39676 57768 46450.97 44684 48243 5115346 5115346 0.00
 
 

Action details: explosive_trap

Static Values
  • id:13812
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:13812
  • name:Explosive Trap
  • school:fire
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:{$@spelldesc191433=Tosses a fire trap on the ground in front of you that explodes when an enemy approaches, causing {$13812s1=0} Fire damage and burning all enemies within $13812A1 yards for $13812o2 additional Fire damage over {$13812d=10 seconds}. Trap will exist for {$13813d=60 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.350000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Flanking Strike 26166 7.8% 29.6 9.78sec 265785 220342 Direct 29.6 167907 335925 265788 58.3%  

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.59 29.59 0.00 0.00 1.2062 0.0000 7865121.25 11562473.25 31.98 220342.38 220342.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.35 41.75% 167907.27 155199 213392 167825.83 156691 191383 2074216 3049294 31.98
crit 17.24 58.25% 335924.75 310398 426784 335747.02 318850 368970 5790905 8513179 31.98
 
 

Action details: flanking_strike

Static Values
  • id:202800
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains>=3)|!talent.way_of_the_moknathal.enabled
Spelldata
  • id:202800
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:A coordinated attack on the target, where you deal ${$sw1*$<mult>} Physical damage and your pet deals $<damage> Physical damage. If the target is attacking you, your pet's attack will deal {$s3=50}% increased damage and {$s4=400}% increased threat. Otherwise, your attack will deal {$s3=50}% increased damage.{$?s191334=false}[ Flanking strike has double the normal chance to trigger Hunting Companion.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.25
 
Fury of the Eagle 29716 8.9% 6.6 47.89sec 1356921 395537 Periodic 58.8 104291 208479 151634 45.4% 7.0%

Stats details: fury_of_the_eagle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.58 0.00 58.84 58.84 3.4306 0.3552 8922127.92 13116373.16 31.98 395536.99 395536.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.1 54.56% 104290.63 27039 157474 104477.99 66439 137869 3348174 4922133 31.98
crit 26.7 45.44% 208479.29 54078 314948 208743.00 118718 284015 5573954 8194240 31.98
 
 

Action details: fury_of_the_eagle

Static Values
  • id:203415
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.mongoose_fury.up&(buff.mongoose_fury.stack=6|action.mongoose_bite.charges=0&cooldown.snake_hunter.remains|buff.mongoose_fury.remains<=gcd.max*2)
Spelldata
  • id:203415
  • name:Fury of the Eagle
  • school:physical
  • tooltip:
  • description:Furiously strikes all enemies in front of you, dealing ${{$203413s1=0}*9} Physical damage. Damage increased by Mongoose Fury.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 

Action details: fury_of_the_eagle_tick

Static Values
  • id:203413
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203413
  • name:Fury of the Eagle
  • school:physical
  • tooltip:
  • description:{$@spelldesc203415=Furiously strikes all enemies in front of you, dealing ${{$203413s1=0}*9} Physical damage. Damage increased by Mongoose Fury.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Lacerate 44358 13.3% 25.2 11.86sec 528844 436784 Direct 25.2 44345 88755 64439 45.2%  
Periodic 288.0 27993 55984 40670 45.3% 95.5%

Stats details: lacerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.22 25.22 288.01 288.01 1.2108 0.9965 13338951.92 14103020.00 5.42 42005.17 436784.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.81 54.75% 44344.76 39275 55519 44337.31 40877 49871 612393 900276 31.98
crit 11.41 45.25% 88754.80 78550 111038 88740.78 81819 100331 1012956 1489141 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 157.6 54.71% 27993.13 26 35056 27992.76 26907 28986 4410781 4410781 0.00
crit 130.4 45.29% 55983.54 50 70111 55982.67 53670 58145 7302822 7302822 0.00
 
 

Action details: lacerate

Static Values
  • id:185855
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.lacerate.ticking&dot.lacerate.remains<=3|target.time_to_die>=5
Spelldata
  • id:185855
  • name:Lacerate
  • school:physical
  • tooltip:Bleeding for {$s1=1} damage every $t1 sec.
  • description:Tears a bleeding wound in the target, dealing ${$o1+{$s2=0}} Physical damage over {$d=12 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.670000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Mongoose Bite 46002 13.8% 44.9 6.61sec 307240 258340 Direct 44.9 210893 423165 307238 45.4%  

Stats details: mongoose_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.93 44.93 0.00 0.00 1.1893 0.0000 13804629.56 20294113.07 31.98 258339.50 258339.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.54 54.61% 210892.80 85866 481499 211026.77 154595 278104 5174918 7607620 31.98
crit 20.39 45.39% 423164.73 171731 962999 423602.00 299787 629722 8629711 12686493 31.98
 
 

Action details: mongoose_bite

Static Values
  • id:190928
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.aspect_of_the_eagle.up&(charges>=2|charges>=1&cooldown.mongoose_bite.remains<=2)|(buff.mongoose_fury.up|cooldown.fury_of_the_eagle.remains<5|charges=3)
Spelldata
  • id:190928
  • name:Mongoose Bite
  • school:physical
  • tooltip:
  • description:Attempts to sever the target's limbs with a brutal attack that deals $sw1 Physical damage and grants you Mongoose Fury. Mongoose Fury increases Mongoose Bite damage by $?a134735[{$190931s2=35}][{$190931s1=50}]% for {$190931d=14 seconds}, stacking up to {$190931u=6} times. Successive attacks do not increase duration.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
On the Trail 8159 2.4% 0.0 0.00sec 0 0 Periodic 300.1 8172 0 8172 0.0% 99.8%

Stats details: on_the_trail

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 300.15 300.15 0.0000 1.0000 2452940.45 2452940.45 0.00 8172.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 300.1 100.00% 8172.47 6996 10186 8172.31 7992 8341 2452940 2452940 0.00
 
 

Action details: on_the_trail

Static Values
  • id:204081
  • school:physical
  • resource:none
  • range:60.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204081
  • name:On the Trail
  • school:physical
  • tooltip:Deals $m1 damage per $t sec. Melee attacks can extend this effect by 6 sec per melee attack.
  • description:{$@spelldesc203757=Harpoon applies On the Trail, a unique damage over time effect that deals ${$204081m1*12} damage over {$204081d=12 seconds} and your melee autoattacks extend its duration by 6 sec.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.220000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Potion of the Old War 16165 4.8% 23.4 3.79sec 204624 0 Direct 23.4 140905 282060 204623 45.1%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.35 23.35 0.00 0.00 0.0000 0.0000 4778877.03 7025401.90 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.81 54.86% 140904.64 130152 169198 140895.41 130152 161389 1805298 2653959 31.98
crit 10.54 45.14% 282060.40 260305 338396 282081.95 260305 338396 2973579 4371443 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Raptor Strike 28489 8.5% 49.3 6.12sec 173778 143417 Direct 49.3 119621 239244 173776 45.3%  

Stats details: raptor_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.28 49.28 0.00 0.00 1.2117 0.0000 8563693.36 12589440.41 31.98 143416.62 143416.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.97 54.73% 119621.04 107722 151016 119583.35 112648 130143 3226018 4742552 31.98
crit 22.31 45.27% 239244.09 215445 302031 239179.93 223285 265402 5337675 7846888 31.98
 
 

Action details: raptor_strike

Static Values
  • id:186270
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.serpent_sting.enabled&active_enemies<=2&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)|talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains<gcd.max|buff.moknathal_tactics.down)
Spelldata
  • id:186270
  • name:Raptor Strike
  • school:physical
  • tooltip:
  • description:A vicious slash dealing $sw1 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
pet - cat 37257 / 37257
Claw 11607 3.5% 100.7 3.00sec 34633 34478 Direct 100.7 22325 44627 34633 55.2%  

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.72 100.72 0.00 0.00 1.0045 0.0000 3488095.14 5127830.25 31.98 34477.56 34477.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.14 44.82% 22325.44 11016 24675 22332.67 20555 24153 1007693 1481404 31.98
crit 55.58 55.18% 44627.15 22032 49351 44644.56 41239 47898 2480402 3646426 31.98
 
 

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:
  • description:Claw the enemy, causing ${$<damage>} damage. Deals {$62762s2=100}% more damage and costs {$62762s1=100}% more Focus when your pet has 50 or more Focus.
 
Flanking Strike 11787 3.5% 29.6 9.78sec 119652 0 Direct 29.6 71103 142210 119654 68.3%  

Stats details: flanking_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.59 29.59 0.00 0.00 0.0000 0.0000 3540742.34 5205226.63 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.39 31.72% 71102.52 66593 72412 71105.32 66593 72412 667495 981281 31.98
crit 20.20 68.28% 142210.08 133187 144824 142217.08 137805 144824 2873247 4223946 31.98
 
 

Action details: flanking_strike

Static Values
  • id:204740
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204740
  • name:Flanking Strike
  • school:physical
  • tooltip:
  • description:{$@spelldesc34026=Give the command to kill, causing your pet to savagely deal $<damage> Physical damage to its target. 25 yard range.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.152000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 13863 4.2% 237.1 1.26sec 17564 13885 Direct 237.1 11306 22611 17564 55.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 237.14 237.14 0.00 0.00 1.2650 0.0000 4165167.88 6123191.31 31.98 13884.54 13884.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.86 44.64% 11305.70 10300 11537 11305.46 11049 11514 1196848 1759480 31.98
crit 131.28 55.36% 22610.82 20601 23073 22609.99 22110 23002 2968320 4363712 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
Hunter_SV_T19M
Aspect of the Eagle 6.6 49.06sec

Stats details: aspect_of_the_eagle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: aspect_of_the_eagle

Static Values
  • id:186289
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:48.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:186289
  • name:Aspect of the Eagle
  • school:physical
  • tooltip:Critical Strike chance on abilities increased by {$s1=0}%.
  • description:$?a231555[Grants you and your pet {$s1=0}% increased Critical Strike chance on all abilities, and your][Your] pet's attacks have a{$?s191334=false}[n additional][] {$s2=25}% chance to grant you a charge of Mongoose Bite. Lasts {$d=10 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_SV_T19M
  • harmful:false
  • if_expr:
 
Cleansed Drake's Breath 3.1 61.89sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_SV_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Hunter_SV_T19M
  • harmful:false
  • if_expr:
 
Harpoon 1.0 0.00sec

Stats details: harpoon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: harpoon

Static Values
  • id:190925
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190925
  • name:Harpoon
  • school:physical
  • tooltip:
  • description:Hurls a harpoon at an enemy, rooting them in place for {$190927d=3 seconds} and pulling you to them.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Snake Hunter 3.6 95.59sec

Stats details: snake_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: snake_hunter

Static Values
  • id:201078
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:action.mongoose_bite.charges<=1&buff.mongoose_fury.remains>gcd.max*4|action.mongoose_bite.charges=0&buff.aspect_of_the_eagle.up
Spelldata
  • id:201078
  • name:Snake Hunter
  • school:physical
  • tooltip:
  • description:Instantly grants you {$s1=3} charges of Mongoose Bite.
 
summon_pet 1.0 0.00sec

Stats details: summon_pet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_pet

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Aspect of the Eagle 6.6 0.0 49.1sec 49.1sec 21.56% 24.60% 0.0(0.0) 6.4

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_aspect_of_the_eagle
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • aspect_of_the_eagle_1:21.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:186289
  • name:Aspect of the Eagle
  • tooltip:Critical Strike chance on abilities increased by {$s1=0}%.
  • description:$?a231555[Grants you and your pet {$s1=0}% increased Critical Strike chance on all abilities, and your][Your] pet's attacks have a{$?s191334=false}[n additional][] {$s2=25}% chance to grant you a charge of Mongoose Bite. Lasts {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Blood Frenzy 10.8 6.5 28.2sec 17.1sec 45.62% 45.62% 6.5(6.5) 10.3

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 11.27% 0.0(0.0) 1.0

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cleansed Ancient's Blessing 2.8 0.0 73.1sec 73.1sec 9.10% 9.10% 0.0(0.0) 2.7

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:9.10%

Trigger Attempt Success

  • trigger_pct:95.49%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 2.8 0.0 72.5sec 72.5sec 9.20% 9.20% 0.0(0.0) 2.7

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:9.20%

Trigger Attempt Success

  • trigger_pct:95.88%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 2.8 0.0 72.8sec 72.8sec 9.03% 9.03% 0.0(0.0) 2.7

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.03%

Trigger Attempt Success

  • trigger_pct:95.34%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Fury of the Eagle 6.6 0.0 47.9sec 47.9sec 6.95% 6.95% 27.8(121.3) 6.5

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_fury_of_the_eagle
  • max_stacks:6
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fury_of_the_eagle_1:0.26%
  • fury_of_the_eagle_2:0.31%
  • fury_of_the_eagle_3:0.45%
  • fury_of_the_eagle_4:0.46%
  • fury_of_the_eagle_5:0.32%
  • fury_of_the_eagle_6:5.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203415
  • name:Fury of the Eagle
  • tooltip:
  • description:Furiously strikes all enemies in front of you, dealing ${{$203413s1=0}*9} Physical damage. Damage increased by Mongoose Fury.
  • max_stacks:0
  • duration:4.00
  • cooldown:45.00
  • default_chance:100.00%
Mark of the Claw 11.3 3.0 26.1sec 20.2sec 25.32% 25.32% 3.0(3.0) 11.1

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Mok'Nathal Tactics 6.1 43.1 50.0sec 6.1sec 97.82% 97.82% 27.6(27.6) 5.1

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_moknathal_tactics
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03

Stack Uptimes

  • moknathal_tactics_1:12.77%
  • moknathal_tactics_2:9.17%
  • moknathal_tactics_3:8.81%
  • moknathal_tactics_4:67.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201081
  • name:Mok'Nathal Tactics
  • tooltip:Attack Power increased by {$s1=3}%
  • description:$@spelldesc109306
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Mongoose Fury 9.8 35.1 32.0sec 6.6sec 55.20% 90.49% 2.7(2.7) 9.2

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_mongoose_fury
  • max_stacks:6
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50

Stack Uptimes

  • mongoose_fury_1:10.40%
  • mongoose_fury_2:9.21%
  • mongoose_fury_3:14.03%
  • mongoose_fury_4:9.32%
  • mongoose_fury_5:3.41%
  • mongoose_fury_6:8.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190931
  • name:Mongoose Fury
  • tooltip:Damage dealt by Mongoose Bite increased by {$s1=50}%.
  • description:{$@spelldesc190928=Attempts to sever the target's limbs with a brutal attack that deals $sw1 Physical damage and grants you Mongoose Fury. Mongoose Fury increases Mongoose Bite damage by $?a134735[{$190931s2=35}][{$190931s1=50}]% for {$190931d=14 seconds}, stacking up to {$190931u=6} times. Successive attacks do not increase duration.}
  • max_stacks:6
  • duration:14.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 59.2sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:750.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_SV_T19M
flanking_strike Focus 29.6 1479.6 50.0 50.0 5315.7
lacerate Focus 25.2 882.8 35.0 35.0 15109.9
raptor_strike Focus 49.3 1232.0 25.0 25.0 6951.1
pet - cat
claw Focus 100.7 4649.6 46.2 46.2 750.2
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1001.36 3522.25 (100.00%) 3.52 234.27 6.24%
pet - cat
focus_regen Focus 566.59 4579.13 (100.00%) 8.08 112.33 2.39%
Resource RPS-Gain RPS-Loss
Focus 11.72 11.96
Combat End Resource Mean Min Max
Focus 48.19 0.01 120.00

Benefits & Uptimes

Benefits %
cat-wild_hunt 84.7%
Uptimes %
Focus Cap 4.5%
cat-Focus Cap 0.4%

Procs

Count Interval
hunting_companion 4.0 53.9sec

Statistics & Data Analysis

Fight Length
Sample Data Hunter_SV_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Hunter_SV_T19M Damage Per Second
Count 7499
Mean 334211.81
Minimum 308174.87
Maximum 367261.80
Spread ( max - min ) 59086.94
Range [ ( max - min ) / 2 * 100% ] 8.84%
Standard Deviation 7843.9069
5th Percentile 321966.82
95th Percentile 347857.35
( 95th Percentile - 5th Percentile ) 25890.52
Mean Distribution
Standard Deviation 90.5797
95.00% Confidence Intervall ( 334034.28 - 334389.35 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2116
0.1 Scale Factor Error with Delta=300 525228
0.05 Scale Factor Error with Delta=300 2100915
0.01 Scale Factor Error with Delta=300 52522880
Priority Target DPS
Sample Data Hunter_SV_T19M Priority Target Damage Per Second
Count 7499
Mean 334211.81
Minimum 308174.87
Maximum 367261.80
Spread ( max - min ) 59086.94
Range [ ( max - min ) / 2 * 100% ] 8.84%
Standard Deviation 7843.9069
5th Percentile 321966.82
95th Percentile 347857.35
( 95th Percentile - 5th Percentile ) 25890.52
Mean Distribution
Standard Deviation 90.5797
95.00% Confidence Intervall ( 334034.28 - 334389.35 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2116
0.1 Scale Factor Error with Delta=300 525228
0.05 Scale Factor Error with Delta=300 2100915
0.01 Scale Factor Error with Delta=300 52522880
DPS(e)
Sample Data Hunter_SV_T19M Damage Per Second (Effective)
Count 7499
Mean 334211.81
Minimum 308174.87
Maximum 367261.80
Spread ( max - min ) 59086.94
Range [ ( max - min ) / 2 * 100% ] 8.84%
Damage
Sample Data Hunter_SV_T19M Damage
Count 7499
Mean 89151509.05
Minimum 67256094.06
Maximum 114471820.90
Spread ( max - min ) 47215726.84
Range [ ( max - min ) / 2 * 100% ] 26.48%
DTPS
Sample Data Hunter_SV_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Hunter_SV_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Hunter_SV_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Hunter_SV_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Hunter_SV_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Hunter_SV_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Hunter_SV_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Hunter_SV_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 summon_pet
3 0.00 snapshot_stats
4 0.00 potion,name=potion_of_the_old_war
5 0.00 augmentation,type=defiled
6 0.00 harpoon
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_attack
0.00 arcane_torrent,if=focus.deficit>=30
0.00 blood_fury
0.00 berserking
8 1.00 potion,name=old_war
0.00 steel_trap
9 24.78 explosive_trap
A 10.31 dragonsfire_grenade
0.00 caltrops
0.00 carve,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies>=3&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)
B 32.07 raptor_strike,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies<=2&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)|talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains<gcd.max|buff.moknathal_tactics.down)
C 6.59 aspect_of_the_eagle
D 6.58 fury_of_the_eagle,if=buff.mongoose_fury.up&(buff.mongoose_fury.stack=6|action.mongoose_bite.charges=0&cooldown.snake_hunter.remains|buff.mongoose_fury.remains<=gcd.max*2)
E 44.93 mongoose_bite,if=buff.aspect_of_the_eagle.up&(charges>=2|charges>=1&cooldown.mongoose_bite.remains<=2)|(buff.mongoose_fury.up|cooldown.fury_of_the_eagle.remains<5|charges=3)
0.00 a_murder_of_crows
F 25.22 lacerate,if=dot.lacerate.ticking&dot.lacerate.remains<=3|target.time_to_die>=5
G 3.55 snake_hunter,if=action.mongoose_bite.charges<=1&buff.mongoose_fury.remains>gcd.max*4|action.mongoose_bite.charges=0&buff.aspect_of_the_eagle.up
H 29.59 flanking_strike,if=talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains>=3)|!talent.way_of_the_moknathal.enabled
0.00 butchery,if=spell_targets.butchery>=2
0.00 carve,if=spell_targets.carve>=4
0.00 spitting_cobra
0.00 throwing_axes
I 17.21 raptor_strike,if=!talent.throwing_axes.enabled&focus>75-cooldown.flanking_strike.remains*focus.regen

Sample Sequence

01245679ABCEEEFGEEEBD9EIFHIIHE9BFHAIHIF9BHEEEB9CFHIED8IA9FHIHIF9BHFEB9EEHABFE9BCGEEEDBF9EHIIIHEFA9BHFB9HBFEBE9CEDABFHEI9HIFBH9FBHAB9FEEBEGEECE9BDFEBHI9IHAFBH9BFEEEIH9IFEBHAC9FEBDHIF9EBHEFB9HABFH9BEEEBFCGE9EEBD

Sample Sequence Table

time name target resources buffs
Pre flask Hunter_SV_T19M 120.0/120: 100% focus
Pre food Hunter_SV_T19M 120.0/120: 100% focus
Pre summon_pet Fluffy_Pillow 120.0/120: 100% focus
Pre potion Fluffy_Pillow 120.0/120: 100% focus potion_of_the_old_war
Pre augmentation Hunter_SV_T19M 120.0/120: 100% focus potion_of_the_old_war
0:00.000 harpoon Fluffy_Pillow 120.0/120: 100% focus mark_of_the_claw, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 120.0/120: 100% focus mark_of_the_claw, potion_of_the_old_war
0:00.000 explosive_trap Fluffy_Pillow 120.0/120: 100% focus bloodlust, mark_of_the_claw, potion_of_the_old_war
0:00.755 dragonsfire_grenade Fluffy_Pillow 120.0/120: 100% focus bloodlust, mark_of_the_claw, potion_of_the_old_war
0:01.510 raptor_strike Fluffy_Pillow 120.0/120: 100% focus bloodlust, mark_of_the_claw, potion_of_the_old_war
0:02.506 aspect_of_the_eagle Fluffy_Pillow 110.1/120: 92% focus bloodlust, moknathal_tactics, mark_of_the_claw, potion_of_the_old_war
0:02.506 mongoose_bite Fluffy_Pillow 110.1/120: 92% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mark_of_the_claw, potion_of_the_old_war
0:03.503 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury, mark_of_the_claw, potion_of_the_old_war
0:04.497 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(2), mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:05.416 lacerate Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), mark_of_the_claw, blood_frenzy, potion_of_the_old_war
0:06.336 snake_hunter Fluffy_Pillow 100.0/120: 83% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), blood_frenzy, potion_of_the_old_war
0:06.336 mongoose_bite Fluffy_Pillow 100.0/120: 83% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), blood_frenzy, potion_of_the_old_war
0:07.269 mongoose_bite Fluffy_Pillow 115.0/120: 96% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(4), blood_frenzy, potion_of_the_old_war
0:08.201 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(5), blood_frenzy, potion_of_the_old_war
0:09.136 raptor_strike Fluffy_Pillow 120.0/120: 100% focus bloodlust, aspect_of_the_eagle, moknathal_tactics, mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:10.071 fury_of_the_eagle Fluffy_Pillow 110.1/120: 92% focus bloodlust, aspect_of_the_eagle, moknathal_tactics(2), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:12.861 explosive_trap Fluffy_Pillow 120.0/120: 100% focus bloodlust, moknathal_tactics(2), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:13.623 mongoose_bite Fluffy_Pillow 120.0/120: 100% focus bloodlust, moknathal_tactics(2), mongoose_fury(6), potion_of_the_old_war
0:14.803 raptor_strike Fluffy_Pillow 120.0/120: 100% focus bloodlust, moknathal_tactics(2), mongoose_fury(6), potion_of_the_old_war
0:15.813 lacerate Fluffy_Pillow 111.3/120: 93% focus bloodlust, moknathal_tactics(3), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:16.747 flanking_strike Fluffy_Pillow 91.4/120: 76% focus bloodlust, moknathal_tactics(3), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:17.680 raptor_strike Fluffy_Pillow 56.4/120: 47% focus bloodlust, moknathal_tactics(3), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:18.614 raptor_strike Fluffy_Pillow 46.5/120: 39% focus bloodlust, moknathal_tactics(4), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:19.547 Waiting 0.900 sec 36.6/120: 30% focus bloodlust, moknathal_tactics(4), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:20.447 flanking_strike Fluffy_Pillow 51.1/120: 43% focus bloodlust, moknathal_tactics(4), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:21.399 mongoose_bite Fluffy_Pillow 16.4/120: 14% focus bloodlust, moknathal_tactics(4), mongoose_fury(6), blood_frenzy, potion_of_the_old_war
0:22.333 Waiting 2.300 sec 31.5/120: 26% focus bloodlust, moknathal_tactics(4), blood_frenzy, potion_of_the_old_war
0:24.633 explosive_trap Fluffy_Pillow 68.6/120: 57% focus bloodlust, moknathal_tactics(4), blood_frenzy
0:25.617 raptor_strike Fluffy_Pillow 83.5/120: 70% focus bloodlust, moknathal_tactics(4)
0:26.628 lacerate Fluffy_Pillow 73.6/120: 61% focus bloodlust, moknathal_tactics(4)
0:27.638 flanking_strike Fluffy_Pillow 53.6/120: 45% focus bloodlust, moknathal_tactics(4)
0:28.649 Waiting 1.900 sec 18.7/120: 16% focus bloodlust, moknathal_tactics(4)
0:30.549 dragonsfire_grenade Fluffy_Pillow 47.1/120: 39% focus bloodlust, moknathal_tactics(4)
0:31.509 Waiting 1.000 sec 61.4/120: 51% focus bloodlust, moknathal_tactics(4)
0:32.509 raptor_strike Fluffy_Pillow 76.3/120: 64% focus bloodlust, moknathal_tactics(4)
0:33.520 flanking_strike Fluffy_Pillow 66.4/120: 55% focus bloodlust, moknathal_tactics(4)
0:34.530 raptor_strike Fluffy_Pillow 31.4/120: 26% focus bloodlust, moknathal_tactics(4)
0:35.541 Waiting 1.000 sec 21.5/120: 18% focus bloodlust, moknathal_tactics(4)
0:36.541 lacerate Fluffy_Pillow 36.4/120: 30% focus bloodlust, moknathal_tactics(4)
0:37.639 explosive_trap Fluffy_Pillow 17.8/120: 15% focus bloodlust, moknathal_tactics(4)
0:38.393 Waiting 3.000 sec 29.0/120: 24% focus bloodlust, moknathal_tactics(4)
0:41.393 raptor_strike Fluffy_Pillow 71.1/120: 59% focus moknathal_tactics(4), blood_frenzy
0:42.606 flanking_strike Fluffy_Pillow 61.4/120: 51% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
0:43.803 Waiting 1.400 sec 26.4/120: 22% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
0:45.203 mongoose_bite Fluffy_Pillow 44.4/120: 37% focus moknathal_tactics(4), cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
0:46.320 mongoose_bite Fluffy_Pillow 59.4/120: 49% focus moknathal_tactics(4), mongoose_fury, cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
0:47.437 mongoose_bite Fluffy_Pillow 74.4/120: 62% focus moknathal_tactics(4), mongoose_fury(2), cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
0:48.555 raptor_strike Fluffy_Pillow 89.5/120: 75% focus moknathal_tactics(4), mongoose_fury(3), cleansed_sisters_blessing, mark_of_the_claw, blood_frenzy
0:49.671 explosive_trap Fluffy_Pillow 79.2/120: 66% focus moknathal_tactics(4), mongoose_fury(3), cleansed_sisters_blessing, mark_of_the_claw
0:50.631 aspect_of_the_eagle Fluffy_Pillow 91.2/120: 76% focus moknathal_tactics(4), mongoose_fury(3), cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_claw
0:50.631 lacerate Fluffy_Pillow 91.2/120: 76% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_claw
0:51.833 flanking_strike Fluffy_Pillow 71.2/120: 59% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_claw
0:53.035 raptor_strike Fluffy_Pillow 36.2/120: 30% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_ancients_blessing, cleansed_sisters_blessing
0:54.254 mongoose_bite Fluffy_Pillow 26.2/120: 22% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), cleansed_ancients_blessing, cleansed_sisters_blessing
0:55.722 fury_of_the_eagle Fluffy_Pillow 43.6/120: 36% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_ancients_blessing
0:59.441 potion Fluffy_Pillow 86.4/120: 72% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_ancients_blessing, blood_frenzy
0:59.441 raptor_strike Fluffy_Pillow 86.4/120: 72% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4), cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
1:00.652 dragonsfire_grenade Fluffy_Pillow 76.5/120: 64% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
1:01.732 explosive_trap Fluffy_Pillow 89.9/120: 75% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
1:02.709 lacerate Fluffy_Pillow 102.0/120: 85% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
1:03.920 flanking_strike Fluffy_Pillow 82.0/120: 68% focus moknathal_tactics(4), mongoose_fury(4), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
1:05.133 raptor_strike Fluffy_Pillow 47.1/120: 39% focus moknathal_tactics(4), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
1:06.345 Waiting 2.200 sec 37.1/120: 31% focus moknathal_tactics(4), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
1:08.545 flanking_strike Fluffy_Pillow 64.5/120: 54% focus moknathal_tactics(4), cleansed_wisps_blessing, blood_frenzy, potion_of_the_old_war
1:09.965 raptor_strike Fluffy_Pillow 31.4/120: 26% focus moknathal_tactics(4), potion_of_the_old_war
1:11.276 Waiting 1.200 sec 21.5/120: 18% focus moknathal_tactics(4), potion_of_the_old_war
1:12.476 lacerate Fluffy_Pillow 35.2/120: 29% focus moknathal_tactics(4), potion_of_the_old_war
1:14.022 explosive_trap Fluffy_Pillow 17.9/120: 15% focus moknathal_tactics(4), potion_of_the_old_war
1:15.167 Waiting 1.500 sec 31.1/120: 26% focus moknathal_tactics(4), potion_of_the_old_war
1:16.667 raptor_strike Fluffy_Pillow 48.3/120: 40% focus moknathal_tactics(4), potion_of_the_old_war
1:17.980 Waiting 1.100 sec 38.3/120: 32% focus moknathal_tactics(4), potion_of_the_old_war
1:19.080 flanking_strike Fluffy_Pillow 51.0/120: 42% focus moknathal_tactics(4), potion_of_the_old_war
1:20.392 Waiting 2.100 sec 16.0/120: 13% focus moknathal_tactics(4), potion_of_the_old_war
1:22.492 lacerate Fluffy_Pillow 40.1/120: 33% focus moknathal_tactics(4), potion_of_the_old_war
1:24.020 mongoose_bite Fluffy_Pillow 22.6/120: 19% focus moknathal_tactics(4), cleansed_wisps_blessing, potion_of_the_old_war
1:25.331 raptor_strike Fluffy_Pillow 37.7/120: 31% focus mongoose_fury, cleansed_wisps_blessing
1:26.643 explosive_trap Fluffy_Pillow 27.7/120: 23% focus moknathal_tactics, mongoose_fury, cleansed_wisps_blessing
1:27.699 mongoose_bite Fluffy_Pillow 40.8/120: 34% focus moknathal_tactics, mongoose_fury, cleansed_wisps_blessing, blood_frenzy
1:28.911 mongoose_bite Fluffy_Pillow 55.9/120: 47% focus moknathal_tactics, mongoose_fury(2), cleansed_wisps_blessing, blood_frenzy
1:30.122 flanking_strike Fluffy_Pillow 70.9/120: 59% focus moknathal_tactics, mongoose_fury(3), cleansed_wisps_blessing, blood_frenzy
1:31.335 dragonsfire_grenade Fluffy_Pillow 35.9/120: 30% focus moknathal_tactics, mongoose_fury(3), cleansed_wisps_blessing, blood_frenzy
1:32.311 raptor_strike Fluffy_Pillow 48.1/120: 40% focus moknathal_tactics, mongoose_fury(3), cleansed_wisps_blessing, blood_frenzy
1:33.522 lacerate Fluffy_Pillow 38.1/120: 32% focus moknathal_tactics(2), mongoose_fury(3), blood_frenzy
1:34.735 mongoose_bite Fluffy_Pillow 18.2/120: 15% focus moknathal_tactics(2), mongoose_fury(3), blood_frenzy
1:35.949 Waiting 2.500 sec 33.2/120: 28% focus moknathal_tactics(2), mongoose_fury(4), blood_frenzy
1:38.449 explosive_trap Fluffy_Pillow 64.6/120: 54% focus moknathal_tactics(2), mark_of_the_claw, blood_frenzy
1:39.593 raptor_strike Fluffy_Pillow 79.0/120: 66% focus moknathal_tactics(2), mark_of_the_claw, blood_frenzy
1:40.788 aspect_of_the_eagle Fluffy_Pillow 69.0/120: 58% focus moknathal_tactics(3), mark_of_the_claw, blood_frenzy
1:40.788 snake_hunter Fluffy_Pillow 69.0/120: 58% focus aspect_of_the_eagle, moknathal_tactics(3), mark_of_the_claw, blood_frenzy
1:40.788 mongoose_bite Fluffy_Pillow 69.0/120: 58% focus aspect_of_the_eagle, moknathal_tactics(3), mark_of_the_claw, blood_frenzy
1:41.986 mongoose_bite Fluffy_Pillow 84.1/120: 70% focus aspect_of_the_eagle, moknathal_tactics(3), mongoose_fury, mark_of_the_claw, blood_frenzy
1:43.183 mongoose_bite Fluffy_Pillow 98.2/120: 82% focus aspect_of_the_eagle, moknathal_tactics(3), mongoose_fury(2)
1:44.495 fury_of_the_eagle Fluffy_Pillow 113.3/120: 94% focus aspect_of_the_eagle, moknathal_tactics(3), mongoose_fury(3)
1:48.348 raptor_strike Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, mongoose_fury(3), blood_frenzy
1:49.561 lacerate Fluffy_Pillow 110.1/120: 92% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), blood_frenzy
1:50.773 explosive_trap Fluffy_Pillow 90.1/120: 75% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), blood_frenzy
1:51.751 mongoose_bite Fluffy_Pillow 102.2/120: 85% focus moknathal_tactics, mongoose_fury(3), blood_frenzy
1:52.961 flanking_strike Fluffy_Pillow 117.3/120: 98% focus moknathal_tactics, mongoose_fury(4), blood_frenzy
1:54.171 raptor_strike Fluffy_Pillow 82.3/120: 69% focus moknathal_tactics, mongoose_fury(4), blood_frenzy
1:55.384 raptor_strike Fluffy_Pillow 72.3/120: 60% focus moknathal_tactics(2), mongoose_fury(4), blood_frenzy
1:56.598 raptor_strike Fluffy_Pillow 62.6/120: 52% focus moknathal_tactics(3), mongoose_fury(4), mark_of_the_claw, blood_frenzy
1:57.795 flanking_strike Fluffy_Pillow 52.6/120: 44% focus moknathal_tactics(4), mongoose_fury(4), mark_of_the_claw, blood_frenzy
1:58.991 Waiting 0.500 sec 17.7/120: 15% focus moknathal_tactics(4), mongoose_fury(4), mark_of_the_claw, blood_frenzy
1:59.491 mongoose_bite Fluffy_Pillow 24.0/120: 20% focus moknathal_tactics(4), mongoose_fury(4), mark_of_the_claw, blood_frenzy
2:00.899 lacerate Fluffy_Pillow 41.6/120: 35% focus moknathal_tactics(4), mark_of_the_claw
2:02.191 dragonsfire_grenade Fluffy_Pillow 21.5/120: 18% focus moknathal_tactics(4)
2:03.333 explosive_trap Fluffy_Pillow 34.6/120: 29% focus moknathal_tactics(4)
2:04.389 raptor_strike Fluffy_Pillow 47.7/120: 40% focus moknathal_tactics(4), blood_frenzy
2:05.602 Waiting 1.000 sec 37.8/120: 31% focus moknathal_tactics(4), blood_frenzy
2:06.602 flanking_strike Fluffy_Pillow 50.2/120: 42% focus moknathal_tactics(4), blood_frenzy
2:07.815 Waiting 2.900 sec 15.4/120: 13% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
2:10.715 lacerate Fluffy_Pillow 51.9/120: 43% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
2:12.096 raptor_strike Fluffy_Pillow 34.3/120: 29% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
2:13.294 Waiting 1.800 sec 24.3/120: 20% focus moknathal_tactics(4), blood_frenzy
2:15.094 explosive_trap Fluffy_Pillow 46.6/120: 39% focus moknathal_tactics(4), blood_frenzy
2:16.310 flanking_strike Fluffy_Pillow 61.7/120: 51% focus moknathal_tactics(4), blood_frenzy
2:17.523 Waiting 1.400 sec 26.8/120: 22% focus moknathal_tactics(4), blood_frenzy
2:18.923 raptor_strike Fluffy_Pillow 44.2/120: 37% focus moknathal_tactics(4), blood_frenzy
2:20.138 Waiting 0.600 sec 34.2/120: 29% focus moknathal_tactics(4), blood_frenzy
2:20.738 lacerate Fluffy_Pillow 41.7/120: 35% focus moknathal_tactics(4), blood_frenzy
2:22.112 Waiting 2.400 sec 23.8/120: 20% focus moknathal_tactics(4), blood_frenzy
2:24.512 mongoose_bite Fluffy_Pillow 53.5/120: 45% focus moknathal_tactics(4), blood_frenzy
2:25.724 raptor_strike Fluffy_Pillow 68.6/120: 57% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
2:26.937 mongoose_bite Fluffy_Pillow 58.7/120: 49% focus moknathal_tactics(4), mongoose_fury, mark_of_the_claw, blood_frenzy
2:28.134 explosive_trap Fluffy_Pillow 73.8/120: 61% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, blood_frenzy
2:29.086 aspect_of_the_eagle Fluffy_Pillow 85.8/120: 71% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, blood_frenzy
2:29.086 mongoose_bite Fluffy_Pillow 85.8/120: 71% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, blood_frenzy
2:30.284 fury_of_the_eagle Fluffy_Pillow 100.8/120: 84% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3), mark_of_the_claw, blood_frenzy
2:33.769 dragonsfire_grenade Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, mongoose_fury(3), blood_frenzy
2:34.747 raptor_strike Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, mongoose_fury(3), blood_frenzy
2:35.958 lacerate Fluffy_Pillow 110.0/120: 92% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), blood_frenzy
2:37.170 flanking_strike Fluffy_Pillow 90.1/120: 75% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3), blood_frenzy
2:38.383 mongoose_bite Fluffy_Pillow 54.6/120: 46% focus aspect_of_the_eagle, moknathal_tactics, mongoose_fury(3)
2:39.696 raptor_strike Fluffy_Pillow 69.7/120: 58% focus moknathal_tactics, mongoose_fury(4)
2:41.007 explosive_trap Fluffy_Pillow 59.7/120: 50% focus moknathal_tactics(2), mongoose_fury(4)
2:42.150 flanking_strike Fluffy_Pillow 72.8/120: 61% focus moknathal_tactics(2), mongoose_fury(4)
2:43.657 raptor_strike Fluffy_Pillow 40.1/120: 33% focus moknathal_tactics(2)
2:44.968 Waiting 0.800 sec 30.2/120: 25% focus moknathal_tactics(3)
2:45.768 lacerate Fluffy_Pillow 39.3/120: 33% focus moknathal_tactics(3)
2:47.273 Waiting 3.100 sec 21.6/120: 18% focus moknathal_tactics(3)
2:50.373 raptor_strike Fluffy_Pillow 57.1/120: 48% focus moknathal_tactics(3)
2:51.683 Waiting 0.300 sec 47.2/120: 39% focus moknathal_tactics(4)
2:51.983 flanking_strike Fluffy_Pillow 50.6/120: 42% focus moknathal_tactics(4)
2:53.294 explosive_trap Fluffy_Pillow 15.6/120: 13% focus moknathal_tactics(4)
2:54.351 Waiting 1.400 sec 28.8/120: 24% focus moknathal_tactics(4), blood_frenzy
2:55.751 lacerate Fluffy_Pillow 46.1/120: 38% focus moknathal_tactics(4), blood_frenzy
2:57.169 raptor_strike Fluffy_Pillow 28.8/120: 24% focus moknathal_tactics(4), blood_frenzy
2:58.381 Waiting 2.600 sec 18.8/120: 16% focus moknathal_tactics(4), blood_frenzy
3:00.981 flanking_strike Fluffy_Pillow 51.1/120: 43% focus moknathal_tactics(4), blood_frenzy
3:02.194 Waiting 1.400 sec 16.1/120: 13% focus moknathal_tactics(4), blood_frenzy
3:03.594 dragonsfire_grenade Fluffy_Pillow 33.5/120: 28% focus moknathal_tactics(4), blood_frenzy
3:04.746 raptor_strike Fluffy_Pillow 47.8/120: 40% focus moknathal_tactics(4), blood_frenzy
3:05.958 explosive_trap Fluffy_Pillow 37.9/120: 32% focus moknathal_tactics(4), blood_frenzy
3:06.930 lacerate Fluffy_Pillow 50.0/120: 42% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
3:08.127 Waiting 1.500 sec 30.1/120: 25% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
3:09.627 mongoose_bite Fluffy_Pillow 48.9/120: 41% focus moknathal_tactics(4), mark_of_the_claw, blood_frenzy
3:10.823 mongoose_bite Fluffy_Pillow 64.0/120: 53% focus moknathal_tactics(4), mongoose_fury, mark_of_the_claw, blood_frenzy
3:12.021 raptor_strike Fluffy_Pillow 77.9/120: 65% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw
3:13.313 mongoose_bite Fluffy_Pillow 69.2/120: 58% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, blood_frenzy
3:14.509 snake_hunter Fluffy_Pillow 84.3/120: 70% focus moknathal_tactics(4), mongoose_fury(3), mark_of_the_claw, blood_frenzy
3:14.509 mongoose_bite Fluffy_Pillow 84.3/120: 70% focus moknathal_tactics(4), mongoose_fury(3), mark_of_the_claw, blood_frenzy
3:15.706 mongoose_bite Fluffy_Pillow 99.3/120: 83% focus moknathal_tactics(4), mongoose_fury(4), mark_of_the_claw, blood_frenzy
3:16.902 aspect_of_the_eagle Fluffy_Pillow 114.4/120: 95% focus moknathal_tactics(4), mongoose_fury(5), mark_of_the_claw, blood_frenzy
3:17.086 mongoose_bite Fluffy_Pillow 116.7/120: 97% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(5), mark_of_the_claw, blood_frenzy
3:18.283 explosive_trap Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6), mark_of_the_claw, blood_frenzy
3:19.244 raptor_strike Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6), blood_frenzy
3:20.457 fury_of_the_eagle Fluffy_Pillow 110.1/120: 92% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6), blood_frenzy
3:23.878 lacerate Fluffy_Pillow 120.0/120: 100% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6)
3:25.190 mongoose_bite Fluffy_Pillow 100.0/120: 83% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6)
3:26.500 raptor_strike Fluffy_Pillow 115.1/120: 96% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6)
3:27.812 flanking_strike Fluffy_Pillow 105.1/120: 88% focus moknathal_tactics(4), mongoose_fury(6)
3:29.123 raptor_strike Fluffy_Pillow 70.2/120: 58% focus moknathal_tactics(4)
3:30.433 explosive_trap Fluffy_Pillow 60.2/120: 50% focus moknathal_tactics(4)
3:31.578 raptor_strike Fluffy_Pillow 73.3/120: 61% focus moknathal_tactics(4)
3:32.888 flanking_strike Fluffy_Pillow 63.3/120: 53% focus moknathal_tactics(4)
3:34.354 dragonsfire_grenade Fluffy_Pillow 30.2/120: 25% focus moknathal_tactics(4)
3:35.498 lacerate Fluffy_Pillow 43.3/120: 36% focus moknathal_tactics(4)
3:36.810 Waiting 1.600 sec 23.6/120: 20% focus moknathal_tactics(4), blood_frenzy
3:38.410 raptor_strike Fluffy_Pillow 43.4/120: 36% focus moknathal_tactics(4), blood_frenzy
3:39.620 Waiting 1.400 sec 33.4/120: 28% focus moknathal_tactics(4), blood_frenzy
3:41.020 flanking_strike Fluffy_Pillow 50.8/120: 42% focus moknathal_tactics(4), blood_frenzy
3:42.232 explosive_trap Fluffy_Pillow 16.9/120: 14% focus moknathal_tactics(4), cleansed_sisters_blessing, blood_frenzy
3:43.285 Waiting 2.000 sec 30.9/120: 26% focus moknathal_tactics(4), cleansed_sisters_blessing, blood_frenzy
3:45.285 raptor_strike Fluffy_Pillow 57.5/120: 48% focus moknathal_tactics(4), cleansed_sisters_blessing, blood_frenzy
3:46.417 lacerate Fluffy_Pillow 47.6/120: 40% focus moknathal_tactics(4), cleansed_sisters_blessing, blood_frenzy
3:47.547 Waiting 0.500 sec 26.7/120: 22% focus moknathal_tactics(4), cleansed_sisters_blessing
3:48.047 mongoose_bite Fluffy_Pillow 32.8/120: 27% focus moknathal_tactics(4), cleansed_sisters_blessing
3:49.266 mongoose_bite Fluffy_Pillow 47.9/120: 40% focus moknathal_tactics(4), mongoose_fury, cleansed_sisters_blessing
3:50.485 mongoose_bite Fluffy_Pillow 63.0/120: 52% focus moknathal_tactics(4), mongoose_fury(2), cleansed_sisters_blessing
3:51.705 raptor_strike Fluffy_Pillow 77.7/120: 65% focus moknathal_tactics(4), mongoose_fury(3), mark_of_the_claw
3:52.998 flanking_strike Fluffy_Pillow 67.7/120: 56% focus moknathal_tactics(4), mongoose_fury(3), mark_of_the_claw
3:54.291 explosive_trap Fluffy_Pillow 32.8/120: 27% focus moknathal_tactics(4), mongoose_fury(3), mark_of_the_claw
3:55.544 raptor_strike Fluffy_Pillow 47.3/120: 39% focus moknathal_tactics(4), mongoose_fury(3), mark_of_the_claw
3:56.835 lacerate Fluffy_Pillow 37.3/120: 31% focus moknathal_tactics(4), mongoose_fury(3)
3:58.146 mongoose_bite Fluffy_Pillow 17.3/120: 14% focus moknathal_tactics(4), mongoose_fury(3)
3:59.498 Waiting 2.800 sec 32.9/120: 27% focus moknathal_tactics(4), mongoose_fury(4), cleansed_ancients_blessing, mark_of_the_claw
4:02.298 raptor_strike Fluffy_Pillow 65.4/120: 55% focus moknathal_tactics(4), cleansed_ancients_blessing, mark_of_the_claw
4:03.591 flanking_strike Fluffy_Pillow 55.5/120: 46% focus moknathal_tactics(4), cleansed_ancients_blessing, mark_of_the_claw
4:04.884 dragonsfire_grenade Fluffy_Pillow 20.5/120: 17% focus moknathal_tactics(4), cleansed_ancients_blessing, mark_of_the_claw
4:06.003 aspect_of_the_eagle Fluffy_Pillow 33.5/120: 28% focus moknathal_tactics(4), cleansed_ancients_blessing
4:06.003 Waiting 0.200 sec 33.5/120: 28% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_ancients_blessing
4:06.203 explosive_trap Fluffy_Pillow 35.8/120: 30% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_ancients_blessing
4:07.575 lacerate Fluffy_Pillow 51.5/120: 43% focus aspect_of_the_eagle, moknathal_tactics(4), cleansed_ancients_blessing
4:08.886 mongoose_bite Fluffy_Pillow 31.5/120: 26% focus aspect_of_the_eagle, moknathal_tactics(4)
4:10.197 raptor_strike Fluffy_Pillow 46.6/120: 39% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury
4:11.508 fury_of_the_eagle Fluffy_Pillow 37.9/120: 32% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, blood_frenzy
4:14.994 flanking_strike Fluffy_Pillow 81.1/120: 68% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury, blood_frenzy
4:16.206 raptor_strike Fluffy_Pillow 46.2/120: 38% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
4:17.418 lacerate Fluffy_Pillow 36.2/120: 30% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
4:18.787 explosive_trap Fluffy_Pillow 18.2/120: 15% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
4:19.764 mongoose_bite Fluffy_Pillow 30.3/120: 25% focus moknathal_tactics(4), mongoose_fury, blood_frenzy
4:20.975 Waiting 2.100 sec 44.7/120: 37% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw
4:23.075 raptor_strike Fluffy_Pillow 71.0/120: 59% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, blood_frenzy
4:24.272 flanking_strike Fluffy_Pillow 61.1/120: 51% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, blood_frenzy
4:25.468 Waiting 1.600 sec 26.2/120: 22% focus moknathal_tactics(4), mongoose_fury(2), mark_of_the_claw, blood_frenzy
4:27.068 mongoose_bite Fluffy_Pillow 46.2/120: 39% focus moknathal_tactics(4), mongoose_fury(2), blood_frenzy
4:28.280 lacerate Fluffy_Pillow 61.3/120: 51% focus moknathal_tactics(4), blood_frenzy
4:29.492 Waiting 0.400 sec 41.3/120: 34% focus moknathal_tactics(4), blood_frenzy
4:29.892 raptor_strike Fluffy_Pillow 46.3/120: 39% focus moknathal_tactics(4), blood_frenzy
4:31.103 explosive_trap Fluffy_Pillow 36.3/120: 30% focus moknathal_tactics(4), blood_frenzy
4:32.082 Waiting 0.200 sec 48.5/120: 40% focus moknathal_tactics(4), blood_frenzy
4:32.282 flanking_strike Fluffy_Pillow 51.0/120: 42% focus moknathal_tactics(4), blood_frenzy
4:33.495 Waiting 1.200 sec 16.0/120: 13% focus moknathal_tactics(4), blood_frenzy
4:34.695 dragonsfire_grenade Fluffy_Pillow 30.9/120: 26% focus moknathal_tactics(4), blood_frenzy
4:35.861 Waiting 0.900 sec 45.4/120: 38% focus moknathal_tactics(4), blood_frenzy
4:36.761 raptor_strike Fluffy_Pillow 56.6/120: 47% focus moknathal_tactics(4)
4:38.074 lacerate Fluffy_Pillow 46.6/120: 39% focus moknathal_tactics(4)
4:39.591 Waiting 1.900 sec 29.0/120: 24% focus moknathal_tactics(4)
4:41.491 flanking_strike Fluffy_Pillow 50.8/120: 42% focus moknathal_tactics(4)
4:42.803 Waiting 0.100 sec 15.9/120: 13% focus moknathal_tactics(4)
4:42.903 explosive_trap Fluffy_Pillow 17.0/120: 14% focus moknathal_tactics(4)
4:44.247 raptor_strike Fluffy_Pillow 32.4/120: 27% focus moknathal_tactics(4)
4:45.559 Waiting 1.800 sec 22.5/120: 19% focus moknathal_tactics(4)
4:47.359 mongoose_bite Fluffy_Pillow 43.1/120: 36% focus moknathal_tactics(4)
4:48.671 mongoose_bite Fluffy_Pillow 58.2/120: 48% focus moknathal_tactics(4), mongoose_fury
4:49.982 mongoose_bite Fluffy_Pillow 73.2/120: 61% focus moknathal_tactics(4), mongoose_fury(2)
4:51.292 raptor_strike Fluffy_Pillow 88.2/120: 74% focus moknathal_tactics(4), mongoose_fury(3)
4:52.603 lacerate Fluffy_Pillow 78.3/120: 65% focus moknathal_tactics(4), mongoose_fury(3)
4:53.916 aspect_of_the_eagle Fluffy_Pillow 58.3/120: 49% focus moknathal_tactics(4), mongoose_fury(3)
4:54.003 snake_hunter Fluffy_Pillow 59.3/120: 49% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3)
4:54.003 mongoose_bite Fluffy_Pillow 59.3/120: 49% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(3)
4:55.313 explosive_trap Fluffy_Pillow 74.3/120: 62% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4)
4:56.455 mongoose_bite Fluffy_Pillow 87.4/120: 73% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(4)
4:57.768 mongoose_bite Fluffy_Pillow 102.9/120: 86% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(5), blood_frenzy
4:58.980 raptor_strike Fluffy_Pillow 118.0/120: 98% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6), blood_frenzy
5:00.194 fury_of_the_eagle Fluffy_Pillow 108.1/120: 90% focus aspect_of_the_eagle, moknathal_tactics(4), mongoose_fury(6), blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6231 6231 0
Agility 27896 26531 16240 (11258)
Stamina 41883 41883 25958
Intellect 6005 6005 0
Spirit 2 2 0
Health 2512980 2512980 0
Focus 120 120 0
Crit 44.15% 44.15% 10204
Haste 14.69% 14.69% 4775
Damage / Heal Versatility 4.28% 4.28% 1710
Attack Power 27896 26531 0
Mastery 9.25% 8.18% 2923
Armor 2758 2758 2758
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_claw
Local Shoulders Matted Fur Pauldrons
ilevel: 880, stats: { 341 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist Laughing Sister's Pouch-Chain
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 AgiInt, +783 Crit, +312 Haste }
Local Legs Disjointed Linkage Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +886 Haste, +574 Crit }
Local Feet Malignant Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +783 Crit, +312 Haste }
Local Wrists Call of the Wild
ilevel: 880, stats: { 199 Armor, +1448 Sta, +965 Agi, +469 Crit, +352 Haste }
Local Hands Gauntlets of Malevolent Intent
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +665 Haste, +430 Vers }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Agi }
Local Main Hand Talonclaw
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Agi, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Animal Instincts (Survival Hunter) Throwing Axes (Survival Hunter) Way of the Mok'Nathal (Survival Hunter)
30 A Murder of Crows (Survival Hunter) Mortal Wounds (Survival Hunter) Snake Hunter (Survival Hunter)
45 Posthaste Farstrider Trailblazer
60 Caltrops (Survival Hunter) Improved Traps (Survival Hunter) Steel Trap (Survival Hunter)
75 Sticky Bomb (Survival Hunter) Ranger's Net (Survival Hunter) Camouflage (Survival Hunter)
90 Butchery (Survival Hunter) Dragonsfire Grenade (Survival Hunter) Serpent Sting (Survival Hunter)
100 Spitting Cobra (Survival Hunter) Expert Trapper (Survival Hunter) Aspect of the Beast

Profile

hunter="Hunter_SV_T19M"
level=110
race=pandaren
role=attack
position=ranged_back
talents=3302022
artifact=34:0:0:0:0:1068:1:1070:3:1071:3:1072:3:1073:3:1074:3:1075:3:1076:3:1077:3:1078:3:1079:1:1080:1:1081:1:1082:1:1083:1:1084:1:1338:1
spec=survival

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=potion_of_the_old_war
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/harpoon

# Executed every time the actor is available.
actions=auto_attack
actions+=/arcane_torrent,if=focus.deficit>=30
actions+=/blood_fury
actions+=/berserking
actions+=/potion,name=old_war
actions+=/steel_trap
actions+=/explosive_trap
actions+=/dragonsfire_grenade
actions+=/caltrops
actions+=/carve,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies>=3&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)
actions+=/raptor_strike,cycle_targets=1,if=talent.serpent_sting.enabled&active_enemies<=2&(!dot.serpent_sting.ticking|dot.serpent_sting.remains<=gcd.max)|talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains<gcd.max|buff.moknathal_tactics.down)
actions+=/aspect_of_the_eagle
actions+=/fury_of_the_eagle,if=buff.mongoose_fury.up&(buff.mongoose_fury.stack=6|action.mongoose_bite.charges=0&cooldown.snake_hunter.remains|buff.mongoose_fury.remains<=gcd.max*2)
actions+=/mongoose_bite,if=buff.aspect_of_the_eagle.up&(charges>=2|charges>=1&cooldown.mongoose_bite.remains<=2)|(buff.mongoose_fury.up|cooldown.fury_of_the_eagle.remains<5|charges=3)
actions+=/a_murder_of_crows
actions+=/lacerate,if=dot.lacerate.ticking&dot.lacerate.remains<=3|target.time_to_die>=5
actions+=/snake_hunter,if=action.mongoose_bite.charges<=1&buff.mongoose_fury.remains>gcd.max*4|action.mongoose_bite.charges=0&buff.aspect_of_the_eagle.up
actions+=/flanking_strike,if=talent.way_of_the_moknathal.enabled&(buff.moknathal_tactics.remains>=3)|!talent.way_of_the_moknathal.enabled
actions+=/butchery,if=spell_targets.butchery>=2
actions+=/carve,if=spell_targets.carve>=4
actions+=/spitting_cobra
actions+=/throwing_axes
actions+=/raptor_strike,if=!talent.throwing_axes.enabled&focus>75-cooldown.flanking_strike.remains*focus.regen

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_claw
shoulders=matted_fur_pauldrons,id=139217,bonus_id=1806
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=200agi
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=call_of_the_wild,id=137101,bonus_id=1806
hands=gauntlets_of_malevolent_intent,id=139213,bonus_id=1806
waist=laughing_sisters_pouchchain,id=139211,bonus_id=1806
legs=disjointed_linkage_leggings,id=139216,bonus_id=1806
feet=malignant_sabatons,id=138211,bonus_id=1806
finger1=grubby_silver_ring,id=139236,bonus_id=1806,enchant=200vers
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=200vers
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=natures_call,id=139334,bonus_id=1806
main_hand=talonclaw,id=128808,gem_id=139262/139257/139255,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=881.73
# gear_agility=16240
# gear_stamina=25958
# gear_crit_rating=10204
# gear_haste_rating=4775
# gear_mastery_rating=2923
# gear_versatility_rating=1710
# gear_armor=2758
summon_pet=cat

Mage_Arcane_T19M : 440990 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
440990.2 440990.2 403.5 / 0.092% 68797.2 / 15.6% 8.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
48068.8 48068.8 Mana 0.03% 44.3 100.0% 100%
Talents
  • 15: Arcane Familiar (Arcane Mage)
  • 45: Rune of Power
  • 60: Supernova (Arcane Mage)
  • 90: Nether Tempest (Arcane Mage)
  • 100: Quickening (Arcane Mage)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mage_Arcane_T19M 440990
Aegwynn's Ascendance 3821 0.9% 3.3 98.54sec 345041 0 Direct 3.3 345043 0 345043 0.0%  

Stats details: aegwynns_ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.32 3.32 0.00 0.00 0.0000 0.0000 1145688.02 1145688.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.32 100.00% 345043.25 98031 375619 345320.15 259079 369319 1145688 1145688 0.00
 
 

Action details: aegwynns_ascendance

Static Values
  • id:187677
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187677
  • name:Aegwynn's Ascendance
  • school:arcane
  • tooltip:
  • description:An emanation of mana-fueled Arcane damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:346884.88
  • base_dd_max:346884.88
 
Arcane Barrage 10842 2.5% 9.8 27.16sec 333445 332551 Direct 9.7 262351 525301 335068 27.7%  

Stats details: arcane_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.79 9.74 0.00 0.00 1.0028 0.0000 3262992.01 3262992.01 0.00 332551.16 332551.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.04 72.34% 262350.63 250308 488100 262478.63 250308 372333 1848190 1848190 0.00
crit 2.69 27.66% 525300.95 500616 976201 500817.22 0 976201 1414802 1414802 0.00
 
 

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:5500.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:mana.pct<100&cooldown.arcane_power.remains>5
Spelldata
  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=1 + 130.0%} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge$?a231564[ Hits {$36032s3=0} additional $Ltarget:targets; within {$s3=10} yds per Arcane Charge for {$s2=50}% damage.][] |cFFFFFFFFConsumes all Arcane Charges.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Arcane Blast 154962 35.2% 96.4 3.11sec 482179 308850 Direct 97.4 374075 750611 477232 27.4%  

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.42 97.42 0.00 0.00 1.5612 0.0000 46492168.84 46492168.84 0.00 308850.34 308850.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.73 72.60% 374075.00 89411 696106 374304.54 316156 443771 26459089 26459089 0.00
crit 26.69 27.40% 750610.91 178821 1392213 751076.62 474871 1051783 20033080 20033080 0.00
 
 

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 192.4%} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Mana cost increased by {$36032s2=125}% per Arcane Charge. |cFFFFFFFFGenerates 1 Arcane Charge|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.924000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Arcane Explosion 2230 0.5% 2.6 68.13sec 261263 238371 Direct 2.6 205332 409031 261256 27.5%  

Stats details: arcane_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.56 2.56 0.00 0.00 1.0963 0.0000 668155.15 668155.15 0.00 238371.44 238371.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.86 72.55% 205331.70 144410 281600 181658.67 0 281600 380961 380961 0.00
crit 0.70 27.45% 409030.53 288821 563201 212370.31 0 563201 287194 287194 0.00
 
 

Action details: arcane_explosion

Static Values
  • id:1449
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1
Spelldata
  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s1=1 + 75.0%} Arcane damage to all enemies within $A1 yards. Damage increased by {$36032s1=60}% per Arcane Charge. Mana cost increased by {$36032s2=125}% per Arcane Charge. |cFFFFFFFFGenerates 1 Arcane Charge if any targets are hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Arcane Missiles 120984 27.5% 46.0 6.32sec 790269 501634 Periodic 274.7 103800 207614 132275 27.4% 20.3%

Stats details: arcane_missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.97 0.00 275.43 274.65 1.5754 0.2211 36329834.65 36329834.65 0.00 501633.94 501633.94
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.3 72.57% 103799.75 51393 160287 103860.21 91058 118368 20689198 20689198 0.00
crit 75.3 27.43% 207614.45 102787 320575 207727.90 177330 243073 15640637 15640637 0.00
 
 

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.arcane_missiles.react=3
Spelldata
  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing a total of ${5*{$7268s1=1 + 44.3%}} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Each damaging spell cast has a {$79684s1=15}% chance to activate Arcane Missiles. Chance doubled for Arcane Blast. Limit {$79683s1=3} charges. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2 seconds}, causing a total of ${5*{$7268s1=1 + 44.3%}} Arcane damage. Damage increased by {$36032s1=60}% per Arcane Charge. Each damaging spell cast has a {$79684s1=15}% chance to activate Arcane Missiles. Chance doubled for Arcane Blast. Limit {$79683s1=3} charges. |cFFFFFFFFGenerates 1 Arcane Charge.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.443000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 21524 4.8% 39.4 5.94sec 161601 0 Direct 39.4 126715 253644 161604 27.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.38 39.38 0.00 0.00 0.0000 0.0000 6363128.51 6363128.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.55 72.52% 126714.53 84248 164284 126662.75 105872 144753 3618134 3618134 0.00
crit 10.82 27.48% 253643.78 168496 328567 253573.28 176921 328567 2744995 2744995 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of Aluneth 9832 2.2% 5.2 62.26sec 562821 402126 Periodic 31.0 74453 148771 94795 27.4% 10.3%

Stats details: mark_of_aluneth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.22 0.00 31.01 31.01 1.3997 1.0000 2939142.28 2939142.28 0.00 76709.96 402126.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.5 72.63% 74452.98 52609 102588 74874.89 59764 88684 1676692 1676692 0.00
crit 8.5 27.37% 148771.45 105218 205175 149600.07 105218 205175 1262450 1262450 0.00
 
 

Action details: mark_of_aluneth

Static Values
  • id:224968
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.arcane_power.remains>20
Spelldata
  • id:224968
  • name:Mark of Aluneth
  • school:arcane
  • tooltip:Deals continuous Arcane damage, and then detonates for massive damage to nearby enemies.
  • description:Creates a rune around the target, inflicting ${{$211088s1=0 + 120.0%}*6} Arcane damage over {$d=6 seconds}, and then detonating for Arcane damage equal to {$s1=15}% of your maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.200000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mark of Aluneth (_explosion) 9093 2.1% 5.2 62.19sec 519872 0 Direct 5.2 407246 818892 519902 27.4%  

Stats details: mark_of_aluneth_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.22 5.22 0.00 0.00 0.0000 0.0000 2714857.81 2714857.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.79 72.64% 407245.78 262874 512604 408792.78 0 512604 1544818 1544818 0.00
crit 1.43 27.36% 818891.54 525748 1025208 663996.81 0 1025208 1170040 1170040 0.00
 
 

Action details: mark_of_aluneth_explosion

Static Values
  • id:210726
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210726
  • name:Mark of Aluneth
  • school:physical
  • tooltip:
  • description:Creates a runic prison at the target's location, slowing enemy movement speed by ${{$211056s1=70}/-1}%, inflicting ${{$211088s1=0 + 120.0%}*6} Arcane damage over {$d=6 seconds}, and then detonating for Arcane damage equal to {$s1=15}% of your maximum mana.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:235274.82
  • base_dd_max:235274.82
 
Mark of the Hidden Satyr 10447 2.4% 21.2 14.06sec 147800 0 Direct 21.2 116090 231436 147803 27.5%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.22 21.22 0.00 0.00 0.0000 0.0000 3135968.54 3135968.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.38 72.51% 116089.81 94426 184131 116119.98 94426 147934 1785907 1785907 0.00
crit 5.83 27.49% 231435.56 188852 368262 231223.02 0 368262 1350062 1350062 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Nether Tempest 21277 (42558) 4.8% (9.7%) 25.8 11.62sec 494988 484254 Periodic 421.9 11874 23751 15139 27.5% 94.1%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.81 0.00 421.89 421.89 1.0222 0.6708 6387047.41 6387047.41 0.00 41297.24 484254.44
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 305.9 72.51% 11873.79 12 18781 11878.42 11377 12465 3632133 3632133 0.00
crit 116.0 27.49% 23751.04 24 37563 23761.85 21984 26113 2754914 2754914 0.00
 
 

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:16500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.nether_tempest.remains<=2|!ticking
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals $w1 Arcane damage and an additional $w1 Arcane damage to all enemies within $114954A1 yards every $t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over {$114923d=12 seconds} to the target and ${$114954m1*12/$t1} to all enemies within 10 yards. Limit 1 target. Damage increased by {$36032s1=60}% per Arcane Charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.055000
  • base_td:1.00
  • dot_duration:12.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Nether Tempest (_aoe) 21281 4.8% 421.9 0.70sec 15144 0 Periodic 420.0 11939 23870 15210 27.4% 0.0%

Stats details: nether_tempest_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 421.88 0.00 0.00 420.05 0.0000 0.0000 6389037.51 6389037.51 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 304.9 72.58% 11939.24 9632 18781 11944.12 11462 12422 3640085 3640085 0.00
crit 115.2 27.42% 23870.09 19263 37563 23879.45 22049 26268 2748952 2748952 0.00
 
 

Action details: nether_tempest_aoe

Static Values
  • id:114954
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:1.2500
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114954
  • name:Nether Tempest
  • school:arcane
  • tooltip:
  • description:{$@spelldesc114923=Places a Nether Tempest on the target which deals $114923o1 Arcane damage over {$114923d=12 seconds} to the target and ${$114954m1*12/$t1} to all enemies within 10 yards. Limit 1 target. Damage increased by {$36032s1=60}% per Arcane Charge.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.055000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Plague Swarm 16929 3.8% 16.9 17.60sec 300387 0 Periodic 72.0 55414 110853 70652 27.5% 46.9%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.93 0.00 71.96 71.96 0.0000 1.9598 5084219.63 5084219.63 0.00 36051.39 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.2 72.51% 55414.31 23 90679 55449.49 46605 67495 2891667 2891667 0.00
crit 19.8 27.49% 110853.29 70 181359 110956.55 83425 144580 2192553 2192553 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Supernova 7620 1.7% 9.4 31.06sec 242829 239598 Direct 9.4 190591 381492 242830 27.4%  

Stats details: supernova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.44 9.44 0.00 0.00 1.0135 0.0000 2293193.65 2293193.65 0.00 239598.12 239598.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.86 72.63% 190590.96 166597 324865 190466.80 166597 279051 1307297 1307297 0.00
crit 2.58 27.37% 381491.89 333195 649730 360278.27 0 649730 985897 985897 0.00
 
 

Action details: supernova

Static Values
  • id:157980
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:mana.pct<100
Spelldata
  • id:157980
  • name:Supernova
  • school:arcane
  • tooltip:
  • description:Pulses arcane energy around the target enemy or ally, dealing {$s2=1 + 190.0%} Arcane damage to all enemies within $A2 yards, and knocking them upward. A primary enemy target will take {$s1=100}% increased damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.900000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 7354 1.7% 12.6 23.06sec 174689 0 Direct 86.8 19971 39915 25430 27.4%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.64 86.82 0.00 0.00 0.0000 0.0000 2207785.79 2207785.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.05 72.63% 19970.78 16335 31853 19975.87 16335 25697 1259212 1259212 0.00
crit 23.76 27.37% 39915.27 32670 63706 39934.82 32670 54048 948574 948574 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Touch of the Magi 12227 2.8% 8.3 33.93sec 440082 0 Direct 8.3 440520 0 440520 0.0%  

Stats details: touch_of_the_magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 8.31 0.00 0.00 0.0000 0.0000 3660912.76 3660912.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.31 100.00% 440520.22 1926 2296180 442962.76 0 1031094 3660913 3660913 0.00
 
 

Action details: touch_of_the_magi

Static Values
  • id:210833
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating {$s1=20}% of the damage you deal to the target for {$210824d=6 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:473811.31
  • base_dd_max:473811.31
 
pet - arcane_familiar 10567 / 10567
Arcane Assault 10567 2.4% 148.2 2.04sec 21405 0 Direct 147.6 16868 33750 21493 27.4%  

Stats details: arcane_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.22 147.61 0.00 0.00 0.0000 0.0000 3172696.56 3172696.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.17 72.60% 16867.63 14614 21920 16870.62 16108 17687 1807631 1807631 0.00
crit 40.45 27.40% 33750.05 29227 43841 33754.68 30556 37823 1365065 1365065 0.00
 
 

Action details: arcane_assault

Static Values
  • id:205235
  • school:arcane
  • resource:none
  • range:45.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:3.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205235
  • name:Arcane Assault
  • school:arcane
  • tooltip:
  • description:{$@spelldesc225119=Launches bolts of arcane energy at the enemy target, causing {$s1=1 + 35.0%} Arcane damage. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.350000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Mage_Arcane_T19M
Arcane Power 3.6 93.16sec

Stats details: arcane_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.61 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. Mana costs of your damaging spells reduced by $w2%.
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage and your spells cost {$s2=30}% less mana.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Arcane_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.27sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Evocation 3.3 98.10sec

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.32 0.00 13.20 0.00 3.7254 0.8739 0.00 0.00 0.00 0.00 0.00
 
 

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana every $t1 sec.
  • description:Returns ${4*$m1}% of your total mana over {$d=6 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Arcane_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Arcane_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.7 35.31sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.73 0.00 0.00 0.00 1.0132 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct>45&buff.arcane_power.down
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 
(summon_) Arcane Familiar 1.0 0.00sec

Stats details: summon_arcane_familiar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_arcane_familiar

Static Values
  • id:205022
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205022
  • name:Arcane Familiar
  • school:arcane
  • tooltip:
  • description:Summon a Familiar that attacks your enemies and increases your maximum mana by {$210126s1=10}%. Lasts {$d=3600 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcane Charge 10.7 135.3 28.3sec 2.1sec 90.73% 89.34% 103.6(103.6) 0.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_charge_1:6.55%
  • arcane_charge_2:6.26%
  • arcane_charge_3:6.12%
  • arcane_charge_4:71.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Missiles! 26.6 21.3 11.3sec 6.3sec 47.34% 47.34% 0.9(0.9) 0.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_arcane_missiles
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_missiles_1:32.24%
  • arcane_missiles_2:12.83%
  • arcane_missiles_3:2.27%

Trigger Attempt Success

  • trigger_pct:33.09%

Spelldata details

  • id:79683
  • name:Arcane Missiles!
  • tooltip:Arcane Missiles activated.
  • description:Your offensive spells have a chance to activate Arcane Missiles. This effect can accumulate up to {$79683s1=3} charges and lasts {$79683d=20 seconds}.
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 93.2sec 93.2sec 15.40% 100.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • duration:13.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • arcane_power_1:15.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. Mana costs of your damaging spells reduced by $w2%.
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage and your spells cost {$s2=30}% less mana.
  • max_stacks:0
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 10.96% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 17.56% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Potion of Deadly Grace 2.0 0.0 194.9sec 0.0sec 19.62% 19.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Quickening 11.3 134.7 26.9sec 2.1sec 90.45% 90.45% 0.0(0.0) 0.6

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_quickening
  • max_stacks:50
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • quickening_1:6.99%
  • quickening_2:6.72%
  • quickening_3:6.35%
  • quickening_4:5.96%
  • quickening_5:8.61%
  • quickening_6:7.67%
  • quickening_7:5.76%
  • quickening_8:4.07%
  • quickening_9:3.66%
  • quickening_10:3.13%
  • quickening_11:2.75%
  • quickening_12:2.63%
  • quickening_13:2.47%
  • quickening_14:2.39%
  • quickening_15:2.45%
  • quickening_16:2.29%
  • quickening_17:2.11%
  • quickening_18:2.04%
  • quickening_19:1.99%
  • quickening_20:2.00%
  • quickening_21:1.74%
  • quickening_22:1.61%
  • quickening_23:1.18%
  • quickening_24:0.91%
  • quickening_25:0.69%
  • quickening_26:0.50%
  • quickening_27:0.38%
  • quickening_28:0.29%
  • quickening_29:0.23%
  • quickening_30:0.19%
  • quickening_31:0.14%
  • quickening_32:0.12%
  • quickening_33:0.10%
  • quickening_34:0.10%
  • quickening_35:0.09%
  • quickening_36:0.07%
  • quickening_37:0.06%
  • quickening_38:0.04%
  • quickening_39:0.02%
  • quickening_40:0.02%
  • quickening_41:0.01%
  • quickening_42:0.00%
  • quickening_43:0.00%
  • quickening_44:0.00%
  • quickening_45:0.00%
  • quickening_46:0.00%
  • quickening_47:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198924
  • name:Quickening
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc198923=Arcane Blast, Arcane Missiles, and Arcane Explosion also grant {$198924s1=2}% Haste for {$198924d=6 seconds}, stacking up to {$198924u=50} times. This effect is cleared when you cast Arcane Barrage.}
  • max_stacks:50
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Rune of Power 8.7 0.0 35.3sec 35.3sec 28.67% 28.67% 0.0(0.0) 8.5

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Mage Armor

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_mage_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:1250.00

Stack Uptimes

  • mage_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:6117
  • name:Mage Armor
  • tooltip:Mastery increased by $6117w1. Duration of all harmful Magic effects reduced by $w2%.
  • description:Increases your Mastery by {$6117s1=1250}. The duration of all harmful Magic effects used against you is reduced by {$s2=25}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Arcane_T19M
arcane_barrage Mana 9.8 53568.6 5474.1 5474.2 60.9
arcane_blast Mana 97.4 13668643.0 140304.1 141760.0 3.4
arcane_explosion Mana 2.6 322051.1 125942.6 125928.7 2.1
nether_tempest Mana 25.8 407709.9 15796.1 15796.0 31.3
Resource Gains Type Count Total Average Overflow
arcane_blast None 97.42 0.00 (0.00%) 0.00 97.42 100.00%
arcane_explosion None 2.56 0.00 (0.00%) 0.00 2.56 100.00%
evocation Mana 13.20 4582667.45 (34.41%) 347253.14 592165.78 11.44%
mp5_regen Mana 1150.38 6281060.64 (47.16%) 5459.98 149301.69 2.32%
Mystic Kilt of the Rune Master Mana 9.79 2455866.38 (18.44%) 250959.81 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 44303.62 48068.75
Combat End Resource Mean Min Max
Mana 384752.86 18207.96 1378784.00

Benefits & Uptimes

Benefits %
Arcane Barrage Arcane Charge 4 100.0%
Arcane Blast Arcane Charge 0 10.7%
Arcane Blast Arcane Charge 1 10.6%
Arcane Blast Arcane Charge 2 10.5%
Arcane Blast Arcane Charge 3 10.1%
Arcane Blast Arcane Charge 4 58.1%
Arcane Missiles Arcane Charge 2 0.0%
Arcane Missiles Arcane Charge 3 0.7%
Arcane Missiles Arcane Charge 4 99.3%
Nether Tempest Arcane Charge 0 8.3%
Nether Tempest Arcane Charge 1 5.4%
Nether Tempest Arcane Charge 2 4.5%
Nether Tempest Arcane Charge 3 3.7%
Nether Tempest Arcane Charge 4 78.1%
Arcane Missiles! from Arcane Blast 81.5%
Arcane Missiles! from Arcane Explosion 1.0%
Arcane Missiles! from Nether Tempest 9.5%
Arcane Missiles! from Supernova 3.9%
Arcane Missiles! from Arcane Barrage 4.0%
Uptimes %
Mana Cap 1.7%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Mage_Arcane_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Mage_Arcane_T19M Damage Per Second
Count 7499
Mean 440990.24
Minimum 381602.58
Maximum 524182.84
Spread ( max - min ) 142580.27
Range [ ( max - min ) / 2 * 100% ] 16.17%
Standard Deviation 17828.7176
5th Percentile 412996.78
95th Percentile 472133.37
( 95th Percentile - 5th Percentile ) 59136.59
Mean Distribution
Standard Deviation 205.8820
95.00% Confidence Intervall ( 440586.72 - 441393.77 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6278
0.1 Scale Factor Error with Delta=300 2713462
0.05 Scale Factor Error with Delta=300 10853851
0.01 Scale Factor Error with Delta=300 271346285
Priority Target DPS
Sample Data Mage_Arcane_T19M Priority Target Damage Per Second
Count 7499
Mean 440990.24
Minimum 381602.58
Maximum 524182.84
Spread ( max - min ) 142580.27
Range [ ( max - min ) / 2 * 100% ] 16.17%
Standard Deviation 17828.7176
5th Percentile 412996.78
95th Percentile 472133.37
( 95th Percentile - 5th Percentile ) 59136.59
Mean Distribution
Standard Deviation 205.8820
95.00% Confidence Intervall ( 440586.72 - 441393.77 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6278
0.1 Scale Factor Error with Delta=300 2713462
0.05 Scale Factor Error with Delta=300 10853851
0.01 Scale Factor Error with Delta=300 271346285
DPS(e)
Sample Data Mage_Arcane_T19M Damage Per Second (Effective)
Count 7499
Mean 440990.24
Minimum 381602.58
Maximum 524182.84
Spread ( max - min ) 142580.27
Range [ ( max - min ) / 2 * 100% ] 16.17%
Damage
Sample Data Mage_Arcane_T19M Damage
Count 7499
Mean 129074132.54
Minimum 96494731.88
Maximum 167558744.58
Spread ( max - min ) 71064012.70
Range [ ( max - min ) / 2 * 100% ] 27.53%
DTPS
Sample Data Mage_Arcane_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mage_Arcane_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mage_Arcane_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mage_Arcane_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mage_Arcane_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mage_Arcane_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Mage_Arcane_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mage_Arcane_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 summon_arcane_familiar
4 0.00 snapshot_stats
5 0.00 mirror_image
6 0.00 potion,name=deadly_grace
7 0.00 arcane_blast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.arcane_power.down
8 3.28 stop_burn_phase,if=prev_gcd.evocation&burn_phase_duration>gcd.max
9 3.24 mark_of_aluneth,if=cooldown.arcane_power.remains>20
A 0.00 call_action_list,name=build,if=buff.arcane_charge.stack<4
B 0.00 call_action_list,name=init_burn,if=buff.arcane_power.down&buff.arcane_charge.stack=4&(cooldown.mark_of_aluneth.remains=0|cooldown.mark_of_aluneth.remains>20)&(!talent.rune_of_power.enabled|(cooldown.arcane_power.remains<=action.rune_of_power.cast_time|action.rune_of_power.recharge_time<cooldown.arcane_power.remains))|target.time_to_die<45
C 0.00 call_action_list,name=burn,if=burn_phase
D 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&!burn_phase
E 0.00 call_action_list,name=conserve
actions.build
# count action,conditions
0.00 charged_up,if=buff.arcane_charge.stack<=1
F 0.33 arcane_missiles,if=buff.arcane_missiles.react=3
0.00 arcane_orb
0.00 arcane_explosion,if=active_enemies>1
G 41.27 arcane_blast
actions.burn
# count action,conditions
H 0.00 call_action_list,name=cooldowns
I 1.56 arcane_missiles,if=buff.arcane_missiles.react=3
J 1.12 arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
0.00 presence_of_mind,if=buff.arcane_power.remains>2*gcd
K 6.33 nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
L 1.69 arcane_blast,if=active_enemies<=1&mana.pct%10*execute_time>target.time_to_die
0.00 arcane_explosion,if=active_enemies>1&mana.pct%10*execute_time>target.time_to_die
M 10.44 arcane_missiles,if=buff.arcane_missiles.react>1
0.00 arcane_explosion,if=active_enemies>1&buff.arcane_power.remains>cast_time
N 21.01 arcane_blast,if=buff.presence_of_mind.up|buff.arcane_power.remains>cast_time
O 4.60 supernova,if=mana.pct<100
P 10.16 arcane_missiles,if=mana.pct>10&(talent.overpowered.enabled|buff.arcane_power.down)
0.00 arcane_explosion,if=active_enemies>1
Q 17.32 arcane_blast
R 3.32 evocation,interrupt_if=mana.pct>99
actions.conserve
# count action,conditions
S 1.70 arcane_missiles,if=buff.arcane_missiles.react=3
T 0.50 arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
U 1.11 arcane_blast,if=mana.pct>99
V 10.60 nether_tempest,if=(refreshable|!ticking)
0.00 arcane_blast,if=buff.rhonins_assaulting_armwraps.up&equipped.132413
W 17.10 arcane_missiles
X 4.84 supernova,if=mana.pct<100
0.00 frost_nova,if=equipped.132452
0.00 arcane_explosion,if=mana.pct>=82&equipped.132451&active_enemies>1
Y 5.88 arcane_blast,if=mana.pct>=82&equipped.132451
Z 9.41 arcane_barrage,if=mana.pct<100&cooldown.arcane_power.remains>5
0.00 arcane_explosion,if=active_enemies>1
a 1.19 arcane_blast
actions.cooldowns
# count action,conditions
b 0.12 rune_of_power,if=mana.pct>45&buff.arcane_power.down
c 3.61 arcane_power
0.00 blood_fury
d 2.00 berserking
0.00 arcane_torrent
e 1.00 potion,name=deadly_grace,if=buff.arcane_power.up&(buff.berserking.up|buff.blood_fury.up)
actions.init_burn
# count action,conditions
f 2.00 mark_of_aluneth
0.00 frost_nova,if=equipped.132452
g 8.42 nether_tempest,if=dot.nether_tempest.remains<10&(prev_gcd.mark_of_aluneth|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<gcd.max))
h 8.64 rune_of_power
i 4.27 start_burn_phase,if=((cooldown.evocation.remains-(2*burn_phase_duration))%2<burn_phase_duration)|cooldown.arcane_power.remains=0|target.time_to_die<55
actions.rop_phase
# count action,conditions
j 0.19 arcane_missiles,if=buff.arcane_missiles.react=3
k 0.94 arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
l 0.46 nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
m 4.51 arcane_missiles,if=buff.arcane_charge.stack=4
0.00 arcane_explosion,if=active_enemies>1
n 7.53 arcane_blast,if=mana.pct>45
o 0.38 arcane_barrage

Sample Sequence

012367GGGfghicdMNNMNNNMKNMMghOMPQQQPQR8UVYWZGGGGVWWXYWZGGGGVS9ghkmmnnnnVWXZGGGGVWahicNNNMNKMNOMMPQKPQR8UY9ghmnnnmnoGGGGVWXZGGGGVSWWZGGGGVSWWXZGGGGfghicdeNNNNNMKMNOghMPQQQQR8UVWWYZGGGGVWWXYZGGGG9VWWYZGGGGghiMOPQQKQQcNNghMNNNNMMLK

Sample Sequence Table

time name target resources buffs
Pre flask Mage_Arcane_T19M 1425908.0/1425908: 100% mana
Pre food Mage_Arcane_T19M 1425908.0/1425908: 100% mana
Pre augmentation Mage_Arcane_T19M 1425908.0/1425908: 100% mana
Pre summon_arcane_familiar Fluffy_Pillow 1568498.8/1568499: 100% mana
Pre potion Fluffy_Pillow 1568498.8/1568499: 100% mana potion_of_deadly_grace
0:00.000 arcane_blast Fluffy_Pillow 1535498.8/1568499: 98% mana arcane_missiles, quickening, potion_of_deadly_grace
0:00.000 arcane_blast Fluffy_Pillow 1535498.8/1568499: 98% mana arcane_missiles, quickening, potion_of_deadly_grace
0:01.841 arcane_blast Fluffy_Pillow 1494291.6/1568499: 95% mana bloodlust, arcane_missiles, quickening(2), potion_of_deadly_grace
0:03.233 arcane_blast Fluffy_Pillow 1408564.5/1568499: 90% mana bloodlust, arcane_missiles(2), quickening(3), potion_of_deadly_grace
0:04.598 mark_of_aluneth Fluffy_Pillow 1281010.0/1568499: 82% mana bloodlust, arcane_missiles(2), quickening(4), potion_of_deadly_grace
0:05.790 nether_tempest Fluffy_Pillow 1306505.2/1568499: 83% mana bloodlust, arcane_missiles(2), quickening(4), potion_of_deadly_grace
0:06.686 rune_of_power Fluffy_Pillow 1309169.4/1568499: 83% mana bloodlust, arcane_missiles(2), quickening(4), potion_of_deadly_grace
0:07.583 start_burn_phase Fluffy_Pillow 1328355.0/1568499: 85% mana bloodlust, arcane_missiles(2), quickening(4), rune_of_power, potion_of_deadly_grace
0:07.583 arcane_power Fluffy_Pillow 1328355.0/1568499: 85% mana bloodlust, arcane_missiles(2), quickening(4), rune_of_power, potion_of_deadly_grace
0:07.583 berserking Fluffy_Pillow 1328355.0/1568499: 85% mana bloodlust, arcane_missiles(2), arcane_power, quickening(4), rune_of_power, potion_of_deadly_grace
0:07.583 arcane_missiles Fluffy_Pillow 1328355.0/1568499: 85% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(4), rune_of_power, potion_of_deadly_grace
0:08.967 arcane_blast Fluffy_Pillow 1357956.9/1568499: 87% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(5), rune_of_power, potion_of_deadly_grace
0:10.112 arcane_blast Fluffy_Pillow 1243846.9/1568499: 79% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(6), rune_of_power, potion_of_deadly_grace
0:11.236 arcane_missiles Fluffy_Pillow 1129287.7/1568499: 72% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(7), rune_of_power, potion_of_deadly_grace
0:12.422 arcane_blast Fluffy_Pillow 1154654.6/1568499: 74% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(8), rune_of_power, potion_of_deadly_grace
0:13.509 arcane_blast Fluffy_Pillow 1039304.0/1568499: 66% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(9), rune_of_power, potion_of_deadly_grace
0:14.577 arcane_blast Fluffy_Pillow 923547.0/1568499: 59% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(10), rune_of_power, potion_of_deadly_grace
0:15.627 arcane_missiles Fluffy_Pillow 807405.1/1568499: 51% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(11), rune_of_power, potion_of_deadly_grace
0:16.777 nether_tempest Fluffy_Pillow 832002.0/1568499: 53% mana bloodlust, berserking, arcane_missiles, arcane_power, quickening(12), rune_of_power, potion_of_deadly_grace
0:17.532 arcane_blast Fluffy_Pillow 836600.4/1568499: 53% mana bloodlust, berserking, arcane_missiles(2), arcane_power, quickening(12), rune_of_power, potion_of_deadly_grace
0:18.549 arcane_missiles Fluffy_Pillow 719752.6/1568499: 46% mana bloodlust, arcane_missiles(3), arcane_power, quickening(13), potion_of_deadly_grace
0:19.835 arcane_missiles Fluffy_Pillow 747258.4/1568499: 48% mana bloodlust, arcane_missiles(2), arcane_power, quickening(14), potion_of_deadly_grace
0:21.090 nether_tempest Fluffy_Pillow 774101.1/1568499: 49% mana bloodlust, arcane_missiles, quickening(15), potion_of_deadly_grace
0:21.846 rune_of_power Fluffy_Pillow 773770.9/1568499: 49% mana bloodlust, arcane_missiles, quickening(15), potion_of_deadly_grace
0:22.601 supernova Fluffy_Pillow 789919.3/1568499: 50% mana bloodlust, arcane_missiles, quickening(15), rune_of_power, potion_of_deadly_grace
0:23.355 arcane_missiles Fluffy_Pillow 806046.3/1568499: 51% mana bloodlust, arcane_missiles(2), quickening(15), rune_of_power, potion_of_deadly_grace
0:24.549 arcane_missiles Fluffy_Pillow 831584.4/1568499: 53% mana bloodlust, arcane_missiles, quickening(16), rune_of_power, potion_of_deadly_grace
0:25.837 arcane_blast Fluffy_Pillow 859132.9/1568499: 55% mana bloodlust, quickening(17), rune_of_power, potion_of_deadly_grace
0:26.918 arcane_blast Fluffy_Pillow 684254.0/1568499: 44% mana bloodlust, quickening(18), rune_of_power, potion_of_deadly_grace
0:27.984 arcane_blast Fluffy_Pillow 509054.3/1568499: 32% mana bloodlust, quickening(19), rune_of_power, potion_of_deadly_grace
0:29.035 arcane_missiles Fluffy_Pillow 333533.7/1568499: 21% mana bloodlust, arcane_missiles, quickening(20), rune_of_power
0:30.203 arcane_blast Fluffy_Pillow 358515.6/1568499: 23% mana bloodlust, quickening(21), rune_of_power
0:31.223 evocation Fluffy_Pillow 182332.0/1568499: 12% mana bloodlust, quickening(22), rune_of_power
0:34.163 stop_burn_phase Fluffy_Pillow 1568498.8/1568499: 100% mana bloodlust, quickening(22)
0:34.163 arcane_blast Fluffy_Pillow 1568498.8/1568499: 100% mana bloodlust, quickening(22)
0:35.170 nether_tempest Fluffy_Pillow 1370605.7/1568499: 87% mana bloodlust, quickening(23)
0:35.925 arcane_blast Fluffy_Pillow 1370254.2/1568499: 87% mana bloodlust, quickening(23)
0:36.916 arcane_missiles Fluffy_Pillow 1193450.3/1568499: 76% mana bloodlust, arcane_missiles, quickening(24)
0:37.987 arcane_barrage Fluffy_Pillow 1216357.5/1568499: 78% mana bloodlust, quickening(25)
0:38.741 arcane_blast Fluffy_Pillow 1477944.3/1568499: 94% mana bloodlust
0:40.188 arcane_blast Fluffy_Pillow 1475893.6/1568499: 94% mana arcane_charge, quickening
0:42.031 arcane_blast Fluffy_Pillow 1441062.9/1568499: 92% mana arcane_charge(2), arcane_missiles, quickening(2)
0:43.839 arcane_blast Fluffy_Pillow 1364233.5/1568499: 87% mana arcane_charge(3), arcane_missiles, quickening(3)
0:45.613 nether_tempest Fluffy_Pillow 1245426.9/1568499: 79% mana arcane_charge(4), arcane_missiles, quickening(4)
0:46.776 arcane_missiles Fluffy_Pillow 1253801.9/1568499: 80% mana arcane_charge(4), arcane_missiles(2), quickening(4)
0:48.382 arcane_missiles Fluffy_Pillow 1288152.0/1568499: 82% mana arcane_charge(4), arcane_missiles, quickening(5)
0:50.241 supernova Fluffy_Pillow 1327913.4/1568499: 85% mana arcane_charge(4), quickening(6)
0:51.363 arcane_blast Fluffy_Pillow 1351911.5/1568499: 86% mana arcane_charge(4), quickening(6)
0:53.043 arcane_missiles Fluffy_Pillow 1189844.4/1568499: 76% mana arcane_charge(4), arcane_missiles, quickening(7)
0:54.818 arcane_barrage Fluffy_Pillow 1227809.2/1568499: 78% mana arcane_charge(4), quickening(8)
0:55.900 arcane_blast Fluffy_Pillow 1496411.5/1568499: 95% mana
0:57.781 arcane_blast Fluffy_Pillow 1503643.4/1568499: 96% mana arcane_charge, arcane_missiles, quickening
0:59.625 arcane_blast Fluffy_Pillow 1468834.1/1568499: 94% mana arcane_charge(2), arcane_missiles, quickening(2)
1:01.433 arcane_blast Fluffy_Pillow 1392004.7/1568499: 89% mana arcane_charge(3), arcane_missiles(2), quickening(3)
1:03.208 nether_tempest Fluffy_Pillow 1273219.5/1568499: 81% mana arcane_charge(4), arcane_missiles(2), quickening(4)
1:04.367 arcane_missiles Fluffy_Pillow 1281508.9/1568499: 82% mana arcane_charge(4), arcane_missiles(3), quickening(4)
1:06.085 mark_of_aluneth Fluffy_Pillow 1318254.5/1568499: 84% mana arcane_charge(4), arcane_missiles(2), quickening(5)
1:07.606 nether_tempest Fluffy_Pillow 1350786.6/1568499: 86% mana arcane_charge(4), arcane_missiles(2), quickening(5)
1:08.747 rune_of_power Fluffy_Pillow 1358691.1/1568499: 87% mana arcane_charge(4), arcane_missiles(2), quickening(5)
1:09.889 arcane_explosion Fluffy_Pillow 1383116.9/1568499: 88% mana arcane_charge(4), arcane_missiles(2), quickening(5), rune_of_power
1:11.030 arcane_missiles Fluffy_Pillow 1275521.3/1568499: 81% mana arcane_charge(4), arcane_missiles(2), quickening(6), rune_of_power
1:12.706 arcane_missiles Fluffy_Pillow 1311368.6/1568499: 84% mana arcane_charge(4), arcane_missiles, quickening(7), rune_of_power
1:14.331 arcane_blast Fluffy_Pillow 1346125.1/1568499: 86% mana arcane_charge(4), quickening(8), rune_of_power
1:15.952 arcane_blast Fluffy_Pillow 1182796.1/1568499: 75% mana arcane_charge(4), quickening(9), rune_of_power
1:17.546 arcane_blast Fluffy_Pillow 1018889.5/1568499: 65% mana arcane_charge(4), quickening(10), rune_of_power
1:19.115 arcane_blast Fluffy_Pillow 854448.3/1568499: 54% mana arcane_charge(4), quickening(11), rune_of_power
1:20.658 nether_tempest Fluffy_Pillow 689450.9/1568499: 44% mana arcane_charge(4), quickening(12)
1:21.670 arcane_missiles Fluffy_Pillow 694596.2/1568499: 44% mana arcane_charge(4), arcane_missiles, quickening(12)
1:23.221 supernova Fluffy_Pillow 727769.9/1568499: 46% mana arcane_charge(4), quickening(13)
1:24.218 arcane_barrage Fluffy_Pillow 749094.4/1568499: 48% mana arcane_charge(4), quickening(13)
1:25.215 arcane_blast Fluffy_Pillow 1015878.7/1568499: 65% mana
1:27.095 arcane_blast Fluffy_Pillow 1023089.3/1568499: 65% mana arcane_charge, quickening
1:28.939 arcane_blast Fluffy_Pillow 988279.9/1568499: 63% mana arcane_charge(2), quickening(2)
1:30.748 arcane_blast Fluffy_Pillow 911471.9/1568499: 58% mana arcane_charge(3), arcane_missiles, quickening(3)
1:32.523 nether_tempest Fluffy_Pillow 792686.7/1568499: 51% mana arcane_charge(4), arcane_missiles, quickening(4)
1:33.686 arcane_missiles Fluffy_Pillow 801061.7/1568499: 51% mana arcane_charge(4), arcane_missiles, quickening(4)
1:35.442 arcane_blast Fluffy_Pillow 838620.1/1568499: 53% mana arcane_charge(4), quickening(5)
1:37.153 rune_of_power Fluffy_Pillow 677216.0/1568499: 43% mana arcane_charge(4), quickening(6)
1:38.275 start_burn_phase Fluffy_Pillow 701214.0/1568499: 45% mana arcane_charge(4), quickening(6), rune_of_power
1:38.275 arcane_power Fluffy_Pillow 701214.0/1568499: 45% mana arcane_charge(4), quickening(6), rune_of_power
1:38.275 arcane_blast Fluffy_Pillow 701214.0/1568499: 45% mana arcane_charge(4), arcane_power, quickening(6), rune_of_power
1:39.957 arcane_blast Fluffy_Pillow 598589.7/1568499: 38% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(7), rune_of_power
1:41.607 arcane_blast Fluffy_Pillow 495280.9/1568499: 32% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(8), rune_of_power
1:43.228 arcane_missiles Fluffy_Pillow 391351.9/1568499: 25% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(9), rune_of_power
1:44.925 arcane_blast Fluffy_Pillow 427648.4/1568499: 27% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(10), rune_of_power
1:46.492 nether_tempest Fluffy_Pillow 322564.3/1568499: 21% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(11), rune_of_power
1:47.522 arcane_missiles Fluffy_Pillow 333044.6/1568499: 21% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(11), rune_of_power
1:49.134 arcane_blast Fluffy_Pillow 367523.1/1568499: 23% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(12)
1:50.651 supernova Fluffy_Pillow 261369.6/1568499: 17% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(13)
1:51.649 arcane_missiles Fluffy_Pillow 282715.4/1568499: 18% mana arcane_charge(4), arcane_missiles(3), quickening(13)
1:53.321 arcane_missiles Fluffy_Pillow 318477.2/1568499: 20% mana arcane_charge(4), arcane_missiles(2), quickening(14)
1:54.865 arcane_missiles Fluffy_Pillow 351501.2/1568499: 22% mana arcane_charge(4), arcane_missiles, quickening(15)
1:56.402 arcane_blast Fluffy_Pillow 384375.5/1568499: 25% mana arcane_charge(4), quickening(16)
1:57.825 nether_tempest Fluffy_Pillow 216811.6/1568499: 14% mana arcane_charge(4), arcane_missiles, quickening(17)
1:58.762 arcane_missiles Fluffy_Pillow 220352.7/1568499: 14% mana arcane_charge(4), arcane_missiles, quickening(17)
2:00.246 arcane_blast Fluffy_Pillow 252093.4/1568499: 16% mana arcane_charge(4), quickening(18)
2:01.628 evocation Fluffy_Pillow 83652.5/1568499: 5% mana arcane_charge(4), quickening(19)
2:05.461 stop_burn_phase Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), quickening(19)
2:05.461 arcane_blast Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), quickening(19)
2:06.824 arcane_blast Fluffy_Pillow 1370584.4/1568499: 87% mana arcane_charge(4), quickening(20)
2:08.167 mark_of_aluneth Fluffy_Pillow 1201309.3/1568499: 77% mana arcane_charge(4), quickening(21)
2:09.346 nether_tempest Fluffy_Pillow 1226526.5/1568499: 78% mana arcane_charge(4), quickening(21)
2:10.230 rune_of_power Fluffy_Pillow 1228934.0/1568499: 78% mana arcane_charge(4), arcane_missiles, quickening(21)
2:11.119 arcane_missiles Fluffy_Pillow 1247948.5/1568499: 80% mana arcane_charge(4), arcane_missiles, quickening(21), rune_of_power
2:12.579 arcane_blast Fluffy_Pillow 1279175.9/1568499: 82% mana arcane_charge(4), quickening(22), rune_of_power
2:13.887 arcane_blast Fluffy_Pillow 1109152.2/1568499: 71% mana arcane_charge(4), quickening(23), rune_of_power
2:15.177 arcane_blast Fluffy_Pillow 938743.5/1568499: 60% mana arcane_charge(4), quickening(24), rune_of_power
2:16.448 arcane_missiles Fluffy_Pillow 767928.4/1568499: 49% mana arcane_charge(4), arcane_missiles, quickening(25), rune_of_power
2:17.918 arcane_blast Fluffy_Pillow 799369.7/1568499: 51% mana arcane_charge(4), quickening(26), rune_of_power
2:19.157 arcane_barrage Fluffy_Pillow 627870.2/1568499: 40% mana arcane_charge(4), quickening(27), rune_of_power
2:19.974 arcane_blast Fluffy_Pillow 890804.5/1568499: 57% mana rune_of_power
2:21.854 arcane_blast Fluffy_Pillow 898015.1/1568499: 57% mana arcane_charge, arcane_missiles, quickening
2:23.698 arcane_blast Fluffy_Pillow 863205.7/1568499: 55% mana arcane_charge(2), arcane_missiles, quickening(2)
2:25.506 arcane_blast Fluffy_Pillow 786376.4/1568499: 50% mana arcane_charge(3), arcane_missiles, quickening(3)
2:27.281 nether_tempest Fluffy_Pillow 667591.2/1568499: 43% mana arcane_charge(4), arcane_missiles, quickening(4)
2:28.442 arcane_missiles Fluffy_Pillow 675923.3/1568499: 43% mana arcane_charge(4), arcane_missiles, quickening(4)
2:30.249 supernova Fluffy_Pillow 714572.6/1568499: 46% mana arcane_charge(4), quickening(5)
2:31.391 arcane_barrage Fluffy_Pillow 738998.4/1568499: 47% mana arcane_charge(4), quickening(5)
2:32.532 arcane_blast Fluffy_Pillow 1008862.6/1568499: 64% mana
2:34.413 arcane_blast Fluffy_Pillow 1016094.6/1568499: 65% mana arcane_charge, arcane_missiles, quickening
2:36.254 arcane_blast Fluffy_Pillow 981221.1/1568499: 63% mana arcane_charge(2), arcane_missiles(2), quickening(2)
2:38.062 arcane_blast Fluffy_Pillow 904391.7/1568499: 58% mana arcane_charge(3), arcane_missiles(2), quickening(3)
2:39.838 nether_tempest Fluffy_Pillow 785627.9/1568499: 50% mana arcane_charge(4), arcane_missiles(3), quickening(4)
2:40.998 arcane_missiles Fluffy_Pillow 793938.7/1568499: 51% mana arcane_charge(4), arcane_missiles(3), quickening(4)
2:42.857 arcane_missiles Fluffy_Pillow 833700.1/1568499: 53% mana arcane_charge(4), arcane_missiles(2), quickening(5)
2:44.548 arcane_missiles Fluffy_Pillow 869868.3/1568499: 55% mana arcane_charge(4), arcane_missiles, quickening(6)
2:46.309 arcane_barrage Fluffy_Pillow 907533.6/1568499: 58% mana arcane_charge(4), quickening(7)
2:47.411 arcane_blast Fluffy_Pillow 1176563.7/1568499: 75% mana
2:49.293 arcane_blast Fluffy_Pillow 1183817.1/1568499: 75% mana arcane_charge, arcane_missiles, quickening
2:51.135 arcane_blast Fluffy_Pillow 1148964.9/1568499: 73% mana arcane_charge(2), arcane_missiles(2), quickening(2)
2:52.944 arcane_blast Fluffy_Pillow 1072156.9/1568499: 68% mana arcane_charge(3), arcane_missiles(2), quickening(3)
2:54.719 nether_tempest Fluffy_Pillow 953371.7/1568499: 61% mana arcane_charge(4), arcane_missiles(3), quickening(4)
2:55.881 arcane_missiles Fluffy_Pillow 961725.3/1568499: 61% mana arcane_charge(4), arcane_missiles(3), quickening(4)
2:57.671 arcane_missiles Fluffy_Pillow 1000010.9/1568499: 64% mana arcane_charge(4), arcane_missiles(2), quickening(5)
2:59.471 arcane_missiles Fluffy_Pillow 1038510.5/1568499: 66% mana arcane_charge(4), arcane_missiles, quickening(6)
3:01.184 supernova Fluffy_Pillow 1075149.2/1568499: 69% mana arcane_charge(4), quickening(7)
3:02.285 arcane_barrage Fluffy_Pillow 1098698.0/1568499: 70% mana arcane_charge(4), quickening(7)
3:03.386 arcane_blast Fluffy_Pillow 1367706.7/1568499: 87% mana
3:05.266 arcane_blast Fluffy_Pillow 1374917.3/1568499: 88% mana arcane_charge, quickening
3:07.109 arcane_blast Fluffy_Pillow 1340086.5/1568499: 85% mana arcane_charge(2), quickening(2)
3:08.919 arcane_blast Fluffy_Pillow 1263299.9/1568499: 81% mana arcane_charge(3), quickening(3)
3:10.692 mark_of_aluneth Fluffy_Pillow 1144472.0/1568499: 73% mana arcane_charge(4), quickening(4)
3:12.240 nether_tempest Fluffy_Pillow 1177581.6/1568499: 75% mana arcane_charge(4), quickening(4)
3:13.404 rune_of_power Fluffy_Pillow 1185977.9/1568499: 76% mana arcane_charge(4), quickening(4)
3:14.569 start_burn_phase Fluffy_Pillow 1210895.6/1568499: 77% mana arcane_charge(4), quickening(4), rune_of_power
3:14.569 arcane_power Fluffy_Pillow 1210895.6/1568499: 77% mana arcane_charge(4), quickening(4), rune_of_power
3:14.569 berserking Fluffy_Pillow 1210895.6/1568499: 77% mana arcane_charge(4), arcane_power, quickening(4), rune_of_power
3:14.569 potion Fluffy_Pillow 1210895.6/1568499: 77% mana berserking, arcane_charge(4), arcane_power, quickening(4), rune_of_power
3:14.569 arcane_blast Fluffy_Pillow 1210895.6/1568499: 77% mana berserking, arcane_charge(4), arcane_power, quickening(4), rune_of_power, potion_of_deadly_grace
3:16.083 arcane_blast Fluffy_Pillow 1104678.0/1568499: 70% mana berserking, arcane_charge(4), arcane_power, quickening(5), rune_of_power, potion_of_deadly_grace
3:17.573 arcane_blast Fluffy_Pillow 997947.1/1568499: 64% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(6), rune_of_power, potion_of_deadly_grace
3:19.035 arcane_blast Fluffy_Pillow 890617.2/1568499: 57% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(7), rune_of_power, potion_of_deadly_grace
3:20.469 arcane_blast Fluffy_Pillow 782688.5/1568499: 50% mana berserking, arcane_charge(4), arcane_missiles(2), arcane_power, quickening(8), rune_of_power, potion_of_deadly_grace
3:21.880 arcane_missiles Fluffy_Pillow 674267.8/1568499: 43% mana berserking, arcane_charge(4), arcane_missiles(2), arcane_power, quickening(9), rune_of_power, potion_of_deadly_grace
3:23.369 nether_tempest Fluffy_Pillow 706115.5/1568499: 45% mana berserking, arcane_charge(4), arcane_missiles, arcane_power, quickening(10), rune_of_power, potion_of_deadly_grace
3:24.279 arcane_missiles Fluffy_Pillow 714029.1/1568499: 46% mana berserking, arcane_charge(4), arcane_missiles(2), arcane_power, quickening(10), rune_of_power, potion_of_deadly_grace
3:25.775 arcane_blast Fluffy_Pillow 746026.5/1568499: 48% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(11), potion_of_deadly_grace
3:27.319 supernova Fluffy_Pillow 640450.6/1568499: 41% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(12), potion_of_deadly_grace
3:28.331 nether_tempest Fluffy_Pillow 662095.8/1568499: 42% mana arcane_charge(4), arcane_missiles(2), quickening(12), potion_of_deadly_grace
3:29.343 rune_of_power Fluffy_Pillow 667241.1/1568499: 43% mana arcane_charge(4), arcane_missiles(2), quickening(12), potion_of_deadly_grace
3:30.357 arcane_missiles Fluffy_Pillow 688929.2/1568499: 44% mana arcane_charge(4), arcane_missiles(2), quickening(12), rune_of_power, potion_of_deadly_grace
3:31.972 arcane_missiles Fluffy_Pillow 723471.8/1568499: 46% mana arcane_charge(4), arcane_missiles, quickening(13), rune_of_power, potion_of_deadly_grace
3:33.419 arcane_blast Fluffy_Pillow 754421.1/1568499: 48% mana arcane_charge(4), quickening(14), rune_of_power, potion_of_deadly_grace
3:34.890 arcane_blast Fluffy_Pillow 587883.8/1568499: 37% mana arcane_charge(4), quickening(15), rune_of_power, potion_of_deadly_grace
3:36.336 arcane_blast Fluffy_Pillow 420811.7/1568499: 27% mana arcane_charge(4), quickening(16), rune_of_power, potion_of_deadly_grace
3:37.762 arcane_blast Fluffy_Pillow 253311.9/1568499: 16% mana arcane_charge(4), quickening(17), rune_of_power, potion_of_deadly_grace
3:39.167 evocation Fluffy_Pillow 85362.9/1568499: 5% mana arcane_charge(4), arcane_missiles, quickening(18), rune_of_power, potion_of_deadly_grace
3:43.112 stop_burn_phase Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), arcane_missiles, quickening(18), potion_of_deadly_grace
3:43.112 arcane_blast Fluffy_Pillow 1568498.8/1568499: 100% mana arcane_charge(4), arcane_missiles, quickening(18), potion_of_deadly_grace
3:44.495 nether_tempest Fluffy_Pillow 1370584.4/1568499: 87% mana arcane_charge(4), arcane_missiles(2), quickening(19), potion_of_deadly_grace
3:45.405 arcane_missiles Fluffy_Pillow 1373548.0/1568499: 88% mana arcane_charge(4), arcane_missiles(2), quickening(19)
3:46.855 arcane_missiles Fluffy_Pillow 1404561.5/1568499: 90% mana arcane_charge(4), arcane_missiles, quickening(20)
3:48.256 arcane_blast Fluffy_Pillow 1434527.0/1568499: 91% mana arcane_charge(4), quickening(21)
3:49.579 arcane_barrage Fluffy_Pillow 1264824.1/1568499: 81% mana arcane_charge(4), quickening(22)
3:50.453 arcane_blast Fluffy_Pillow 1528977.6/1568499: 97% mana
3:52.334 arcane_blast Fluffy_Pillow 1535605.7/1568499: 98% mana arcane_charge, arcane_missiles, quickening
3:54.177 arcane_blast Fluffy_Pillow 1494334.4/1568499: 95% mana arcane_charge(2), arcane_missiles(2), quickening(2)
3:55.984 arcane_blast Fluffy_Pillow 1417483.6/1568499: 90% mana arcane_charge(3), arcane_missiles(2), quickening(3)
3:57.760 nether_tempest Fluffy_Pillow 1298719.8/1568499: 83% mana arcane_charge(4), arcane_missiles(2), quickening(4)
3:58.925 arcane_missiles Fluffy_Pillow 1307137.5/1568499: 83% mana arcane_charge(4), arcane_missiles(2), quickening(4)
4:00.707 arcane_missiles Fluffy_Pillow 1345252.0/1568499: 86% mana arcane_charge(4), arcane_missiles, quickening(5)
4:02.470 supernova Fluffy_Pillow 1382960.2/1568499: 88% mana arcane_charge(4), quickening(6)
4:03.590 arcane_blast Fluffy_Pillow 1406915.4/1568499: 90% mana arcane_charge(4), quickening(6)
4:05.269 arcane_barrage Fluffy_Pillow 1244826.9/1568499: 79% mana arcane_charge(4), quickening(7)
4:06.369 arcane_blast Fluffy_Pillow 1513814.2/1568499: 97% mana
4:08.249 arcane_blast Fluffy_Pillow 1521024.8/1568499: 97% mana arcane_charge, arcane_missiles, quickening
4:10.092 arcane_blast Fluffy_Pillow 1486194.0/1568499: 95% mana arcane_charge(2), arcane_missiles, quickening(2)
4:11.899 arcane_blast Fluffy_Pillow 1409343.3/1568499: 90% mana arcane_charge(3), arcane_missiles, quickening(3)
4:13.674 mark_of_aluneth Fluffy_Pillow 1290558.1/1568499: 82% mana arcane_charge(4), arcane_missiles(2), quickening(4)
4:15.221 nether_tempest Fluffy_Pillow 1323646.3/1568499: 84% mana arcane_charge(4), arcane_missiles(2), quickening(4)
4:16.384 arcane_missiles Fluffy_Pillow 1332021.2/1568499: 85% mana arcane_charge(4), arcane_missiles(2), quickening(4)
4:18.322 arcane_missiles Fluffy_Pillow 1373472.4/1568499: 88% mana arcane_charge(4), arcane_missiles, quickening(5)
4:20.088 arcane_blast Fluffy_Pillow 1411244.7/1568499: 90% mana arcane_charge(4), quickening(6)
4:21.765 arcane_barrage Fluffy_Pillow 1249113.4/1568499: 80% mana arcane_charge(4), quickening(7)
4:22.867 arcane_blast Fluffy_Pillow 1518143.5/1568499: 97% mana arcane_missiles
4:24.748 arcane_blast Fluffy_Pillow 1525375.5/1568499: 97% mana arcane_charge, arcane_missiles, quickening
4:26.591 arcane_blast Fluffy_Pillow 1490544.7/1568499: 95% mana arcane_charge(2), arcane_missiles(2), quickening(2)
4:28.398 arcane_blast Fluffy_Pillow 1413693.9/1568499: 90% mana arcane_charge(3), arcane_missiles(2), quickening(3)
4:30.172 nether_tempest Fluffy_Pillow 1294887.3/1568499: 83% mana arcane_charge(4), arcane_missiles(2), quickening(4)
4:31.334 rune_of_power Fluffy_Pillow 1303240.9/1568499: 83% mana arcane_charge(4), arcane_missiles(2), quickening(4)
4:32.496 start_burn_phase Fluffy_Pillow 1328094.5/1568499: 85% mana arcane_charge(4), arcane_missiles(2), quickening(4), rune_of_power
4:32.496 arcane_missiles Fluffy_Pillow 1328094.5/1568499: 85% mana arcane_charge(4), arcane_missiles(2), quickening(4), rune_of_power
4:34.239 supernova Fluffy_Pillow 1365374.9/1568499: 87% mana arcane_charge(4), arcane_missiles, quickening(5), rune_of_power
4:35.379 arcane_missiles Fluffy_Pillow 1389757.9/1568499: 89% mana arcane_charge(4), arcane_missiles, quickening(5), rune_of_power
4:37.056 arcane_blast Fluffy_Pillow 1425626.6/1568499: 91% mana arcane_charge(4), quickening(6), rune_of_power
4:38.736 arcane_blast Fluffy_Pillow 1263559.5/1568499: 81% mana arcane_charge(4), quickening(7), rune_of_power
4:40.385 nether_tempest Fluffy_Pillow 1100829.3/1568499: 70% mana arcane_charge(4), quickening(8), rune_of_power
4:41.467 arcane_blast Fluffy_Pillow 1107471.8/1568499: 71% mana arcane_charge(4), quickening(8), rune_of_power
4:43.089 arcane_blast Fluffy_Pillow 944164.2/1568499: 60% mana arcane_charge(4), quickening(9)
4:44.684 arcane_power Fluffy_Pillow 780279.0/1568499: 50% mana arcane_charge(4), arcane_missiles, quickening(10)
4:44.684 arcane_blast Fluffy_Pillow 780279.0/1568499: 50% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(10)
4:46.252 arcane_blast Fluffy_Pillow 675216.4/1568499: 43% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(11)
4:47.794 nether_tempest Fluffy_Pillow 569597.6/1568499: 36% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(12)
4:48.807 rune_of_power Fluffy_Pillow 579714.3/1568499: 37% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(12)
4:49.821 arcane_missiles Fluffy_Pillow 601402.3/1568499: 38% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(12), rune_of_power
4:51.447 arcane_blast Fluffy_Pillow 636180.2/1568499: 41% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(13), rune_of_power
4:52.938 arcane_blast Fluffy_Pillow 529470.7/1568499: 34% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(14), rune_of_power
4:54.407 arcane_blast Fluffy_Pillow 422290.6/1568499: 27% mana arcane_charge(4), arcane_missiles, arcane_power, quickening(15), rune_of_power
4:55.855 arcane_blast Fluffy_Pillow 314661.3/1568499: 20% mana arcane_charge(4), arcane_missiles(2), arcane_power, quickening(16), rune_of_power
4:57.281 arcane_missiles Fluffy_Pillow 206561.4/1568499: 13% mana arcane_charge(4), arcane_missiles(3), arcane_power, quickening(17), rune_of_power
4:58.772 arcane_missiles Fluffy_Pillow 238451.9/1568499: 15% mana arcane_charge(4), arcane_missiles(2), quickening(18), rune_of_power
5:00.270 arcane_blast Fluffy_Pillow 270492.0/1568499: 17% mana arcane_charge(4), arcane_missiles, quickening(19)
5:01.633 nether_tempest Fluffy_Pillow 101644.7/1568499: 6% mana arcane_charge(4), arcane_missiles, quickening(20)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4876 4551 0
Agility 6579 6254 0
Stamina 42382 42382 26343
Intellect 39238 37532 28421 (2596)
Spirit 1 1 0
Health 2542920 2542920 0
Mana 1568499 1378784 0
Spell Power 39238 37532 0
Melee Crit 23.46% 22.39% 6085
Spell Crit 27.46% 26.39% 6085
Haste 19.89% 19.89% 6465
Damage / Heal Versatility 6.41% 6.41% 2564
ManaReg per Second 21389 20682 0
Mastery 29.63% 25.34% 4591
Armor 1824 1824 1824
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Pendant of Liquid Horror
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Ancient Dreamwoven Mantle
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +641 Mastery, +454 Crit }
Local Chest Robes of Celestial Adornment
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +855 Haste, +605 Crit }
Local Waist Cinch of Light
ilevel: 880, stats: { 163 Armor, +1930 Sta, +1287 Int, +783 Mastery, +312 Haste }
Local Legs Mystic Kilt of the Rune Master
ilevel: 895, stats: { 267 Armor, +2959 Sta, +1973 Int, +993 Haste, +552 Mastery }
Local Feet Treads of the Drowned
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +759 Haste, +336 Mastery }
Local Wrists Helhound Hair Bracers
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +499 Mastery, +323 Vers }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Mastery }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Mastery }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Mantle of the Victorious Dead
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Vers, +340 Haste }, enchant: { +200 Int }
Local Main Hand Aluneth
ilevel: 906, weapon: { 5654 - 8482, 3.6 }, stats: { +2186 Int, +3279 Sta, +806 Haste, +806 Mastery, +11923 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Arcane Familiar (Arcane Mage) Presence of Mind (Arcane Mage) Words of Power (Arcane Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Supernova (Arcane Mage) Charged Up (Arcane Mage) Resonance (Arcane Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Nether Tempest (Arcane Mage) Unstable Magic Erosion (Arcane Mage)
100 Overpowered Quickening (Arcane Mage) Arcane Orb (Arcane Mage)

Profile

mage="Mage_Arcane_T19M"
level=110
race=troll
role=spell
position=back
talents=1021012
artifact=4:0:0:0:0:72:3:73:1:74:3:75:3:77:3:78:1:79:3:80:1:81:3:82:3:83:3:84:3:86:1:87:1:290:1:1169:1:1339:1
spec=arcane

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/summon_arcane_familiar
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/arcane_blast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.arcane_power.down
actions+=/stop_burn_phase,if=prev_gcd.evocation&burn_phase_duration>gcd.max
actions+=/mark_of_aluneth,if=cooldown.arcane_power.remains>20
actions+=/call_action_list,name=build,if=buff.arcane_charge.stack<4
actions+=/call_action_list,name=init_burn,if=buff.arcane_power.down&buff.arcane_charge.stack=4&(cooldown.mark_of_aluneth.remains=0|cooldown.mark_of_aluneth.remains>20)&(!talent.rune_of_power.enabled|(cooldown.arcane_power.remains<=action.rune_of_power.cast_time|action.rune_of_power.recharge_time<cooldown.arcane_power.remains))|target.time_to_die<45
actions+=/call_action_list,name=burn,if=burn_phase
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&!burn_phase
actions+=/call_action_list,name=conserve

actions.build=charged_up,if=buff.arcane_charge.stack<=1
actions.build+=/arcane_missiles,if=buff.arcane_missiles.react=3
actions.build+=/arcane_orb
actions.build+=/arcane_explosion,if=active_enemies>1
actions.build+=/arcane_blast

actions.burn=call_action_list,name=cooldowns
actions.burn+=/arcane_missiles,if=buff.arcane_missiles.react=3
actions.burn+=/arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
actions.burn+=/presence_of_mind,if=buff.arcane_power.remains>2*gcd
actions.burn+=/nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
actions.burn+=/arcane_blast,if=active_enemies<=1&mana.pct%10*execute_time>target.time_to_die
actions.burn+=/arcane_explosion,if=active_enemies>1&mana.pct%10*execute_time>target.time_to_die
actions.burn+=/arcane_missiles,if=buff.arcane_missiles.react>1
actions.burn+=/arcane_explosion,if=active_enemies>1&buff.arcane_power.remains>cast_time
actions.burn+=/arcane_blast,if=buff.presence_of_mind.up|buff.arcane_power.remains>cast_time
actions.burn+=/supernova,if=mana.pct<100
actions.burn+=/arcane_missiles,if=mana.pct>10&(talent.overpowered.enabled|buff.arcane_power.down)
actions.burn+=/arcane_explosion,if=active_enemies>1
actions.burn+=/arcane_blast
actions.burn+=/evocation,interrupt_if=mana.pct>99

actions.conserve=arcane_missiles,if=buff.arcane_missiles.react=3
actions.conserve+=/arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
actions.conserve+=/arcane_blast,if=mana.pct>99
actions.conserve+=/nether_tempest,if=(refreshable|!ticking)
actions.conserve+=/arcane_blast,if=buff.rhonins_assaulting_armwraps.up&equipped.132413
actions.conserve+=/arcane_missiles
actions.conserve+=/supernova,if=mana.pct<100
actions.conserve+=/frost_nova,if=equipped.132452
actions.conserve+=/arcane_explosion,if=mana.pct>=82&equipped.132451&active_enemies>1
actions.conserve+=/arcane_blast,if=mana.pct>=82&equipped.132451
actions.conserve+=/arcane_barrage,if=mana.pct<100&cooldown.arcane_power.remains>5
actions.conserve+=/arcane_explosion,if=active_enemies>1
actions.conserve+=/arcane_blast

actions.cooldowns=rune_of_power,if=mana.pct>45&buff.arcane_power.down
actions.cooldowns+=/arcane_power
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=deadly_grace,if=buff.arcane_power.up&(buff.berserking.up|buff.blood_fury.up)

actions.init_burn=mark_of_aluneth
actions.init_burn+=/frost_nova,if=equipped.132452
actions.init_burn+=/nether_tempest,if=dot.nether_tempest.remains<10&(prev_gcd.mark_of_aluneth|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<gcd.max))
actions.init_burn+=/rune_of_power
actions.init_burn+=/start_burn_phase,if=((cooldown.evocation.remains-(2*burn_phase_duration))%2<burn_phase_duration)|cooldown.arcane_power.remains=0|target.time_to_die<55

actions.rop_phase=arcane_missiles,if=buff.arcane_missiles.react=3
actions.rop_phase+=/arcane_explosion,if=buff.quickening.remains<action.arcane_blast.cast_time&talent.quickening.enabled
actions.rop_phase+=/nether_tempest,if=dot.nether_tempest.remains<=2|!ticking
actions.rop_phase+=/arcane_missiles,if=buff.arcane_charge.stack=4
actions.rop_phase+=/arcane_explosion,if=active_enemies>1
actions.rop_phase+=/arcane_blast,if=mana.pct>45
actions.rop_phase+=/arcane_barrage

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=pendant_of_liquid_horror,id=141696,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=ancient_dreamwoven_mantle,id=139191,bonus_id=1806
back=mantle_of_the_victorious_dead,id=142540,bonus_id=1502/3467,enchant=binding_of_intellect
chest=robes_of_celestial_adornment,id=142410,bonus_id=1502/3467
wrists=helhound_hair_bracers,id=142415,bonus_id=1502/3467
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=cinch_of_light,id=142411,bonus_id=1502/3467
legs=mystic_kilt_of_the_rune_master,id=132451
feet=treads_of_the_drowned,id=142414,bonus_id=1502/3467
finger1=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_mastery
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=binding_of_mastery
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=aluneth,id=127857,gem_id=137380/137272/137380,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=882.73
# gear_stamina=26343
# gear_intellect=28421
# gear_crit_rating=6085
# gear_haste_rating=6465
# gear_mastery_rating=4591
# gear_versatility_rating=2564
# gear_armor=1824

Mage_Fire_T19M : 430629 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
430629.3 430629.3 409.1 / 0.095% 70875.0 / 16.5% 24.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
17458.9 17458.9 Mana 0.00% 49.6 100.0% 100%
Talents
  • 15: Pyromaniac (Fire Mage)
  • 45: Rune of Power
  • 60: Flame On (Fire Mage)
  • 90: Unstable Magic
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mage_Fire_T19M 430629
Blast Furnace (blast_furance) 4583 1.1% 36.4 8.33sec 37850 0 Periodic 222.5 3040 7888 6184 64.9% 72.9%

Stats details: blast_furance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.35 0.00 222.48 222.48 0.0000 0.9849 1375905.18 1375905.18 0.00 6279.20 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.2 35.14% 3040.04 3 4198 3040.18 2785 3319 237662 237662 0.00
crit 144.3 64.86% 7887.94 6 10810 7893.62 7439 8523 1138243 1138243 0.00
 
 

Action details: blast_furance

Static Values
  • id:194522
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:194522
  • name:Blast Furnace
  • school:fire
  • tooltip:Deals {$s1=1} Fire damage every $t1 sec.
  • description:Deals {$s1=1} Fire damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.070000
  • base_td:1.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Deadly Grace 18660 4.3% 24.6 4.62sec 224729 0 Direct 24.6 94632 262774 224727 77.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.56 24.56 0.00 0.00 0.0000 0.0000 5518794.06 5518794.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.56 22.63% 94632.18 82172 123258 94501.67 0 123258 525826 525826 0.00
crit 19.00 77.37% 262774.18 164343 308144 263012.15 227342 299180 4992968 4992968 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Fire Blast 26410 6.1% 36.4 8.33sec 218024 0 Direct 36.4 0 218024 218024 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.35 36.35 0.00 0.00 0.0000 0.0000 7925580.41 7925580.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 36.35 100.00% 218023.82 142921 267977 218055.91 202769 234465 7925580 7925580 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum ${{$231567s1=1}+1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 36477 8.5% 75.7 3.68sec 144873 92399 Direct 75.6 79214 175903 145064 68.1%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.69 75.59 0.00 0.00 1.5679 0.0000 10965050.59 10965050.59 0.00 92398.74 92398.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.11 31.90% 79214.26 76234 114352 79199.63 76234 88940 1909824 1909824 0.00
crit 51.48 68.10% 175902.73 157043 294455 175902.96 164530 192292 9055226 9055226 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 87910 20.4% 224.1 1.35sec 117839 0 Periodic 299.4 88190 0 88190 0.0% 99.6%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.05 0.00 299.37 299.37 0.0000 1.0000 26401899.92 26401899.92 0.00 88190.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 299.4 100.00% 88189.76 2462 366721 88289.28 71688 103809 26401900 26401900 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Maddening Whispers 20800 4.8% 2.3 160.10sec 2738411 0 Direct 2.3 730373 2738528 2738411 100.0%  

Stats details: maddening_whispers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.29 2.29 0.00 0.00 0.0000 0.0000 6268145.51 6268145.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 730373.40 730373 730373 97.40 0 730373 97 97 0.00
crit 2.29 99.99% 2738527.98 1825933 2738900 2738575.58 2282417 2738900 6268048 6268048 0.00
 
 

Action details: maddening_whispers

Static Values
  • id:222050
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222050
  • name:Maddening Whispers
  • school:shadow
  • tooltip:Deals {$222046s1=36653} Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70372.42
  • base_dd_max:70372.42
 
Mark of the Hidden Satyr 11199 2.6% 17.0 17.56sec 197686 0 Direct 17.0 98058 251482 197682 64.9%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 0.00 0.00 0.0000 0.0000 3360896.20 3360896.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.96 35.06% 98058.44 90176 135264 97953.50 0 135264 584561 584561 0.00
crit 11.04 64.94% 251482.49 185762 348304 251361.16 188084 348304 2776335 2776335 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Phoenix Reborn 3570 0.8% 24.9 11.70sec 43100 0 Direct 24.9 21640 55053 43100 64.2%  

Stats details: phoenix_reborn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.90 24.90 0.00 0.00 0.0000 0.0000 1073297.64 1073297.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.91 35.77% 21639.75 19982 29974 21639.45 0 29974 192768 192768 0.00
crit 15.99 64.23% 55052.74 41164 77182 55116.63 42634 69685 880530 880530 0.00
 
 

Action details: phoenix_reborn

Static Values
  • id:215773
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215773
  • name:Phoenix Reborn
  • school:fire
  • tooltip:
  • description:Targets affected by your Ignite have a chance to erupt in flame, taking $215775m1 additional Fire damage and reducing the remaining cooldown on Phoenix's Flame by {$s1=10} sec.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 19657 4.6% 13.6 22.92sec 433772 361380 Direct 13.5 0 435308 435308 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.59 13.54 0.00 0.00 1.2004 0.0000 5894470.90 5894470.90 0.00 361380.11 361380.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 13.54 100.00% 435307.72 246986 463098 435546.93 402234 463098 5894471 5894471 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Plague Swarm 19403 4.5% 13.5 21.75sec 430501 0 Periodic 61.3 48424 120833 95172 64.6% 40.1%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.54 0.00 61.25 61.25 0.0000 1.9683 5829531.44 5829531.44 0.00 48351.77 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.7 35.44% 48424.18 68 68034 48449.99 37552 59530 1051217 1051217 0.00
crit 39.5 64.56% 120833.03 52 170086 120784.50 91123 150998 4778314 4778314 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Pyroblast 173775 40.4% 97.2 3.08sec 536820 340517 Direct 97.9 272964 621622 532677 74.5%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.19 97.94 0.00 0.00 1.5765 0.0000 52171288.56 52171288.56 0.00 340516.99 340516.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.98 25.51% 272963.98 159286 955713 272724.62 167669 443724 6819776 6819776 0.00
crit 72.96 74.49% 621622.28 328128 2460962 621219.31 503568 783181 45351512 45351512 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.760000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 182 0.0% 0.7 145.80sec 76779 72565 Direct 0.7 0 76779 76779 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.70 0.70 0.00 0.00 1.0594 0.0000 53916.03 53916.03 0.00 72565.32 72565.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.70 100.00% 76778.64 41166 77187 41173.67 0 77187 53916 53916 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
sorcerous_arcane_blast 1092 0.3% 0.4 318.49sec 746878 0 Direct 0.4 671842 1405401 746856 10.2%  

Stats details: sorcerous_arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.45 0.45 0.00 0.00 0.0000 0.0000 334944.68 334944.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.40 89.77% 671842.43 671842 671842 251392.17 0 671842 270475 270475 0.00
crit 0.05 10.23% 1405400.63 1343685 1679606 63103.38 0 1679606 64470 64470 0.00
 
 

Action details: sorcerous_arcane_blast

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:431550.00
  • base_dd_max:431550.00
 
sorcerous_fireball 1311 0.3% 0.5 318.84sec 866566 0 Direct 0.5 383869 807357 424848 9.7%  
Periodic 3.7 54549 0 54549 0.0% 0.8%

Stats details: sorcerous_fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.46 0.46 3.74 3.74 0.0000 0.6075 400060.20 400060.20 0.00 176160.37 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.42 90.32% 383869.04 255940 383910 147270.44 0 383910 160069 160069 0.00
crit 0.04 9.68% 807356.92 767820 959775 35634.16 0 959775 36067 36067 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.7 100.00% 54549.06 26673 57586 22807.67 0 57586 203924 203924 0.00
 
 

Action details: sorcerous_fireball

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:246600.00
  • base_dd_max:246600.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:36990.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
sorcerous_frostbolt 1033 0.2% 0.5 318.62sec 700150 0 Direct 0.5 633451 1342125 700131 9.4%  

Stats details: sorcerous_frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.45 0.45 0.00 0.00 0.0000 0.0000 317443.73 317443.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.41 90.59% 633451.44 633451 633451 239476.57 0 633451 260172 260172 0.00
crit 0.04 9.41% 1342125.23 1266903 1583629 56325.57 0 1583629 57272 57272 0.00
 
 

Action details: sorcerous_frostbolt

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:406890.00
  • base_dd_max:406890.00
 
Unstable Magic (_explosion) 4566 1.1% 18.9 14.21sec 72531 0 Direct 18.9 72531 0 72531 0.0%  

Stats details: unstable_magic_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.92 18.92 0.00 0.00 0.0000 0.0000 1372332.54 1372332.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.92 100.00% 72530.91 38117 147228 72621.84 46983 97279 1372333 1372333 0.00
 
 

Action details: unstable_magic_explosion

Static Values
  • id:157976
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:157976
  • name:Unstable Magic
  • school:none
  • tooltip:
  • description:{$?s137021=false}[Arcane Blast]?s137019[Fireball][Frostbolt] has a {$?s137020=false}[{$s2=20}%]?s137021[{$s1=15}%][{$s3=25}%] chance to explode on impact, dealing {$s4=50}% additional damage to the target and all other enemies within $157977A1 yds.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:38117.19
  • base_dd_max:38117.19
 
Simple Action Stats Execute Interval
Mage_Fire_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Fire_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 238.34sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Combustion 4.3 79.55sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
 
Flame On 4.6 76.48sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Fire_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Fire_T19M
  • harmful:false
  • if_expr:
 
Phoenix's Flames (_splash) 13.5 22.95sec

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.54 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.7 37.78sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.71 0.00 0.00 0.00 1.2866 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 238.5sec 238.5sec 6.52% 22.50% 0.0(0.0) 1.9

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 34.20% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 4.3 0.0 79.6sec 79.6sec 14.18% 90.70% 85.0(85.0) 4.2

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 19.0 5.1 14.4sec 11.3sec 28.63% 30.15% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:24.21%
  • enhanced_pyrotechnics_2:3.97%
  • enhanced_pyrotechnics_3:0.45%
  • enhanced_pyrotechnics_4:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 86.7 0.0 3.5sec 3.5sec 40.15% 47.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:40.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 77.9 0.0 3.9sec 3.9sec 23.34% 86.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:23.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Kael'thas's Ultimate Ability (kaelthas_ultimate_ability) 13.1 3.8 22.8sec 17.5sec 32.01% 32.01% 3.8(3.8) 0.1

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_kaelthas_ultimate_ability
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • kaelthas_ultimate_ability_1:32.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209455
  • name:Kael'thas's Ultimate Ability
  • tooltip:Increases the damage of your next non-instant Pyroblast by {$s1=300}%.
  • description:{$@spelldesc209450=After consuming Hot Streak, there is a {$s1=20}% chance that your next non-instant Pyroblast cast within {$209455d=15 seconds} deals {$209455s1=300}% additional damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Maddening Whispers 2.4 0.0 158.5sec 158.5sec 4.94% 4.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.78%
  • maddening_whispers_2:0.59%
  • maddening_whispers_3:0.47%
  • maddening_whispers_4:0.45%
  • maddening_whispers_5:0.47%
  • maddening_whispers_6:0.45%
  • maddening_whispers_7:0.47%
  • maddening_whispers_8:0.45%
  • maddening_whispers_9:0.50%
  • maddening_whispers_10:0.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222046
  • name:Maddening Whispers
  • tooltip:Your damaging spells transfer a Maddening Whisper to the target. When all Whispers have been applied, each deals $s~1 Shadow damage.
  • description:Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.
  • max_stacks:10
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 77.4sec 0.0sec 19.62% 19.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 36.9 138.1 8.1sec 1.7sec 73.28% 100.00% 62.9(62.9) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:19.38%
  • pyretic_incantation_2:10.83%
  • pyretic_incantation_3:4.62%
  • pyretic_incantation_4:8.07%
  • pyretic_incantation_5:30.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.7 0.0 37.8sec 37.8sec 28.23% 28.23% 0.0(0.0) 7.9

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=10}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Fire_T19M
combustion Mana 4.3 476089.9 110000.0 109997.8 0.0
fire_blast Mana 36.4 399874.4 11000.0 11000.1 19.8
fireball Mana 75.7 1665148.6 22000.0 22000.4 6.6
pyroblast Mana 98.2 2700088.7 27500.0 27782.8 19.3
scorch Mana 0.7 7722.4 11000.0 10997.1 7.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 357.52 4948437.60 (100.00%) 13841.04 404.06 0.01%
Resource RPS-Gain RPS-Loss
Mana 16459.45 17458.92
Combat End Resource Mean Min Max
Mana 798669.19 471707.50 1090375.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.0%

Procs

Count Interval
Heating Up generated 86.7 3.5sec
Heating Up removed 8.3 30.4sec
IB conversions of HU 33.9 8.9sec
Total Hot Streak procs 77.9 3.9sec
Hot Streak spells used 224.1 1.3sec
Hot Streak spell crits 175.0 1.7sec
Wasted Hot Streak spell crits 10.5 25.4sec
Direct Ignite applications 1.0 0.0sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Mage_Fire_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Mage_Fire_T19M Damage Per Second
Count 7499
Mean 430629.35
Minimum 364667.83
Maximum 494400.63
Spread ( max - min ) 129732.80
Range [ ( max - min ) / 2 * 100% ] 15.06%
Standard Deviation 18076.3883
5th Percentile 401958.48
95th Percentile 461196.51
( 95th Percentile - 5th Percentile ) 59238.03
Mean Distribution
Standard Deviation 208.7421
95.00% Confidence Intervall ( 430220.22 - 431038.48 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 67
0.1% Error 6768
0.1 Scale Factor Error with Delta=300 2789375
0.05 Scale Factor Error with Delta=300 11157502
0.01 Scale Factor Error with Delta=300 278937555
Priority Target DPS
Sample Data Mage_Fire_T19M Priority Target Damage Per Second
Count 7499
Mean 430629.35
Minimum 364667.83
Maximum 494400.63
Spread ( max - min ) 129732.80
Range [ ( max - min ) / 2 * 100% ] 15.06%
Standard Deviation 18076.3883
5th Percentile 401958.48
95th Percentile 461196.51
( 95th Percentile - 5th Percentile ) 59238.03
Mean Distribution
Standard Deviation 208.7421
95.00% Confidence Intervall ( 430220.22 - 431038.48 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 67
0.1% Error 6768
0.1 Scale Factor Error with Delta=300 2789375
0.05 Scale Factor Error with Delta=300 11157502
0.01 Scale Factor Error with Delta=300 278937555
DPS(e)
Sample Data Mage_Fire_T19M Damage Per Second (Effective)
Count 7499
Mean 430629.35
Minimum 364667.83
Maximum 494400.63
Spread ( max - min ) 129732.80
Range [ ( max - min ) / 2 * 100% ] 15.06%
Damage
Sample Data Mage_Fire_T19M Damage
Count 7499
Mean 129263557.59
Minimum 92232568.57
Maximum 168391395.91
Spread ( max - min ) 76158827.33
Range [ ( max - min ) / 2 * 100% ] 29.46%
DTPS
Sample Data Mage_Fire_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mage_Fire_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mage_Fire_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mage_Fire_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mage_Fire_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mage_Fire_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Mage_Fire_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mage_Fire_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.combustion.down
7 4.59 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
8 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
9 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
A 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
B 4.59 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
0.00 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
0.00 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
C 4.17 rune_of_power,if=buff.combustion.down
D 0.00 call_action_list,name=active_talents
E 4.33 combustion
F 1.00 potion,name=deadly_grace
0.00 blood_fury
G 1.97 berserking
0.00 arcane_torrent
H 1.36 use_item,slot=neck
I 2.36 use_item,slot=trinket2
J 28.91 pyroblast,if=buff.hot_streak.up
K 17.59 fire_blast,if=buff.heating_up.up
L 8.68 phoenixs_flames
M 0.73 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase
# count action,conditions
0.00 rune_of_power
N 13.73 pyroblast,if=buff.hot_streak.up
O 0.00 call_action_list,name=active_talents
P 3.21 pyroblast,if=buff.kaelthas_ultimate_ability.react
Q 6.95 fire_blast,if=!prev_off_gcd.fire_blast
R 4.91 phoenixs_flames,if=!prev_gcd.phoenixs_flames
0.00 scorch,if=target.health.pct<=25&equipped.132454
S 7.54 fireball
actions.single_target
# count action,conditions
T 0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
0.00 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
U 38.11 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
V 13.41 pyroblast,if=buff.kaelthas_ultimate_ability.react
W 0.00 call_action_list,name=active_talents
X 0.00 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
Y 11.81 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
Z 0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
a 68.39 fireball

Sample Sequence

01256CEGHILKJKBJKJKJLJLJMJKJ7PSSSNQNSaaUaaUaUaUaUVVaYUVVaYUaYUaUaaaaUaUaUaaCEFKJKBJKJKJLJLJaaUaUVYaUaaaUYaUaa7NQRNRNQNSSaaaaaYUaUVaUaaUaaaaCEIJKJKBJKJKJLJLUVaUaaaYUaaaaaYUa7QRNSSRNQNaaUaUaaYUaaUaaaaaaUVaCEGJKJKBJKJKJLJMJVaaaaYUaaUaaUVV7PQNQRNPBYaUa7QNRNPQN

Sample Sequence Table

time name target resources buffs
Pre flask Mage_Fire_T19M 1100000.0/1100000: 100% mana
Pre food Mage_Fire_T19M 1100000.0/1100000: 100% mana
Pre augmentation Mage_Fire_T19M 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:01.321 combustion Fluffy_Pillow 1094296.5/1100000: 99% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:01.321 berserking Fluffy_Pillow 984296.5/1100000: 89% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:01.321 use_item_sorcerous_shadowruby_pendant Fluffy_Pillow 984296.5/1100000: 89% mana bloodlust, berserking, combustion, rune_of_power, potion_of_deadly_grace
0:01.321 use_item_wriggling_sinew Fluffy_Pillow 984296.5/1100000: 89% mana bloodlust, berserking, combustion, rune_of_power, potion_of_deadly_grace
0:01.321 phoenixs_flames Fluffy_Pillow 984296.5/1100000: 89% mana bloodlust, berserking, combustion, rune_of_power, maddening_whispers(10), potion_of_deadly_grace
0:02.208 fire_blast Fluffy_Pillow 998932.0/1100000: 91% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation, rune_of_power, maddening_whispers(9), potion_of_deadly_grace
0:02.208 pyroblast Fluffy_Pillow 987932.0/1100000: 90% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(2), rune_of_power, maddening_whispers(8), potion_of_deadly_grace
0:03.095 fire_blast Fluffy_Pillow 975067.5/1100000: 89% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(3), rune_of_power, maddening_whispers(7), potion_of_deadly_grace
0:03.095 flame_on Fluffy_Pillow 964067.5/1100000: 88% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(6), potion_of_deadly_grace
0:03.095 pyroblast Fluffy_Pillow 964067.5/1100000: 88% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(6), potion_of_deadly_grace
0:03.981 fire_blast Fluffy_Pillow 951186.5/1100000: 86% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(5), potion_of_deadly_grace
0:03.981 pyroblast Fluffy_Pillow 940186.5/1100000: 85% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(4), potion_of_deadly_grace
0:04.867 fire_blast Fluffy_Pillow 927305.5/1100000: 84% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(3), potion_of_deadly_grace
0:04.867 pyroblast Fluffy_Pillow 916305.5/1100000: 83% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(2), potion_of_deadly_grace
0:05.753 phoenixs_flames Fluffy_Pillow 903424.5/1100000: 82% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers, potion_of_deadly_grace
0:06.639 pyroblast Fluffy_Pillow 918043.5/1100000: 83% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:07.523 phoenixs_flames Fluffy_Pillow 905129.5/1100000: 82% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:08.410 pyroblast Fluffy_Pillow 919765.0/1100000: 84% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:09.295 scorch Fluffy_Pillow 906867.5/1100000: 82% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:10.180 pyroblast Fluffy_Pillow 910470.0/1100000: 83% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:11.066 fire_blast Fluffy_Pillow 897589.0/1100000: 82% mana bloodlust, berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:11.066 pyroblast Fluffy_Pillow 886589.0/1100000: 81% mana bloodlust, berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:12.047 rune_of_power Fluffy_Pillow 875275.5/1100000: 80% mana bloodlust, heating_up, pyretic_incantation(5), kaelthas_ultimate_ability, potion_of_deadly_grace
0:13.064 pyroblast Fluffy_Pillow 892056.0/1100000: 81% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, potion_of_deadly_grace
0:16.108 fireball Fluffy_Pillow 914782.0/1100000: 83% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:17.359 fireball Fluffy_Pillow 913423.5/1100000: 83% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:18.610 fireball Fluffy_Pillow 912065.0/1100000: 83% mana bloodlust, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:19.861 pyroblast Fluffy_Pillow 910706.5/1100000: 83% mana bloodlust, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:20.878 fire_blast Fluffy_Pillow 899987.0/1100000: 82% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:20.878 pyroblast Fluffy_Pillow 888987.0/1100000: 81% mana bloodlust, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:21.895 fireball Fluffy_Pillow 878267.5/1100000: 80% mana bloodlust, enhanced_pyrotechnics, rune_of_power, potion_of_deadly_grace
0:23.145 fireball Fluffy_Pillow 876892.5/1100000: 80% mana bloodlust, enhanced_pyrotechnics, potion_of_deadly_grace
0:24.395 fireball Fluffy_Pillow 875517.5/1100000: 80% mana bloodlust, heating_up, pyretic_incantation, potion_of_deadly_grace
0:25.646 pyroblast Fluffy_Pillow 874159.0/1100000: 79% mana bloodlust, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
0:26.663 fireball Fluffy_Pillow 863439.5/1100000: 78% mana bloodlust, heating_up, potion_of_deadly_grace
0:27.913 fireball Fluffy_Pillow 862064.5/1100000: 78% mana bloodlust, heating_up, potion_of_deadly_grace
0:29.165 pyroblast Fluffy_Pillow 860722.5/1100000: 78% mana bloodlust, hot_streak, pyretic_incantation
0:30.183 fireball Fluffy_Pillow 850019.5/1100000: 77% mana bloodlust, hot_streak, pyretic_incantation(3)
0:31.434 pyroblast Fluffy_Pillow 848661.0/1100000: 77% mana bloodlust, hot_streak, pyretic_incantation(3)
0:32.452 fireball Fluffy_Pillow 837958.0/1100000: 76% mana bloodlust, hot_streak, pyretic_incantation(5)
0:33.702 pyroblast Fluffy_Pillow 836583.0/1100000: 76% mana bloodlust, hot_streak, pyretic_incantation(5)
0:34.721 fireball Fluffy_Pillow 825896.5/1100000: 75% mana bloodlust, hot_streak, pyretic_incantation(5)
0:35.971 pyroblast Fluffy_Pillow 824521.5/1100000: 75% mana bloodlust, hot_streak, pyretic_incantation(5)
0:36.987 pyroblast Fluffy_Pillow 813785.5/1100000: 74% mana bloodlust, hot_streak, pyretic_incantation(5), kaelthas_ultimate_ability
0:38.004 pyroblast Fluffy_Pillow 803066.0/1100000: 73% mana bloodlust, kaelthas_ultimate_ability
0:41.049 fireball Fluffy_Pillow 825808.5/1100000: 75% mana
0:42.673 fire_blast Fluffy_Pillow 830604.5/1100000: 76% mana heating_up, pyretic_incantation
0:42.673 pyroblast Fluffy_Pillow 819604.5/1100000: 75% mana hot_streak, pyretic_incantation(2)
0:43.995 pyroblast Fluffy_Pillow 813917.5/1100000: 74% mana hot_streak, pyretic_incantation(4), kaelthas_ultimate_ability
0:45.316 pyroblast Fluffy_Pillow 808214.0/1100000: 73% mana kaelthas_ultimate_ability
0:49.273 fireball Fluffy_Pillow 846004.5/1100000: 77% mana
0:50.896 fire_blast Fluffy_Pillow 850784.0/1100000: 77% mana heating_up, pyretic_incantation
0:50.896 pyroblast Fluffy_Pillow 839784.0/1100000: 76% mana hot_streak, pyretic_incantation(2)
0:52.217 fireball Fluffy_Pillow 834080.5/1100000: 76% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
0:53.841 fire_blast Fluffy_Pillow 838876.5/1100000: 76% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
0:53.841 pyroblast Fluffy_Pillow 827876.5/1100000: 75% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
0:55.162 fireball Fluffy_Pillow 822173.0/1100000: 75% mana hot_streak, pyretic_incantation(4)
0:56.785 pyroblast Fluffy_Pillow 826952.5/1100000: 75% mana hot_streak, pyretic_incantation(4)
0:58.106 fireball Fluffy_Pillow 821249.0/1100000: 75% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
0:59.730 fireball Fluffy_Pillow 826045.0/1100000: 75% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:01.355 fireball Fluffy_Pillow 830857.5/1100000: 76% mana enhanced_pyrotechnics(2)
1:02.980 fireball Fluffy_Pillow 835670.0/1100000: 76% mana heating_up, pyretic_incantation
1:04.603 pyroblast Fluffy_Pillow 840449.5/1100000: 76% mana hot_streak, pyretic_incantation(2)
1:05.926 fireball Fluffy_Pillow 834779.0/1100000: 76% mana hot_streak, pyretic_incantation(4)
1:07.549 pyroblast Fluffy_Pillow 839558.5/1100000: 76% mana hot_streak, pyretic_incantation(4)
1:08.871 fireball Fluffy_Pillow 833871.5/1100000: 76% mana hot_streak, pyretic_incantation(5)
1:10.496 pyroblast Fluffy_Pillow 838684.0/1100000: 76% mana hot_streak, pyretic_incantation(5)
1:11.816 fireball Fluffy_Pillow 832964.0/1100000: 76% mana enhanced_pyrotechnics
1:13.439 fireball Fluffy_Pillow 837743.5/1100000: 76% mana enhanced_pyrotechnics
1:15.063 rune_of_power Fluffy_Pillow 842539.5/1100000: 77% mana enhanced_pyrotechnics(2)
1:16.386 combustion Fluffy_Pillow 864369.0/1100000: 79% mana heating_up, pyretic_incantation, rune_of_power
1:16.386 potion Fluffy_Pillow 754369.0/1100000: 69% mana combustion, heating_up, pyretic_incantation, rune_of_power
1:16.386 fire_blast Fluffy_Pillow 754369.0/1100000: 69% mana combustion, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
1:16.386 pyroblast Fluffy_Pillow 743369.0/1100000: 68% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
1:17.707 fire_blast Fluffy_Pillow 737665.5/1100000: 67% mana combustion, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
1:17.707 flame_on Fluffy_Pillow 726665.5/1100000: 66% mana combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
1:17.707 pyroblast Fluffy_Pillow 726665.5/1100000: 66% mana combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
1:19.030 fire_blast Fluffy_Pillow 720995.0/1100000: 66% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:19.030 pyroblast Fluffy_Pillow 709995.0/1100000: 65% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:20.353 fire_blast Fluffy_Pillow 704324.5/1100000: 64% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:20.353 pyroblast Fluffy_Pillow 693324.5/1100000: 63% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:21.675 phoenixs_flames Fluffy_Pillow 687637.5/1100000: 63% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:22.997 pyroblast Fluffy_Pillow 709450.5/1100000: 64% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:24.319 phoenixs_flames Fluffy_Pillow 703763.5/1100000: 64% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:25.640 pyroblast Fluffy_Pillow 725560.0/1100000: 66% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:26.963 fireball Fluffy_Pillow 719889.5/1100000: 65% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:28.590 fireball Fluffy_Pillow 724735.0/1100000: 66% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:30.215 pyroblast Fluffy_Pillow 729547.5/1100000: 66% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:31.536 fireball Fluffy_Pillow 723844.0/1100000: 66% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:33.160 pyroblast Fluffy_Pillow 728640.0/1100000: 66% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:34.480 pyroblast Fluffy_Pillow 722920.0/1100000: 66% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, kaelthas_ultimate_ability, potion_of_deadly_grace
1:38.438 fire_blast Fluffy_Pillow 760727.0/1100000: 69% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
1:38.438 fireball Fluffy_Pillow 749727.0/1100000: 68% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:40.064 pyroblast Fluffy_Pillow 754556.0/1100000: 69% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(3), potion_of_deadly_grace
1:41.386 fireball Fluffy_Pillow 748869.0/1100000: 68% mana enhanced_pyrotechnics(2), potion_of_deadly_grace
1:43.011 fireball Fluffy_Pillow 753681.5/1100000: 69% mana enhanced_pyrotechnics(2), potion_of_deadly_grace
1:44.637 fireball Fluffy_Pillow 758510.5/1100000: 69% mana heating_up, pyretic_incantation, potion_of_deadly_grace
1:46.261 pyroblast Fluffy_Pillow 763306.5/1100000: 69% mana hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:47.583 fire_blast Fluffy_Pillow 757619.5/1100000: 69% mana heating_up
1:47.583 fireball Fluffy_Pillow 746619.5/1100000: 68% mana hot_streak, pyretic_incantation
1:49.209 pyroblast Fluffy_Pillow 751448.5/1100000: 68% mana hot_streak, pyretic_incantation
1:50.529 fireball Fluffy_Pillow 745728.5/1100000: 68% mana heating_up
1:52.154 fireball Fluffy_Pillow 750541.0/1100000: 68% mana heating_up
1:53.778 rune_of_power Fluffy_Pillow 755337.0/1100000: 69% mana hot_streak, pyretic_incantation
1:55.098 pyroblast Fluffy_Pillow 777117.0/1100000: 71% mana hot_streak, pyretic_incantation(2), rune_of_power
1:56.419 fire_blast Fluffy_Pillow 771413.5/1100000: 70% mana rune_of_power
1:56.419 phoenixs_flames Fluffy_Pillow 760413.5/1100000: 69% mana heating_up, pyretic_incantation, rune_of_power
1:57.741 pyroblast Fluffy_Pillow 782226.5/1100000: 71% mana hot_streak, pyretic_incantation(2), rune_of_power
1:59.063 phoenixs_flames Fluffy_Pillow 776539.5/1100000: 71% mana heating_up, pyretic_incantation(3), rune_of_power
2:00.385 pyroblast Fluffy_Pillow 798352.5/1100000: 73% mana hot_streak, pyretic_incantation(4), rune_of_power
2:01.708 fire_blast Fluffy_Pillow 792682.0/1100000: 72% mana heating_up, pyretic_incantation(5), rune_of_power
2:01.708 pyroblast Fluffy_Pillow 781682.0/1100000: 71% mana hot_streak, pyretic_incantation(5), rune_of_power
2:03.029 fireball Fluffy_Pillow 775978.5/1100000: 71% mana heating_up, pyretic_incantation(5), rune_of_power
2:04.654 fireball Fluffy_Pillow 780791.0/1100000: 71% mana heating_up, pyretic_incantation(5), rune_of_power
2:06.279 fireball Fluffy_Pillow 785603.5/1100000: 71% mana enhanced_pyrotechnics
2:07.903 fireball Fluffy_Pillow 790399.5/1100000: 72% mana heating_up, pyretic_incantation
2:09.527 fireball Fluffy_Pillow 795195.5/1100000: 72% mana enhanced_pyrotechnics
2:11.152 fireball Fluffy_Pillow 800008.0/1100000: 73% mana heating_up, pyretic_incantation
2:12.776 fireball Fluffy_Pillow 804804.0/1100000: 73% mana enhanced_pyrotechnics
2:14.402 fire_blast Fluffy_Pillow 809633.0/1100000: 74% mana heating_up, pyretic_incantation
2:14.402 pyroblast Fluffy_Pillow 798633.0/1100000: 73% mana hot_streak, pyretic_incantation(2)
2:15.724 fireball Fluffy_Pillow 792946.0/1100000: 72% mana hot_streak, pyretic_incantation(4)
2:17.349 pyroblast Fluffy_Pillow 797758.5/1100000: 73% mana hot_streak, pyretic_incantation(4)
2:18.671 pyroblast Fluffy_Pillow 792071.5/1100000: 72% mana heating_up, kaelthas_ultimate_ability
2:22.628 fireball Fluffy_Pillow 829862.0/1100000: 75% mana heating_up
2:24.254 pyroblast Fluffy_Pillow 834691.0/1100000: 76% mana hot_streak, pyretic_incantation
2:25.575 fireball Fluffy_Pillow 828987.5/1100000: 75% mana heating_up
2:27.199 fireball Fluffy_Pillow 833783.5/1100000: 76% mana heating_up
2:28.822 pyroblast Fluffy_Pillow 838563.0/1100000: 76% mana hot_streak, pyretic_incantation
2:30.144 fireball Fluffy_Pillow 832876.0/1100000: 76% mana enhanced_pyrotechnics
2:31.770 fireball Fluffy_Pillow 837705.0/1100000: 76% mana enhanced_pyrotechnics
2:33.395 fireball Fluffy_Pillow 842517.5/1100000: 77% mana heating_up, pyretic_incantation
2:35.019 fireball Fluffy_Pillow 847313.5/1100000: 77% mana enhanced_pyrotechnics
2:36.644 rune_of_power Fluffy_Pillow 852126.0/1100000: 77% mana heating_up, pyretic_incantation
2:37.966 combustion Fluffy_Pillow 873939.0/1100000: 79% mana hot_streak, pyretic_incantation(2), rune_of_power
2:37.966 use_item_wriggling_sinew Fluffy_Pillow 763939.0/1100000: 69% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power
2:37.966 pyroblast Fluffy_Pillow 763939.0/1100000: 69% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power, maddening_whispers(10)
2:39.286 fire_blast Fluffy_Pillow 758219.0/1100000: 69% mana combustion, heating_up, pyretic_incantation(3), rune_of_power, maddening_whispers(9)
2:39.286 pyroblast Fluffy_Pillow 747219.0/1100000: 68% mana combustion, hot_streak, pyretic_incantation(4), rune_of_power, maddening_whispers(8)
2:40.606 fire_blast Fluffy_Pillow 741499.0/1100000: 67% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(7)
2:40.606 flame_on Fluffy_Pillow 730499.0/1100000: 66% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(6)
2:40.606 pyroblast Fluffy_Pillow 730499.0/1100000: 66% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(6)
2:41.928 fire_blast Fluffy_Pillow 724812.0/1100000: 66% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(5)
2:41.928 pyroblast Fluffy_Pillow 713812.0/1100000: 65% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(4)
2:43.248 fire_blast Fluffy_Pillow 708092.0/1100000: 64% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(3)
2:43.248 pyroblast Fluffy_Pillow 697092.0/1100000: 63% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers(2)
2:44.570 phoenixs_flames Fluffy_Pillow 691405.0/1100000: 63% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability, maddening_whispers
2:45.892 pyroblast Fluffy_Pillow 713218.0/1100000: 65% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
2:47.214 phoenixs_flames Fluffy_Pillow 707531.0/1100000: 64% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
2:48.535 pyroblast Fluffy_Pillow 729327.5/1100000: 66% mana hot_streak, pyretic_incantation(5), kaelthas_ultimate_ability
2:49.858 pyroblast Fluffy_Pillow 723657.0/1100000: 66% mana heating_up, pyretic_incantation(5), kaelthas_ultimate_ability
2:53.817 fireball Fluffy_Pillow 761480.5/1100000: 69% mana heating_up, pyretic_incantation(5)
2:55.442 pyroblast Fluffy_Pillow 766293.0/1100000: 70% mana hot_streak, pyretic_incantation(5)
2:56.764 fireball Fluffy_Pillow 760606.0/1100000: 69% mana enhanced_pyrotechnics
2:58.389 fireball Fluffy_Pillow 765418.5/1100000: 70% mana enhanced_pyrotechnics
3:00.013 fireball Fluffy_Pillow 770214.5/1100000: 70% mana enhanced_pyrotechnics(2)
3:01.638 fire_blast Fluffy_Pillow 775027.0/1100000: 70% mana heating_up, pyretic_incantation
3:01.638 pyroblast Fluffy_Pillow 764027.0/1100000: 69% mana hot_streak, pyretic_incantation(2)
3:02.957 fireball Fluffy_Pillow 758290.5/1100000: 69% mana heating_up
3:04.580 fireball Fluffy_Pillow 763070.0/1100000: 69% mana heating_up
3:06.203 fireball Fluffy_Pillow 767849.5/1100000: 70% mana enhanced_pyrotechnics
3:07.828 fireball Fluffy_Pillow 772662.0/1100000: 70% mana heating_up, pyretic_incantation
3:09.451 fireball Fluffy_Pillow 777441.5/1100000: 71% mana enhanced_pyrotechnics
3:11.075 fire_blast Fluffy_Pillow 782237.5/1100000: 71% mana heating_up, pyretic_incantation
3:11.075 pyroblast Fluffy_Pillow 771237.5/1100000: 70% mana hot_streak, pyretic_incantation(2)
3:12.396 fireball Fluffy_Pillow 765534.0/1100000: 70% mana heating_up
3:14.020 rune_of_power Fluffy_Pillow 770330.0/1100000: 70% mana heating_up
3:15.341 fire_blast Fluffy_Pillow 792126.5/1100000: 72% mana enhanced_pyrotechnics, rune_of_power
3:15.341 phoenixs_flames Fluffy_Pillow 781126.5/1100000: 71% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
3:16.662 pyroblast Fluffy_Pillow 802923.0/1100000: 73% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
3:17.983 fireball Fluffy_Pillow 797219.5/1100000: 72% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power
3:19.607 fireball Fluffy_Pillow 802015.5/1100000: 73% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power
3:21.231 phoenixs_flames Fluffy_Pillow 806811.5/1100000: 73% mana enhanced_pyrotechnics(2), rune_of_power
3:22.553 pyroblast Fluffy_Pillow 828624.5/1100000: 75% mana hot_streak, pyretic_incantation(2), rune_of_power
3:23.874 fire_blast Fluffy_Pillow 822921.0/1100000: 75% mana heating_up, pyretic_incantation(3), rune_of_power
3:24.101 pyroblast Fluffy_Pillow 815666.5/1100000: 74% mana hot_streak, pyretic_incantation(4), rune_of_power
3:25.421 fireball Fluffy_Pillow 809946.5/1100000: 74% mana heating_up, pyretic_incantation(5)
3:27.044 fireball Fluffy_Pillow 814726.0/1100000: 74% mana heating_up, pyretic_incantation(5)
3:28.668 pyroblast Fluffy_Pillow 819522.0/1100000: 75% mana hot_streak, pyretic_incantation(5)
3:29.991 fireball Fluffy_Pillow 813851.5/1100000: 74% mana hot_streak, pyretic_incantation(5)
3:31.615 pyroblast Fluffy_Pillow 818647.5/1100000: 74% mana hot_streak, pyretic_incantation(5)
3:32.937 fireball Fluffy_Pillow 812960.5/1100000: 74% mana enhanced_pyrotechnics
3:34.562 fireball Fluffy_Pillow 817773.0/1100000: 74% mana enhanced_pyrotechnics
3:36.185 fire_blast Fluffy_Pillow 822552.5/1100000: 75% mana heating_up, pyretic_incantation
3:36.185 pyroblast Fluffy_Pillow 811552.5/1100000: 74% mana hot_streak, pyretic_incantation(2)
3:37.507 fireball Fluffy_Pillow 805865.5/1100000: 73% mana heating_up
3:39.133 fireball Fluffy_Pillow 810694.5/1100000: 74% mana heating_up
3:40.758 pyroblast Fluffy_Pillow 815507.0/1100000: 74% mana hot_streak, pyretic_incantation
3:42.079 fireball Fluffy_Pillow 809803.5/1100000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:43.702 fireball Fluffy_Pillow 814583.0/1100000: 74% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:45.326 fireball Fluffy_Pillow 819379.0/1100000: 74% mana enhanced_pyrotechnics(2)
3:46.950 fireball Fluffy_Pillow 824175.0/1100000: 75% mana heating_up, pyretic_incantation
3:48.575 fireball Fluffy_Pillow 828987.5/1100000: 75% mana enhanced_pyrotechnics
3:50.199 fireball Fluffy_Pillow 833783.5/1100000: 76% mana heating_up, pyretic_incantation
3:51.823 pyroblast Fluffy_Pillow 838579.5/1100000: 76% mana hot_streak, pyretic_incantation(2)
3:53.147 pyroblast Fluffy_Pillow 832925.5/1100000: 76% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, kaelthas_ultimate_ability
3:57.105 fireball Fluffy_Pillow 870732.5/1100000: 79% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:58.731 rune_of_power Fluffy_Pillow 875561.5/1100000: 80% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
4:00.054 combustion Fluffy_Pillow 897391.0/1100000: 82% mana hot_streak, pyretic_incantation(3), rune_of_power
4:00.054 berserking Fluffy_Pillow 787391.0/1100000: 72% mana combustion, hot_streak, pyretic_incantation(3), rune_of_power
4:00.054 pyroblast Fluffy_Pillow 787391.0/1100000: 72% mana berserking, combustion, hot_streak, pyretic_incantation(3), rune_of_power
4:01.206 fire_blast Fluffy_Pillow 778899.0/1100000: 71% mana berserking, combustion, heating_up, pyretic_incantation(4), rune_of_power
4:01.206 pyroblast Fluffy_Pillow 767899.0/1100000: 70% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:02.356 fire_blast Fluffy_Pillow 759374.0/1100000: 69% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power
4:02.356 flame_on Fluffy_Pillow 748374.0/1100000: 68% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:02.356 pyroblast Fluffy_Pillow 748374.0/1100000: 68% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:03.506 fire_blast Fluffy_Pillow 739849.0/1100000: 67% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power
4:03.506 pyroblast Fluffy_Pillow 728849.0/1100000: 66% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:04.657 fire_blast Fluffy_Pillow 720340.5/1100000: 65% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:04.657 pyroblast Fluffy_Pillow 709340.5/1100000: 64% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:05.807 phoenixs_flames Fluffy_Pillow 700815.5/1100000: 64% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:06.957 pyroblast Fluffy_Pillow 719790.5/1100000: 65% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:08.109 scorch Fluffy_Pillow 711298.5/1100000: 65% mana berserking, combustion, heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:09.261 pyroblast Fluffy_Pillow 719306.5/1100000: 65% mana berserking, combustion, hot_streak, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:10.465 pyroblast Fluffy_Pillow 711672.5/1100000: 65% mana heating_up, pyretic_incantation(5), kaelthas_ultimate_ability
4:14.423 fireball Fluffy_Pillow 749479.5/1100000: 68% mana heating_up, pyretic_incantation(5)
4:16.048 fireball Fluffy_Pillow 754292.0/1100000: 69% mana
4:17.672 fireball Fluffy_Pillow 759088.0/1100000: 69% mana heating_up, pyretic_incantation
4:19.295 fireball Fluffy_Pillow 763867.5/1100000: 69% mana enhanced_pyrotechnics
4:20.919 fire_blast Fluffy_Pillow 768663.5/1100000: 70% mana heating_up, pyretic_incantation
4:20.919 pyroblast Fluffy_Pillow 757663.5/1100000: 69% mana hot_streak, pyretic_incantation(2)
4:22.240 fireball Fluffy_Pillow 751960.0/1100000: 68% mana heating_up
4:23.865 fireball Fluffy_Pillow 756772.5/1100000: 69% mana heating_up
4:25.490 pyroblast Fluffy_Pillow 761585.0/1100000: 69% mana hot_streak, pyretic_incantation
4:26.810 fireball Fluffy_Pillow 755865.0/1100000: 69% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:28.434 fireball Fluffy_Pillow 760661.0/1100000: 69% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
4:30.058 pyroblast Fluffy_Pillow 765457.0/1100000: 70% mana hot_streak, pyretic_incantation(2)
4:31.379 pyroblast Fluffy_Pillow 759753.5/1100000: 69% mana hot_streak, pyretic_incantation(4), kaelthas_ultimate_ability
4:32.701 pyroblast Fluffy_Pillow 754066.5/1100000: 69% mana hot_streak, pyretic_incantation(5), kaelthas_ultimate_ability
4:34.022 rune_of_power Fluffy_Pillow 748363.0/1100000: 68% mana heating_up, pyretic_incantation(5), kaelthas_ultimate_ability
4:35.344 pyroblast Fluffy_Pillow 770176.0/1100000: 70% mana heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
4:39.300 fire_blast Fluffy_Pillow 807950.0/1100000: 73% mana heating_up, pyretic_incantation(5), rune_of_power
4:39.300 pyroblast Fluffy_Pillow 796950.0/1100000: 72% mana hot_streak, pyretic_incantation(5), rune_of_power
4:40.623 fire_blast Fluffy_Pillow 791279.5/1100000: 72% mana rune_of_power
4:40.623 phoenixs_flames Fluffy_Pillow 780279.5/1100000: 71% mana heating_up, pyretic_incantation, rune_of_power
4:41.944 pyroblast Fluffy_Pillow 802076.0/1100000: 73% mana hot_streak, pyretic_incantation(2), rune_of_power
4:43.263 pyroblast Fluffy_Pillow 796339.5/1100000: 72% mana heating_up, pyretic_incantation(3), rune_of_power, kaelthas_ultimate_ability
4:47.221 flame_on Fluffy_Pillow 834146.5/1100000: 76% mana heating_up, pyretic_incantation(3)
4:47.356 fire_blast Fluffy_Pillow 836374.0/1100000: 76% mana heating_up, pyretic_incantation(3)
4:47.356 fireball Fluffy_Pillow 825374.0/1100000: 75% mana hot_streak, pyretic_incantation(4)
4:48.981 pyroblast Fluffy_Pillow 830186.5/1100000: 75% mana hot_streak, pyretic_incantation(5)
4:50.303 fireball Fluffy_Pillow 824499.5/1100000: 75% mana enhanced_pyrotechnics
4:51.928 rune_of_power Fluffy_Pillow 829312.0/1100000: 75% mana enhanced_pyrotechnics
4:53.250 fire_blast Fluffy_Pillow 851125.0/1100000: 77% mana heating_up, pyretic_incantation, rune_of_power
4:53.250 pyroblast Fluffy_Pillow 840125.0/1100000: 76% mana hot_streak, pyretic_incantation(2), rune_of_power
4:54.572 phoenixs_flames Fluffy_Pillow 834438.0/1100000: 76% mana heating_up, pyretic_incantation(3), rune_of_power
4:55.892 pyroblast Fluffy_Pillow 856218.0/1100000: 78% mana hot_streak, pyretic_incantation(4), rune_of_power
4:57.214 pyroblast Fluffy_Pillow 850531.0/1100000: 77% mana heating_up, pyretic_incantation(5), rune_of_power, kaelthas_ultimate_ability
5:01.171 fire_blast Fluffy_Pillow 888321.5/1100000: 81% mana heating_up, pyretic_incantation(5), rune_of_power
5:01.171 pyroblast Fluffy_Pillow 877321.5/1100000: 80% mana hot_streak, pyretic_incantation(5), rune_of_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4876 4551 0
Agility 6579 6254 0
Stamina 41665 41665 25791
Intellect 37385 35678 26656 (965)
Spirit 1 1 0
Health 2499900 2499900 0
Mana 1100000 1100000 0
Spell Power 37385 35678 0
Crit 38.15% 37.07% 11226
Haste 13.81% 13.81% 4488
Damage / Heal Versatility 3.79% 3.79% 1515
ManaReg per Second 16500 16500 0
Mastery 12.42% 12.42% 2995
Armor 1817 1817 1817
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Sorcerous Shadowruby Pendant of the Fireflash
ilevel: 850, stats: { +1094 Sta, +1101 Crit, +734 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Maddening Robe of Secrets
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +981 Mastery, +479 Crit }
Local Waist Pliable Spider Silk Cinch
ilevel: 880, stats: { 163 Armor, +1930 Sta, +1287 Int, +689 Mastery, +406 Crit }
Local Legs Leggings of the Lower Planes
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +1012 Crit, +448 Haste }
Local Feet Crimson Wool-Lined Slippers
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +689 Crit, +406 Mastery }
Local Wrists Marquee Bindings of the Sun King
ilevel: 895, stats: { 134 Armor, +1665 Sta, +1110 Int, +559 Crit, +310 Haste }
Local Hands Oiled Rigger's Handwraps
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Crit, +383 Vers }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Wriggling Sinew
ilevel: 880, stats: { +1043 Crit }
Local Back Windwhipped Sailcloth
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +569 Crit, +252 Vers }, enchant: { +200 Int }
Local Main Hand Felo'melorn
ilevel: 906, weapon: { 2776 - 5157, 2.6 }, stats: { +937 Int, +1405 Sta, +345 Haste, +345 Mastery, +11921 Int }
Local Off Hand Heart of the Phoenix
ilevel: 906, stats: { +1230 Int, +1844 Sta, +627 Haste, +278 Crit }

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Mage_Fire_T19M"
level=110
race=troll
role=spell
position=back
talents=1022021
artifact=54:133022:140813:133022:0:748:1:749:6:750:3:751:3:752:3:753:3:754:3:755:3:756:3:757:3:758:1:759:1:760:1:761:1:762:1:763:1:1340:1
spec=fire

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/use_item,slot=neck
actions.combustion_phase+=/use_item,slot=trinket2
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=sorcerous_shadowruby_pendant,id=130233,bonus_id=1758/689/601/669,gem_id=130219,enchant_id=5439
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=windwhipped_sailcloth,id=142412,bonus_id=1502,enchant=binding_of_intellect
chest=maddening_robe_of_secrets,id=139193,bonus_id=1806
wrists=marquee_bindings_of_the_sun_king,id=132406
hands=oiled_riggers_handwraps,id=142429,bonus_id=1502
waist=pliable_spider_silk_cinch,id=138217,bonus_id=1806
legs=leggings_of_the_lower_planes,id=142413,bonus_id=1502
feet=crimson_woollined_slippers,id=139195,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=binding_of_crit
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_crit
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=wriggling_sinew,id=139326,bonus_id=1806
main_hand=felomelorn,id=128820,ilevel=906
off_hand=heart_of_the_phoenix,id=133959,ilevel=906

# Gear Summary
# gear_ilvl=882.31
# gear_stamina=25791
# gear_intellect=26656
# gear_crit_rating=11226
# gear_haste_rating=4488
# gear_mastery_rating=2995
# gear_versatility_rating=1515
# gear_armor=1817

Mage_Frost_T19M : 436337 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
436336.7 436336.7 274.8 / 0.063% 48288.8 / 11.1% 35.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
10955.8 10955.8 Mana 0.00% 49.4 100.0% 100%
Talents
  • 15: Ray of Frost (Frost Mage)
  • 30: Shimmer
  • 45: Rune of Power
  • 60: Ice Nova (Frost Mage)
  • 75: Ice Floes
  • 90: Frost Bomb (Frost Mage)
  • 100: Comet Storm (Frost Mage)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mage_Frost_T19M 436337
Blizzard 8347 1.9% 8.4 11.68sec 294237 273385 Periodic 66.3 25391 50450 37234 47.3% 12.0%

Stats details: blizzard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.39 0.00 66.30 66.30 1.0763 0.5446 2468666.28 2468666.28 0.00 54691.53 273384.97
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.0 52.74% 25391.19 2164 34323 25415.83 21781 29098 887786 887786 0.00
crit 31.3 47.26% 50450.45 4329 68645 50502.48 41569 59840 1580881 1580881 0.00
 
 

Action details: blizzard

Static Values
  • id:190356
  • school:frost
  • resource:mana
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.potion_of_deadly_grace.up&!prev_off_gcd.water_jet
Spelldata
  • id:190356
  • name:Blizzard
  • school:frost
  • tooltip:
  • description:Ice shards pelt the target area, dealing ${$190357m1*8} Frost damage over $10d and reducing movement speed by {$205708s1=50}% for {$205708d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 

Action details: blizzard_shard

Static Values
  • id:190357
  • school:frost
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190357
  • name:Blizzard
  • school:frost
  • tooltip:
  • description:{$@spelldesc190356=Ice shards pelt the target area, dealing ${$190357m1*8} Frost damage over $10d and reducing movement speed by {$205708s1=50}% for {$205708d=15 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.495000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Comet Storm 0 (13477) 0.0% (3.1%) 9.1 32.93sec 444711 438188

Stats details: comet_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.10 0.00 54.46 0.00 1.0149 0.2000 0.00 0.00 0.00 201044.59 438187.51
 
 

Action details: comet_storm

Static Values
  • id:153595
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:153595
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:Calls down a series of 7 icy comets on and around the target, each of which deals {$153596s1=1} Frost damage to all enemies within 4 yards of its impact.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.20
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Comet Storm (_projectile) 13477 3.1% 63.6 4.28sec 63659 0 Direct 63.4 48606 97182 63868 31.4%  

Stats details: comet_storm_projectile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.56 63.35 0.00 0.00 0.0000 0.0000 4046223.46 4046223.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.45 68.58% 48605.91 40449 72808 48686.41 40919 61106 2111812 2111812 0.00
crit 19.91 31.42% 97181.62 80897 145615 97349.52 80897 126324 1934411 1934411 0.00
 
 

Action details: comet_storm_projectile

Static Values
  • id:153596
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:153596
  • name:Comet Storm
  • school:frost
  • tooltip:
  • description:{$@spelldesc153595=Calls down a series of 7 icy comets on and around the target, each of which deals {$153596s1=1} Frost damage to all enemies within 4 yards of its impact.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.050000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 20995 4.7% 40.5 2.17sec 153125 0 Direct 40.5 116548 232973 153125 31.4%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.54 40.54 0.00 0.00 0.0000 0.0000 6207158.74 6207158.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.80 68.58% 116547.80 81867 147360 116550.74 98240 135080 3240222 3240222 0.00
crit 12.73 31.42% 232972.79 163734 294721 232979.26 163734 294721 2966936 2966936 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Ebonbolt 10398 2.4% 5.9 52.09sec 530272 264996 Direct 5.9 405182 810547 531748 31.2%  

Stats details: ebonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.90 5.88 0.00 0.00 2.0012 0.0000 3126687.08 3126687.08 0.00 264995.94 264995.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.04 68.78% 405181.95 346694 624049 404011.12 0 572045 1638736 1638736 0.00
crit 1.84 31.22% 810547.26 693388 1248099 714973.34 0 1248099 1487951 1487951 0.00
 
 

Action details: ebonbolt

Static Values
  • id:214634
  • school:shadowfrost
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
Spelldata
  • id:214634
  • name:Ebonbolt
  • school:shadowfrost
  • tooltip:
  • description:Deals {$228599s1=0} Shadowfrost damage and grants two charges of Fingers of Frost.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flurry (_bolt) 21063 4.8% 33.9 7.46sec 187649 0 Direct 33.9 110363 220805 187647 70.0%  

Stats details: flurry_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.88 33.88 0.00 0.00 0.0000 0.0000 6357853.86 6357853.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.17 30.02% 110363.24 101205 182168 110332.09 101205 151807 1122642 1122642 0.00
crit 23.71 69.98% 220805.22 202409 364337 220710.80 202409 300241 5235212 5235212 0.00
 
 

Action details: flurry_bolt

Static Values
  • id:228354
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228354
  • name:Flurry
  • school:frost
  • tooltip:Movement slowed by {$s2=70}%.
  • description:{$@spelldesc44614=Unleash a flurry of ice shards, striking the target {$s1=3} times for a total of ${{$228354s1=0 to 2}*$m1} Frost damage. Each shard reduces the target's movement speed by {$228354s2=70}% for {$228354d=1 second}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.523000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
Frost Bomb (_explosion) 21265 4.9% 66.0 4.29sec 96874 0 Direct 66.0 71413 140720 96873 36.7%  

Stats details: frost_bomb_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.03 66.03 0.00 0.00 0.0000 0.0000 6396589.13 6396589.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.77 63.26% 71412.89 60671 109209 71453.89 63459 80895 2983170 2983170 0.00
crit 24.26 36.74% 140719.61 121343 218417 140775.56 121343 165835 3413419 3413419 0.00
 
 

Action details: frost_bomb_explosion

Static Values
  • id:113092
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113092
  • name:Frost Bomb
  • school:frost
  • tooltip:Slowed by $113092s3%.
  • description:{$@spelldesc112948=Places a Frost Bomb on the target for {$d=12 seconds}. Limit 1 target. Your Ice Lances that benefit from Shatter will trigger the release of a wave of freezing ice, dealing {$113092s1=0} Frost damage to the target and {$113092s2=0} Frost damage to all other enemies within $113092A2 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.575000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Frostbolt 38074 (55678) 8.8% (12.8%) 75.1 3.68sec 223671 165442 Direct 75.8 98699 195864 151567 54.4%  

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.09 75.77 0.00 0.00 1.3520 0.0000 11484112.29 11484112.29 0.00 165441.66 165441.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.54 45.59% 98699.17 88985 160173 98701.32 88985 110287 3409092 3409092 0.00
crit 41.23 54.41% 195863.64 177970 320345 195756.88 177970 224439 8075021 8075021 0.00
 
 

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=1} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.100000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Icicle 17604 4.1% 89.5 3.21sec 59323 0 Direct 89.0 59658 0 59658 0.0%  

Stats details: icicle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.52 89.02 0.00 0.00 0.0000 0.0000 5310697.59 5310697.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.02 100.00% 59657.86 29292 210900 59650.26 45161 72696 5310698 5310698 0.00
 
 

Action details: icicle

Static Values
  • id:148022
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:148022
  • name:Icicle
  • school:frost
  • tooltip:
  • description:{$@spelldesc76613=When you damage enemies with Frostbolt, ${$m1}.1% of the damage done is stored as an Icicle for {$148012d=60 seconds}. Also increases the damage done by your Water Elemental by ${$m3}.1%. Casting Ice Lance causes any Icicles stored to begin launching at the target. Up to {$s2=5} Icicles can be stored. Excess Icicles will automatically be launched. }
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:84983.18
  • base_dd_max:84983.18
 
Frozen Orb 0 (5387) 0.0% (1.2%) 5.1 61.66sec 315598 322006

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 0.00 100.30 0.00 0.9801 0.5000 0.00 0.00 0.00 29321.58 322006.26
 
 

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:
  • description:Launches an orb of swirling ice up to {$s1=40} yards forward which deals up to ${20*$84721s2} Frost damage to all enemies it passes through. Grants 1 charge of Fingers of Frost when it first damages an enemy. Enemies damaged by the Frost Orb are slowed by {$205708s1=50}% for {$205708d=15 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Frozen Orb (_bolt) 5387 1.2% 0.0 0.00sec 0 0 Periodic 100.3 12262 24511 16129 31.6% 0.0%

Stats details: frozen_orb_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 100.30 0.0000 0.0000 1617759.47 1617759.47 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.6 68.43% 12261.63 10132 18238 12286.48 10593 15627 841524 841524 0.00
crit 31.7 31.57% 24510.99 20264 36476 24561.15 20725 32335 776236 776236 0.00
 
 

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by {$s1=1}%.
  • description:{$@spelldesc84714=Launches an orb of swirling ice up to {$s1=40} yards forward which deals up to ${20*$84721s2} Frost damage to all enemies it passes through. Grants 1 charge of Fingers of Frost when it first damages an enemy. Enemies damaged by the Frost Orb are slowed by {$205708s1=50}% for {$205708d=15 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.263000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Ice Lance 68794 15.8% 70.1 4.07sec 295584 293952 Direct 69.9 100697 337092 296346 82.8%  

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.05 69.87 0.00 0.00 1.0056 0.0000 20706301.86 20706301.86 0.00 293952.41 293952.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.04 17.24% 100696.68 34400 297214 100235.70 43573 171741 1212802 1212802 0.00
crit 57.83 82.76% 337091.87 82559 713313 337170.67 289949 397254 19493500 19493500 0.00
 
 

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.fingers_of_frost.react=0&prev_gcd.flurry
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:
  • description:Quickly fling a shard of ice at the target, dealing {$228598s1=0} Frost damage{$?s56377=false}[, and ${{$228598s1=0}*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is tripled against frozen targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.893000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Ice Nova 20276 4.6% 10.4 28.93sec 587802 596640 Direct 10.4 431471 824118 587796 39.8%  

Stats details: ice_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.36 10.36 0.00 0.00 0.9852 0.0000 6091690.80 6091690.80 0.00 596639.65 596639.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.24 60.19% 431471.05 346696 624053 432767.88 0 624053 2691304 2691304 0.00
crit 4.13 39.81% 824117.53 693392 1248106 818878.48 0 1248106 3400387 3400387 0.00
 
 

Action details: ice_nova

Static Values
  • id:157997
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.winters_chill.up
Spelldata
  • id:157997
  • name:Ice Nova
  • school:frost
  • tooltip:Frozen.
  • description:Causes a whirl of icy wind around the target enemy or ally, dealing {$s2=1} Frost damage to all enemies within $A2 yards, and freezing them in place for {$d=2 seconds}. A primary enemy target will take {$s1=100}% increased damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Maddening Whispers 12038 2.7% 2.9 115.84sec 1249526 0 Direct 2.9 955551 1890615 1249580 31.4%  

Stats details: maddening_whispers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 2.87 0.00 0.00 0.0000 0.0000 3586950.13 3586950.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1.97 68.56% 955550.79 727664 1309795 919362.82 0 1309795 1880612 1880612 0.00
crit 0.90 31.44% 1890615.48 1455328 2619591 1244021.90 0 2619591 1706338 1706338 0.00
 
 

Action details: maddening_whispers

Static Values
  • id:222050
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222050
  • name:Maddening Whispers
  • school:shadow
  • tooltip:Deals {$222046s1=36653} Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70372.42
  • base_dd_max:70372.42
 
Mark of the Hidden Satyr 10540 2.4% 21.4 14.15sec 148092 0 Direct 21.4 112576 224887 148091 31.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.41 21.41 0.00 0.00 0.0000 0.0000 3170034.95 3170034.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.64 68.38% 112575.56 89706 161470 112480.52 89706 147374 1647723 1647723 0.00
crit 6.77 31.62% 224886.60 179412 322941 224479.93 0 322941 1522312 1522312 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Plague Swarm 17737 4.1% 17.2 17.44sec 309443 0 Periodic 75.8 53573 107039 70411 31.5% 49.6%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.24 0.00 75.78 75.78 0.0000 1.9660 5335717.42 5335717.42 0.00 35814.75 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.9 68.51% 53572.89 23 81338 53598.38 45001 63719 2781353 2781353 0.00
crit 23.9 31.49% 107038.55 45 162677 107107.37 83584 133921 2554365 2554365 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ray of Frost 99556 22.8% 4.5 72.62sec 6636239 653622 Periodic 86.6 262777 525171 345378 31.5% 14.9%

Stats details: ray_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.51 0.00 86.64 86.64 10.1531 0.5153 29922808.12 29922808.12 0.00 653621.85 653621.85
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.4 68.52% 262776.64 66479 404176 261925.00 216508 296027 15599776 15599776 0.00
crit 27.3 31.48% 525171.35 132957 808352 523501.47 383126 661052 14323032 14323032 0.00
 
 

Action details: ray_of_frost

Static Values
  • id:205021
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.icy_veins.up|(cooldown.icy_veins.remains>action.ray_of_frost.cooldown&buff.rune_of_power.down)
Spelldata
  • id:205021
  • name:Ray of Frost
  • school:frost
  • tooltip:Movement slowed by $m1% and taking {$s2=0} Frost damage every $t2 sec.
  • description:For the next {$d=10 seconds}, you can channel a beam of icy power at an enemy, slowing movement by $m1% and dealing {$s2=0} Frost damage every $t2 sec. Each time Ray of Frost deals damage, its damage increases by {$208141s1=20}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.943000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
sorcerous_arcane_blast 1299 0.3% 0.5 302.75sec 795024 0 Direct 0.5 724455 1484624 795244 9.3%  

Stats details: sorcerous_arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.50 0.50 0.00 0.00 0.0000 0.0000 395974.95 395974.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.45 90.71% 724454.60 446233 803220 297403.70 0 803220 327293 327293 0.00
crit 0.05 9.29% 1484623.95 892467 1606441 68157.87 0 1606441 68682 68682 0.00
 
 

Action details: sorcerous_arcane_blast

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:431550.00
  • base_dd_max:431550.00
 
sorcerous_fireball 1943 0.4% 0.5 302.80sec 1235421 0 Direct 0.5 414605 825050 461611 11.5%  
Periodic 5.8 63250 0 63250 0.0% 0.8%

Stats details: sorcerous_fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.48 0.48 5.84 5.84 0.0000 0.4028 589786.18 589786.18 0.00 250759.43 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.42 88.55% 414605.01 254991 458983 161150.02 0 458983 175263 175263 0.00
crit 0.05 11.45% 825049.96 509981 917966 44894.52 0 917966 45109 45109 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.8 100.00% 63250.34 1572 68847 27082.60 0 68847 369414 369414 0.00
 
 

Action details: sorcerous_fireball

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:246600.00
  • base_dd_max:246600.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:36990.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
sorcerous_frostbolt 1215 0.3% 0.5 302.45sec 747807 0 Direct 0.5 687050 1359914 747807 9.0%  

Stats details: sorcerous_frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.49 0.49 0.00 0.00 0.0000 0.0000 369964.65 369964.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.45 90.97% 687049.98 420734 757322 280403.59 0 757322 309214 309214 0.00
crit 0.04 9.03% 1359914.16 841469 1514644 60391.86 0 1514644 60751 60751 0.00
 
 

Action details: sorcerous_frostbolt

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:406890.00
  • base_dd_max:406890.00
 
pet - water_elemental 46329 / 46329
Water Jet 4783 1.1% 9.1 31.75sec 158308 47258 Periodic 36.2 30323 60618 39834 31.4% 8.1%

Stats details: water_jet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.10 0.00 36.15 36.15 3.3499 0.6737 1440185.56 1440185.56 0.00 47257.93 47257.93
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.8 68.60% 30322.79 27111 40667 30360.07 27111 35923 752111 752111 0.00
crit 11.4 31.40% 60618.47 54223 81334 60692.00 54223 81334 688074 688074 0.00
 
 

Action details: water_jet

Static Values
  • id:135029
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:135029
  • name:Water Jet
  • school:frost
  • tooltip:Taking $w1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, {$?s198146=false}[slowing the target by $m2% and ][]dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.706000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Waterbolt 41546 9.5% 165.2 1.81sec 75606 47705 Direct 164.2 57860 115671 76067 31.5%  

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 165.24 164.24 0.00 0.00 1.5849 0.0000 12492999.55 12492999.55 0.00 47705.24 47705.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.51 68.51% 57860.22 49922 74883 57859.86 55382 60494 6510046 6510046 0.00
crit 51.72 31.49% 115670.69 99844 149766 115657.80 105717 125939 5982954 5982954 0.00
 
 

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:
  • description:Deals ${{$s1=0}*0.75} Frost damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Mage_Frost_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Frost_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 180.59sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.05 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Frost_T19M
  • harmful:false
  • if_expr:
 
Flurry 11.3 23.79sec

Stats details: flurry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.34 0.00 33.88 0.00 1.0178 0.2000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flurry

Static Values
  • id:44614
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.brain_freeze.react&buff.fingers_of_frost.react=0&prev_gcd.frostbolt
Spelldata
  • id:44614
  • name:Flurry
  • school:frost
  • tooltip:
  • description:Unleash a flurry of ice shards, striking the target {$s1=3} times for a total of ${{$228354s1=0 to 2}*$m1} Frost damage. Each shard reduces the target's movement speed by {$228354s2=70}% for {$228354d=1 second}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:0.60
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mage_Frost_T19M
  • harmful:false
  • if_expr:
 
Frost Bomb 16.6 17.69sec

Stats details: frost_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.60 0.00 55.69 0.00 1.0065 3.4805 0.00 0.00 0.00 0.00 0.00
 
 

Action details: frost_bomb

Static Values
  • id:112948
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:13750.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.frost_bomb.remains<action.ice_lance.travel_time&buff.fingers_of_frost.react>0
Spelldata
  • id:112948
  • name:Frost Bomb
  • school:frost
  • tooltip:The Mage's Ice Lances that hit the target while frozen will cause the Frost Bomb to release a wave of freezing ice that deals {$113092s1=0} Frost damage to the target, {$113092s2=0} Frost damage to all other enemies within $113092A2 yards.
  • description:Places a Frost Bomb on the target for {$d=12 seconds}. Limit 1 target. Your Ice Lances that benefit from Shatter will trigger the release of a wave of freezing ice, dealing {$113092s1=0} Frost damage to the target and {$113092s2=0} Frost damage to all other enemies within $113092A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:6.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Icy Veins 2.5 149.86sec

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.icy_veins.down
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:Haste increased by $w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=20 seconds}, granting $m1% haste and preventing damage from delaying your spellcasts.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.9 36.88sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.87 0.00 0.00 0.00 0.9706 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.icy_veins.remains<cast_time|charges_fractional>1.9&cooldown.icy_veins.remains>10|buff.icy_veins.up|target.time_to_die.remains+5<charges_fractional*10
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 
Time Warp 2.5 261.97sec

Stats details: time_warp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: time_warp

Static Values
  • id:80353
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:44000.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
Spelldata
  • id:80353
  • name:Time Warp
  • school:arcane
  • tooltip:Haste increased by {$s1=30}%.
  • description:Warp the flow of time, increasing haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies will be unable to benefit from Bloodlust, Heroism, or Time Warp again for {$57724d=600 seconds}.
 
Summon Water Elemental (water_elemental) 1.0 0.00sec

Stats details: water_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: water_elemental

Static Values
  • id:31687
  • school:frost
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:33000.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:31687
  • name:Summon Water Elemental
  • school:frost
  • tooltip:
  • description:Summons a Water Elemental to follow and fight for you.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 180.6sec 180.6sec 6.82% 14.50% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 2.5 1.0 112.2sec 262.0sec 30.88% 40.63% 1.0(1.0) 2.2

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:30.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Brain Freeze 13.5 4.1 20.9sec 15.6sec 24.86% 24.86% 4.1(4.1) 1.8

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_brain_freeze
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • brain_freeze_1:24.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190446
  • name:Brain Freeze
  • tooltip:Your next Flurry is instant cast$?a231584[,][ and] deals {$s2=50}% increased damage$?a231584[, and will cause Winter's Chill on the target][].
  • description:{$@spelldesc190447=Frostbolt has a $m1% chance to empower your next Flurry to be instant cast$?a231584[,][ and] deal {$190446s2=50}% increased damage$?a231584[, and apply Winter's Chill to the target. Winter's Chill causes the target to take damage from your spells as if it were frozen][].}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Chain Reaction 15.6 25.7 18.8sec 6.9sec 54.47% 56.06% 10.4(10.4) 14.9

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_chain_reaction
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • chain_reaction_1:20.51%
  • chain_reaction_2:12.95%
  • chain_reaction_3:21.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:195418
  • name:Chain Reaction
  • tooltip:Increases the damage of your Ice Lance by $m1%.
  • description:Increases the damage of your Ice Lance by $m1%.
  • max_stacks:3
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Chilled to the Core 2.5 0.0 149.8sec 149.8sec 16.02% 16.02% 0.0(0.0) 2.3

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_chilled_to_the_core
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chilled_to_the_core_1:16.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:195446
  • name:Chilled to the Core
  • tooltip:Increases Frost damage by {$s1=20}%.
  • description:Increases Frost damage by {$s1=20}%.
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Fingers of Frost 30.7 31.1 9.6sec 4.7sec 45.09% 88.39% 4.2(4.3) 0.5

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_fingers_of_frost
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • fingers_of_frost_1:23.40%
  • fingers_of_frost_2:14.75%
  • fingers_of_frost_3:6.95%

Trigger Attempt Success

  • trigger_pct:22.05%

Spelldata details

  • id:44544
  • name:Fingers of Frost
  • tooltip:Your next Ice Lance deals damage as if the target were frozen.
  • description:{$@spelldesc112965=Frostbolt and Frozen Orb damage have a {$s1=12}% chance, and Blizzard damage has a {$s2=5}% chance, to grant a charge of Fingers of Frost. Fingers of Frost causes your next Ice Lance to deal damage as if the target were frozen. Maximum {$44544s1=2} charges.}
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Icicle (s) 34.2 56.9 8.9sec 3.1sec 47.19% 47.19% 7.3(7.3) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_icicles
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • icicles_1:20.37%
  • icicles_2:10.43%
  • icicles_3:6.19%
  • icicles_4:3.88%
  • icicles_5:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:148012
  • name:Icicle
  • tooltip:Icicle storing $w1 damage.
  • description:$@spelldesc148011
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Icy Veins 2.5 0.0 149.8sec 149.8sec 16.02% 16.02% 0.0(0.0) 2.3

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • icy_veins_1:16.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:Haste increased by $w1% and immune to pushback.
  • description:Accelerates your spellcasting for {$d=20 seconds}, granting $m1% haste and preventing damage from delaying your spellcasts.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Maddening Whispers 3.0 0.0 120.6sec 120.6sec 13.05% 13.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.77%
  • maddening_whispers_2:0.75%
  • maddening_whispers_3:0.83%
  • maddening_whispers_4:0.91%
  • maddening_whispers_5:0.95%
  • maddening_whispers_6:0.91%
  • maddening_whispers_7:0.79%
  • maddening_whispers_8:0.91%
  • maddening_whispers_9:5.35%
  • maddening_whispers_10:0.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222046
  • name:Maddening Whispers
  • tooltip:Your damaging spells transfer a Maddening Whisper to the target. When all Whispers have been applied, each deals $s~1 Shadow damage.
  • description:Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals {$s1=36653} Shadow damage.
  • max_stacks:10
  • duration:30.00
  • cooldown:120.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 58.3sec 0.0sec 19.62% 19.62% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Ray of Frost 4.5 0.0 72.6sec 72.6sec 14.92% 14.92% 41.8(41.8) 4.4

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_ray_of_frost
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • ray_of_frost_1:0.84%
  • ray_of_frost_2:0.84%
  • ray_of_frost_3:0.84%
  • ray_of_frost_4:0.84%
  • ray_of_frost_5:0.84%
  • ray_of_frost_6:0.84%
  • ray_of_frost_7:0.83%
  • ray_of_frost_8:0.83%
  • ray_of_frost_9:0.83%
  • ray_of_frost_10:6.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208141
  • name:Ray of Frost
  • tooltip:Ray of Frost damage increased by {$s1=20}%.
  • description:{$@spelldesc205021=For the next {$d=10 seconds}, you can channel a beam of icy power at an enemy, slowing movement by $m1% and dealing {$s2=0} Frost damage every $t2 sec. Each time Ray of Frost deals damage, its damage increases by {$208141s1=20}%.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 36.9sec 36.9sec 28.51% 28.51% 0.0(0.0) 8.2

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:28.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Frost Armor

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frost_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Haste increased by $7302w1%. Movement speed of attackers is slowed.
  • description:Increases Haste by {$s1=8}% and causes enemies who strike you to have movement speed slowed by $205708s2% for {$205708d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Frost_T19M
blizzard Mana 8.4 230723.6 27500.0 27499.7 10.7
comet_storm Mana 9.1 100083.7 11000.0 11000.0 40.4
flurry Mana 11.3 124777.6 11000.0 10999.7 0.0
frost_bomb Mana 16.6 228283.7 13750.0 13749.8 0.0
frostbolt Mana 76.1 1673915.2 22000.0 22293.0 10.0
frozen_orb Mana 5.1 56385.8 11000.0 10999.9 28.7
ice_lance Mana 70.1 770577.8 11000.0 11000.1 26.9
time_warp Mana 2.5 109023.3 44000.0 43997.7 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 770.08 3275112.14 (100.00%) 4252.96 1674905.67 33.84%
Resource RPS-Gain RPS-Loss
Mana 10893.68 10955.75
Combat End Resource Mean Min Max
Mana 1081011.52 997221.50 1100000.00

Benefits & Uptimes

Benefits %
Ray of Frost Ray of Frost 0 5.2%
Ray of Frost Ray of Frost 1 5.2%
Ray of Frost Ray of Frost 2 5.2%
Ray of Frost Ray of Frost 3 5.2%
Ray of Frost Ray of Frost 4 5.2%
Ray of Frost Ray of Frost 5 5.2%
Ray of Frost Ray of Frost 6 5.2%
Ray of Frost Ray of Frost 7 5.2%
Ray of Frost Ray of Frost 8 5.2%
Ray of Frost Ray of Frost 9 5.2%
Ray of Frost Ray of Frost 10 48.2%
Fingers of Frost from Frostbolt 13.4%
Fingers of Frost from Water Jet 26.9%
Fingers of Frost from Blizzard 5.0%
Fingers of Frost from Frozen Orb Initial Impact 7.6%
Fingers of Frost from Frozen Orb Tick 17.6%
Fingers of Frost from Ebonbolt 17.5%
Fingers of Frost from Waterbolt 12.0%
Uptimes %
Mana Cap 23.9%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Mage_Frost_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Mage_Frost_T19M Damage Per Second
Count 7499
Mean 436336.66
Minimum 396246.22
Maximum 485759.74
Spread ( max - min ) 89513.52
Range [ ( max - min ) / 2 * 100% ] 10.26%
Standard Deviation 12140.2381
5th Percentile 416225.69
95th Percentile 456046.97
( 95th Percentile - 5th Percentile ) 39821.28
Mean Distribution
Standard Deviation 140.1927
95.00% Confidence Intervall ( 436061.89 - 436611.43 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2973
0.1 Scale Factor Error with Delta=300 1258166
0.05 Scale Factor Error with Delta=300 5032665
0.01 Scale Factor Error with Delta=300 125816638
Priority Target DPS
Sample Data Mage_Frost_T19M Priority Target Damage Per Second
Count 7499
Mean 436336.66
Minimum 396246.22
Maximum 485759.74
Spread ( max - min ) 89513.52
Range [ ( max - min ) / 2 * 100% ] 10.26%
Standard Deviation 12140.2381
5th Percentile 416225.69
95th Percentile 456046.97
( 95th Percentile - 5th Percentile ) 39821.28
Mean Distribution
Standard Deviation 140.1927
95.00% Confidence Intervall ( 436061.89 - 436611.43 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2973
0.1 Scale Factor Error with Delta=300 1258166
0.05 Scale Factor Error with Delta=300 5032665
0.01 Scale Factor Error with Delta=300 125816638
DPS(e)
Sample Data Mage_Frost_T19M Damage Per Second (Effective)
Count 7499
Mean 436336.66
Minimum 396246.22
Maximum 485759.74
Spread ( max - min ) 89513.52
Range [ ( max - min ) / 2 * 100% ] 10.26%
Damage
Sample Data Mage_Frost_T19M Damage
Count 7499
Mean 117184976.97
Minimum 89228472.07
Maximum 150944733.43
Spread ( max - min ) 61716261.36
Range [ ( max - min ) / 2 * 100% ] 26.33%
DTPS
Sample Data Mage_Frost_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mage_Frost_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mage_Frost_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mage_Frost_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mage_Frost_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mage_Frost_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Mage_Frost_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mage_Frost_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 water_elemental
4 0.00 snapshot_stats
5 0.00 mirror_image
6 0.00 potion,name=deadly_grace
7 0.00 frostbolt
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
8 8.57 ice_lance,if=buff.fingers_of_frost.react=0&prev_gcd.flurry
9 2.48 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
A 0.00 call_action_list,name=cooldowns
B 8.39 blizzard,if=buff.potion_of_deadly_grace.up&!prev_off_gcd.water_jet
C 1.52 ice_nova,if=debuff.winters_chill.up
D 9.12 frostbolt,if=prev_off_gcd.water_jet
E 9.12 water_jet,if=prev_gcd.frostbolt&buff.fingers_of_frost.stack<(2+artifact.icy_hand.enabled)&buff.brain_freeze.react=0
F 4.51 ray_of_frost,if=buff.icy_veins.up|(cooldown.icy_veins.remains>action.ray_of_frost.cooldown&buff.rune_of_power.down)
G 11.34 flurry,if=buff.brain_freeze.react&buff.fingers_of_frost.react=0&prev_gcd.frostbolt
0.00 glacial_spike
0.00 frozen_touch,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
H 16.66 frost_bomb,if=debuff.frost_bomb.remains<action.ice_lance.travel_time&buff.fingers_of_frost.react>0
I 61.48 ice_lance,if=buff.fingers_of_frost.react>0&cooldown.icy_veins.remains>10|buff.fingers_of_frost.react>2
J 5.13 frozen_orb
K 8.85 ice_nova
L 9.10 comet_storm
0.00 blizzard,if=talent.artic_gale.enabled
M 5.93 ebonbolt,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
N 66.34 frostbolt
actions.cooldowns
# count action,conditions
O 8.94 rune_of_power,if=cooldown.icy_veins.remains<cast_time|charges_fractional>1.9&cooldown.icy_veins.remains>10|buff.icy_veins.up|target.time_to_die.remains+5<charges_fractional*10
P 2.50 icy_veins,if=buff.icy_veins.down
0.00 mirror_image
Q 1.47 use_item,slot=neck
R 2.99 use_item,slot=trinket2
0.00 blood_fury
S 2.05 berserking
0.00 arcane_torrent
T 1.00 potion,name=deadly_grace

Sample Sequence

0123679OPQRSBFOBHIJKLBIMNIBIINEDGHIINNG8NNNNN9NHIKNNG8LNNNEDNHIINTBNINFBHIJIOIBIIKILIBHIIMNEDIIIING8NNKHING8LNONNREDHIIING8NKNJNHMNINIOPFHKLONEDIIING8NNNNNHINSNINIKNG8MLHIIJNEDIIINGHIFHIIKLNEDNIIINNG8OMNRHIINKNNNEDLHIIJNINIING8HIIKNNONEDINHILMNIINONG8PC9F

Sample Sequence Table

time name target resources buffs
Pre flask Mage_Frost_T19M 1100000.0/1100000: 100% mana
Pre food Mage_Frost_T19M 1100000.0/1100000: 100% mana
Pre augmentation Mage_Frost_T19M 1100000.0/1100000: 100% mana
Pre water_elemental Fluffy_Pillow 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 frostbolt Fluffy_Pillow 1078000.0/1100000: 98% mana icicles, potion_of_deadly_grace
0:00.000 time_warp Fluffy_Pillow 1078000.0/1100000: 98% mana icicles, potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1034000.0/1100000: 94% mana bloodlust, icicles, potion_of_deadly_grace
0:00.857 icy_veins Fluffy_Pillow 1048140.5/1100000: 95% mana bloodlust, icicles, rune_of_power, potion_of_deadly_grace
0:00.857 use_item_sorcerous_shadowruby_pendant Fluffy_Pillow 1048140.5/1100000: 95% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:00.857 use_item_wriggling_sinew Fluffy_Pillow 1048140.5/1100000: 95% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:00.857 berserking Fluffy_Pillow 1048140.5/1100000: 95% mana bloodlust, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(10), potion_of_deadly_grace
0:00.857 blizzard Fluffy_Pillow 1048140.5/1100000: 95% mana bloodlust, berserking, icicles, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(10), potion_of_deadly_grace
0:01.623 ray_of_frost Fluffy_Pillow 1033279.5/1100000: 94% mana bloodlust, berserking, icicles(2), icy_veins, rune_of_power, chain_reaction, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:11.923 rune_of_power Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, fingers_of_frost, icicles(2), icy_veins, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:12.679 blizzard Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, fingers_of_frost, icicles(2), icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:13.561 frost_bomb Fluffy_Pillow 1072599.0/1100000: 98% mana bloodlust, fingers_of_frost, icicles(2), icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:14.317 ice_lance Fluffy_Pillow 1071323.0/1100000: 97% mana bloodlust, fingers_of_frost, icicles(2), icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:15.071 frozen_orb Fluffy_Pillow 1072764.0/1100000: 98% mana bloodlust, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(9), potion_of_deadly_grace
0:15.826 ice_nova Fluffy_Pillow 1074221.5/1100000: 98% mana bloodlust, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(8), potion_of_deadly_grace
0:16.581 comet_storm Fluffy_Pillow 1086679.0/1100000: 99% mana bloodlust, fingers_of_frost, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(7), potion_of_deadly_grace
0:17.336 blizzard Fluffy_Pillow 1088136.5/1100000: 99% mana bloodlust, fingers_of_frost, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(7), potion_of_deadly_grace
0:18.216 ice_lance Fluffy_Pillow 1072566.0/1100000: 98% mana bloodlust, fingers_of_frost, icy_veins, rune_of_power, chilled_to_the_core, maddening_whispers(3), potion_of_deadly_grace
0:18.973 ebonbolt Fluffy_Pillow 1074056.5/1100000: 98% mana bloodlust, icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:20.293 frostbolt Fluffy_Pillow 1095836.5/1100000: 100% mana bloodlust, fingers_of_frost(3), icy_veins, rune_of_power, chilled_to_the_core, potion_of_deadly_grace
0:21.175 ice_lance Fluffy_Pillow 1078099.0/1100000: 98% mana bloodlust, fingers_of_frost(3), icicles, rune_of_power, potion_of_deadly_grace
0:22.033 blizzard Fluffy_Pillow 1081256.0/1100000: 98% mana bloodlust, fingers_of_frost(2), rune_of_power, potion_of_deadly_grace
0:23.178 ice_lance Fluffy_Pillow 1072599.0/1100000: 98% mana bloodlust, fingers_of_frost(2), chain_reaction, potion_of_deadly_grace
0:24.037 ice_lance Fluffy_Pillow 1075772.5/1100000: 98% mana bloodlust, fingers_of_frost, chain_reaction, potion_of_deadly_grace
0:24.894 frostbolt Fluffy_Pillow 1078913.0/1100000: 98% mana bloodlust, chain_reaction, potion_of_deadly_grace
0:26.037 water_jet Fluffy_Pillow 1075772.5/1100000: 98% mana bloodlust, brain_freeze, icicles, chain_reaction, potion_of_deadly_grace
0:26.037 frostbolt Fluffy_Pillow 1075772.5/1100000: 98% mana bloodlust, brain_freeze, icicles, chain_reaction, potion_of_deadly_grace
0:27.180 flurry Fluffy_Pillow 1072632.0/1100000: 98% mana bloodlust, brain_freeze, fingers_of_frost, icicles(2), chain_reaction, potion_of_deadly_grace
0:28.038 frost_bomb Fluffy_Pillow 1075789.0/1100000: 98% mana bloodlust, fingers_of_frost, icicles(2), chain_reaction
0:28.897 ice_lance Fluffy_Pillow 1076212.5/1100000: 98% mana bloodlust, fingers_of_frost(2), icicles(2)
0:29.755 ice_lance Fluffy_Pillow 1079369.5/1100000: 98% mana bloodlust, fingers_of_frost
0:30.614 frostbolt Fluffy_Pillow 1082543.0/1100000: 98% mana bloodlust
0:31.757 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana bloodlust, brain_freeze, icicles
0:32.901 flurry Fluffy_Pillow 1074942.0/1100000: 98% mana bloodlust, brain_freeze, icicles(2), chain_reaction
0:33.756 ice_lance Fluffy_Pillow 1078049.5/1100000: 98% mana bloodlust, icicles(2), chain_reaction
0:34.615 frostbolt Fluffy_Pillow 1081223.0/1100000: 98% mana bloodlust, chain_reaction(2)
0:35.758 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana bloodlust, icicles, chain_reaction(2)
0:36.903 frostbolt Fluffy_Pillow 1074958.5/1100000: 98% mana bloodlust, icicles(2), chain_reaction(3)
0:38.045 frostbolt Fluffy_Pillow 1071801.5/1100000: 97% mana bloodlust, icicles(3), chain_reaction(3)
0:39.189 frostbolt Fluffy_Pillow 1068677.5/1100000: 97% mana bloodlust, icicles(4), chain_reaction(3)
0:40.332 time_warp Fluffy_Pillow 1065537.0/1100000: 97% mana fingers_of_frost, icicles(5), chain_reaction(3)
0:40.332 frostbolt Fluffy_Pillow 1021537.0/1100000: 93% mana bloodlust, fingers_of_frost, icicles(5), chain_reaction(3)
0:41.473 frost_bomb Fluffy_Pillow 1018363.5/1100000: 93% mana bloodlust, fingers_of_frost, icicles(5), chain_reaction(3)
0:42.332 ice_lance Fluffy_Pillow 1018787.0/1100000: 93% mana bloodlust, fingers_of_frost, icicles(5), chain_reaction(3)
0:43.190 ice_nova Fluffy_Pillow 1021944.0/1100000: 93% mana bloodlust, icicles, chain_reaction(3)
0:44.048 frostbolt Fluffy_Pillow 1036101.0/1100000: 94% mana bloodlust, icicles
0:45.193 frostbolt Fluffy_Pillow 1032993.5/1100000: 94% mana bloodlust, brain_freeze, icicles(2)
0:46.336 flurry Fluffy_Pillow 1029853.0/1100000: 94% mana bloodlust, brain_freeze, fingers_of_frost, icicles(3)
0:47.195 ice_lance Fluffy_Pillow 1033026.5/1100000: 94% mana bloodlust, fingers_of_frost, icicles(3)
0:48.053 comet_storm Fluffy_Pillow 1036183.5/1100000: 94% mana bloodlust
0:48.912 frostbolt Fluffy_Pillow 1039357.0/1100000: 94% mana bloodlust
0:50.055 frostbolt Fluffy_Pillow 1036216.5/1100000: 94% mana bloodlust, icicles
0:51.198 frostbolt Fluffy_Pillow 1033076.0/1100000: 94% mana bloodlust, icicles(3), chain_reaction
0:52.341 water_jet Fluffy_Pillow 1029935.5/1100000: 94% mana bloodlust, icicles(5), chain_reaction(2)
0:52.341 frostbolt Fluffy_Pillow 1029935.5/1100000: 94% mana bloodlust, icicles(5), chain_reaction(2)
0:53.485 frostbolt Fluffy_Pillow 1026811.5/1100000: 93% mana bloodlust, fingers_of_frost, icicles(5), chain_reaction(3)
0:54.628 frost_bomb Fluffy_Pillow 1023671.0/1100000: 93% mana bloodlust, fingers_of_frost(2), icicles(5), chain_reaction(3)
0:55.487 ice_lance Fluffy_Pillow 1024094.5/1100000: 93% mana bloodlust, fingers_of_frost(2), icicles(5), chain_reaction(3)
0:56.346 ice_lance Fluffy_Pillow 1027268.0/1100000: 93% mana bloodlust, fingers_of_frost, icicles, chain_reaction(3)
0:57.204 frostbolt Fluffy_Pillow 1030425.0/1100000: 94% mana bloodlust, chain_reaction(3)
0:58.348 potion Fluffy_Pillow 1027301.0/1100000: 93% mana bloodlust, icicles, chain_reaction(3)
0:58.348 blizzard Fluffy_Pillow 1027301.0/1100000: 93% mana bloodlust, icicles, chain_reaction(3), potion_of_deadly_grace
0:59.492 frostbolt Fluffy_Pillow 1018677.0/1100000: 93% mana bloodlust, icicles, chain_reaction(3), potion_of_deadly_grace
1:00.635 ice_lance Fluffy_Pillow 1015536.5/1100000: 92% mana bloodlust, fingers_of_frost, icicles(2), chain_reaction(3), potion_of_deadly_grace
1:01.491 frostbolt Fluffy_Pillow 1018660.5/1100000: 93% mana bloodlust, chain_reaction(3), potion_of_deadly_grace
1:02.635 ray_of_frost Fluffy_Pillow 1015536.5/1100000: 92% mana bloodlust, brain_freeze, icicles, potion_of_deadly_grace
1:12.809 blizzard Fluffy_Pillow 1100000.0/1100000: 100% mana bloodlust, brain_freeze, fingers_of_frost, icicles(2), potion_of_deadly_grace
1:13.953 frost_bomb Fluffy_Pillow 1072582.5/1100000: 98% mana bloodlust, brain_freeze, fingers_of_frost, icicles(2), potion_of_deadly_grace
1:14.813 ice_lance Fluffy_Pillow 1073022.5/1100000: 98% mana bloodlust, brain_freeze, fingers_of_frost, icicles(2), potion_of_deadly_grace
1:15.667 frozen_orb Fluffy_Pillow 1076113.5/1100000: 98% mana bloodlust, brain_freeze, fingers_of_frost, potion_of_deadly_grace
1:16.525 ice_lance Fluffy_Pillow 1079270.5/1100000: 98% mana bloodlust, brain_freeze, fingers_of_frost, potion_of_deadly_grace
1:17.384 rune_of_power Fluffy_Pillow 1082444.0/1100000: 98% mana bloodlust, brain_freeze, fingers_of_frost, potion_of_deadly_grace
1:18.243 ice_lance Fluffy_Pillow 1096617.5/1100000: 100% mana bloodlust, fingers_of_frost(2), rune_of_power, potion_of_deadly_grace
1:19.101 blizzard Fluffy_Pillow 1099774.5/1100000: 100% mana bloodlust, fingers_of_frost, rune_of_power, potion_of_deadly_grace
1:20.245 ice_lance Fluffy_Pillow 1072582.5/1100000: 98% mana bloodlust, fingers_of_frost(2), rune_of_power, potion_of_deadly_grace
1:21.334 ice_lance Fluffy_Pillow 1079551.0/1100000: 98% mana fingers_of_frost, rune_of_power, potion_of_deadly_grace
1:22.449 ice_nova Fluffy_Pillow 1086948.5/1100000: 99% mana fingers_of_frost, rune_of_power, potion_of_deadly_grace
1:23.565 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost, rune_of_power, potion_of_deadly_grace
1:24.680 comet_storm Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost, rune_of_power, potion_of_deadly_grace
1:25.797 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), rune_of_power, potion_of_deadly_grace
1:26.913 blizzard Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), rune_of_power, potion_of_deadly_grace
1:28.398 frost_bomb Fluffy_Pillow 1072566.0/1100000: 98% mana fingers_of_frost(2)
1:29.515 ice_lance Fluffy_Pillow 1077246.5/1100000: 98% mana fingers_of_frost(2)
1:30.631 ice_lance Fluffy_Pillow 1084660.5/1100000: 99% mana fingers_of_frost
1:31.747 ebonbolt Fluffy_Pillow 1092074.5/1100000: 99% mana
1:33.974 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
1:35.458 water_jet Fluffy_Pillow 1078049.5/1100000: 98% mana fingers_of_frost(2), icicles
1:35.458 frostbolt Fluffy_Pillow 1078049.5/1100000: 98% mana fingers_of_frost(2), icicles
1:36.944 ice_lance Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, fingers_of_frost(3), icicles(3)
1:38.058 ice_lance Fluffy_Pillow 1085463.5/1100000: 99% mana brain_freeze, fingers_of_frost(3)
1:39.175 ice_lance Fluffy_Pillow 1092894.0/1100000: 99% mana brain_freeze, fingers_of_frost(2)
1:40.291 ice_lance Fluffy_Pillow 1100000.0/1100000: 100% mana brain_freeze, fingers_of_frost
1:41.407 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana brain_freeze
1:42.893 flurry Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles
1:44.008 ice_lance Fluffy_Pillow 1085480.0/1100000: 99% mana icicles, chain_reaction
1:45.125 frostbolt Fluffy_Pillow 1092910.5/1100000: 99% mana chain_reaction
1:46.611 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana icicles, chain_reaction
1:48.096 ice_nova Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(2), chain_reaction(2)
1:49.211 frost_bomb Fluffy_Pillow 1096463.5/1100000: 100% mana brain_freeze, fingers_of_frost, icicles(2), chain_reaction(3)
1:50.326 ice_lance Fluffy_Pillow 1086316.0/1100000: 99% mana brain_freeze, fingers_of_frost, icicles(2), chain_reaction(3)
1:51.440 frostbolt Fluffy_Pillow 1093697.0/1100000: 99% mana brain_freeze, chain_reaction(3)
1:52.926 flurry Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles, chain_reaction(3)
1:54.042 ice_lance Fluffy_Pillow 1085496.5/1100000: 99% mana icicles, chain_reaction(3)
1:55.158 comet_storm Fluffy_Pillow 1092910.5/1100000: 99% mana chain_reaction(3)
1:56.274 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana chain_reaction(3)
1:57.761 rune_of_power Fluffy_Pillow 1078099.0/1100000: 98% mana icicles, chain_reaction(3)
1:58.876 frostbolt Fluffy_Pillow 1096496.5/1100000: 100% mana icicles, rune_of_power, chain_reaction(3)
2:00.362 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost, icicles(2), rune_of_power, chain_reaction(3)
2:01.847 use_item_wriggling_sinew Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(3), rune_of_power, chain_reaction(3)
2:01.847 water_jet Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(3), rune_of_power, chain_reaction(3), maddening_whispers(10)
2:01.847 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, fingers_of_frost, icicles(3), rune_of_power, chain_reaction(3), maddening_whispers(10)
2:03.333 frost_bomb Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles(4), rune_of_power, chain_reaction(3), maddening_whispers(9)
2:04.449 ice_lance Fluffy_Pillow 1082746.5/1100000: 98% mana brain_freeze, fingers_of_frost(3), icicles(4), rune_of_power, chain_reaction(3), maddening_whispers(8)
2:05.565 ice_lance Fluffy_Pillow 1090160.5/1100000: 99% mana brain_freeze, fingers_of_frost(2), rune_of_power, chain_reaction(3), maddening_whispers(7)
2:06.680 ice_lance Fluffy_Pillow 1097558.0/1100000: 100% mana brain_freeze, fingers_of_frost, rune_of_power, chain_reaction(3), maddening_whispers(6)
2:07.795 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana brain_freeze, rune_of_power, chain_reaction(3), maddening_whispers(5)
2:09.282 flurry Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, icicles, maddening_whispers(5)
2:10.398 ice_lance Fluffy_Pillow 1085513.0/1100000: 99% mana icicles, chain_reaction, maddening_whispers(3)
2:11.513 frostbolt Fluffy_Pillow 1092910.5/1100000: 99% mana chain_reaction
2:12.998 ice_nova Fluffy_Pillow 1078066.0/1100000: 98% mana icicles, chain_reaction
2:14.212 frostbolt Fluffy_Pillow 1098097.0/1100000: 100% mana icicles, chain_reaction(2)
2:15.696 frozen_orb Fluffy_Pillow 1078049.5/1100000: 98% mana icicles(2), chain_reaction(2)
2:16.812 frostbolt Fluffy_Pillow 1085463.5/1100000: 99% mana icicles(2), chain_reaction(2)
2:18.296 frost_bomb Fluffy_Pillow 1078049.5/1100000: 98% mana fingers_of_frost, icicles(3), chain_reaction(2)
2:19.413 ebonbolt Fluffy_Pillow 1082730.0/1100000: 98% mana fingers_of_frost, icicles(3), chain_reaction(3)
2:21.639 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(3), icicles(3), chain_reaction(3)
2:23.126 ice_lance Fluffy_Pillow 1078099.0/1100000: 98% mana fingers_of_frost(3), icicles(4), chain_reaction(3)
2:24.240 frostbolt Fluffy_Pillow 1085480.0/1100000: 99% mana fingers_of_frost(3), icicles, chain_reaction(3)
2:25.725 ice_lance Fluffy_Pillow 1078066.0/1100000: 98% mana fingers_of_frost(3), icicles(2), chain_reaction(3)
2:26.842 rune_of_power Fluffy_Pillow 1085496.5/1100000: 99% mana fingers_of_frost(2), chain_reaction(3)
2:27.956 icy_veins Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), rune_of_power, chain_reaction(3)
2:27.956 ray_of_frost Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
2:38.269 frost_bomb Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), icy_veins, chilled_to_the_core
2:39.129 ice_nova Fluffy_Pillow 1086349.0/1100000: 99% mana icy_veins, chilled_to_the_core
2:39.986 comet_storm Fluffy_Pillow 1100000.0/1100000: 100% mana icy_veins, chilled_to_the_core
2:40.844 rune_of_power Fluffy_Pillow 1100000.0/1100000: 100% mana icy_veins, chilled_to_the_core
2:41.713 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana icy_veins, rune_of_power, chilled_to_the_core
2:42.856 water_jet Fluffy_Pillow 1078066.0/1100000: 98% mana fingers_of_frost, icicles, icy_veins, rune_of_power, chilled_to_the_core
2:42.856 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana fingers_of_frost, icicles, icy_veins, rune_of_power, chilled_to_the_core
2:44.000 ice_lance Fluffy_Pillow 1074942.0/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles(2), icy_veins, rune_of_power, chilled_to_the_core
2:44.859 ice_lance Fluffy_Pillow 1078115.5/1100000: 98% mana brain_freeze, fingers_of_frost, icy_veins, rune_of_power, chilled_to_the_core
2:45.717 ice_lance Fluffy_Pillow 1081272.5/1100000: 98% mana brain_freeze, fingers_of_frost, icy_veins, rune_of_power, chilled_to_the_core
2:46.576 frostbolt Fluffy_Pillow 1084446.0/1100000: 99% mana brain_freeze, icy_veins, rune_of_power, chilled_to_the_core
2:47.719 flurry Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, icicles, icy_veins, rune_of_power, chilled_to_the_core
2:48.577 ice_lance Fluffy_Pillow 1081223.0/1100000: 98% mana icicles, rune_of_power
2:49.693 frostbolt Fluffy_Pillow 1088637.0/1100000: 99% mana rune_of_power
2:51.179 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana icicles, rune_of_power
2:52.667 frostbolt Fluffy_Pillow 1078115.5/1100000: 98% mana icicles(2), chain_reaction
2:54.154 frostbolt Fluffy_Pillow 1078099.0/1100000: 98% mana icicles(3), chain_reaction
2:55.640 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost, icicles(5), chain_reaction(2)
2:57.126 frost_bomb Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost, icicles(5), chain_reaction(2)
2:58.239 ice_lance Fluffy_Pillow 1082697.0/1100000: 98% mana fingers_of_frost, icicles(5), chain_reaction(2)
2:59.354 frostbolt Fluffy_Pillow 1090094.5/1100000: 99% mana chain_reaction(2)
3:00.838 berserking Fluffy_Pillow 1078049.5/1100000: 98% mana fingers_of_frost, icicles, chain_reaction(2)
3:00.857 frostbolt Fluffy_Pillow 1078363.0/1100000: 98% mana berserking, fingers_of_frost, icicles, chain_reaction(2)
3:02.149 ice_lance Fluffy_Pillow 1077681.0/1100000: 98% mana berserking, brain_freeze, fingers_of_frost, icicles(2)
3:03.121 frostbolt Fluffy_Pillow 1082719.0/1100000: 98% mana berserking, brain_freeze
3:04.414 ice_lance Fluffy_Pillow 1078082.5/1100000: 98% mana berserking, brain_freeze, fingers_of_frost, icicles
3:05.385 ice_nova Fluffy_Pillow 1083104.0/1100000: 98% mana berserking, brain_freeze
3:06.356 frostbolt Fluffy_Pillow 1099125.5/1100000: 100% mana berserking, brain_freeze, chain_reaction
3:07.648 flurry Fluffy_Pillow 1078066.0/1100000: 98% mana berserking, brain_freeze, icicles, chain_reaction
3:08.617 ice_lance Fluffy_Pillow 1083054.5/1100000: 98% mana berserking, icicles, chain_reaction
3:09.587 ebonbolt Fluffy_Pillow 1088059.5/1100000: 99% mana berserking, chain_reaction
3:11.523 comet_storm Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
3:12.639 frost_bomb Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
3:13.755 ice_lance Fluffy_Pillow 1086332.5/1100000: 99% mana fingers_of_frost(2)
3:14.871 ice_lance Fluffy_Pillow 1093746.5/1100000: 99% mana fingers_of_frost
3:15.988 frozen_orb Fluffy_Pillow 1100000.0/1100000: 100% mana
3:17.103 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
3:18.589 water_jet Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, fingers_of_frost, icicles
3:18.589 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, fingers_of_frost, icicles
3:20.076 ice_lance Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles(2), chain_reaction
3:21.191 ice_lance Fluffy_Pillow 1085496.5/1100000: 99% mana brain_freeze, fingers_of_frost(2), icicles, chain_reaction
3:22.307 ice_lance Fluffy_Pillow 1092910.5/1100000: 99% mana brain_freeze, fingers_of_frost, chain_reaction
3:23.422 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana brain_freeze, chain_reaction
3:24.909 flurry Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, icicles, chain_reaction
3:26.025 frost_bomb Fluffy_Pillow 1085513.0/1100000: 99% mana fingers_of_frost(3), icicles, chain_reaction
3:27.141 ice_lance Fluffy_Pillow 1086332.5/1100000: 99% mana fingers_of_frost(3), icicles, chain_reaction
3:28.257 ray_of_frost Fluffy_Pillow 1093746.5/1100000: 99% mana fingers_of_frost(2), chain_reaction
3:38.569 frost_bomb Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2)
3:39.685 ice_lance Fluffy_Pillow 1086332.5/1100000: 99% mana fingers_of_frost(2)
3:40.800 ice_lance Fluffy_Pillow 1093730.0/1100000: 99% mana fingers_of_frost
3:41.915 ice_nova Fluffy_Pillow 1100000.0/1100000: 100% mana
3:43.030 comet_storm Fluffy_Pillow 1100000.0/1100000: 100% mana
3:44.147 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
3:45.633 water_jet Fluffy_Pillow 1078082.5/1100000: 98% mana icicles
3:45.633 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana icicles
3:47.118 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana fingers_of_frost, icicles(2), chain_reaction
3:48.606 ice_lance Fluffy_Pillow 1078115.5/1100000: 98% mana fingers_of_frost(3), icicles(3), chain_reaction(2)
3:49.721 ice_lance Fluffy_Pillow 1085513.0/1100000: 99% mana fingers_of_frost(2), chain_reaction(2)
3:50.837 ice_lance Fluffy_Pillow 1092927.0/1100000: 99% mana fingers_of_frost, chain_reaction(2)
3:51.952 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana chain_reaction(2)
3:53.439 frostbolt Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, icicles, chain_reaction(2)
3:54.925 flurry Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles(3)
3:56.041 ice_lance Fluffy_Pillow 1085496.5/1100000: 99% mana icicles(3)
3:57.156 rune_of_power Fluffy_Pillow 1092894.0/1100000: 99% mana
3:58.272 ebonbolt Fluffy_Pillow 1100000.0/1100000: 100% mana rune_of_power
4:00.497 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), rune_of_power
4:01.984 use_item_wriggling_sinew Fluffy_Pillow 1078099.0/1100000: 98% mana fingers_of_frost(2), icicles, rune_of_power
4:01.984 frost_bomb Fluffy_Pillow 1078099.0/1100000: 98% mana fingers_of_frost(2), icicles, rune_of_power, maddening_whispers(10)
4:03.100 ice_lance Fluffy_Pillow 1082763.0/1100000: 98% mana fingers_of_frost(2), icicles, rune_of_power, chain_reaction, maddening_whispers(9)
4:04.216 ice_lance Fluffy_Pillow 1090177.0/1100000: 99% mana fingers_of_frost, rune_of_power, chain_reaction, maddening_whispers(8)
4:05.331 frostbolt Fluffy_Pillow 1097574.5/1100000: 100% mana rune_of_power, chain_reaction, maddening_whispers(7)
4:06.817 ice_nova Fluffy_Pillow 1078082.5/1100000: 98% mana icicles, rune_of_power, chain_reaction, maddening_whispers(7)
4:08.031 frostbolt Fluffy_Pillow 1098113.5/1100000: 100% mana icicles(2), rune_of_power, chain_reaction(2), maddening_whispers(5)
4:09.516 frostbolt Fluffy_Pillow 1078066.0/1100000: 98% mana icicles(3), chain_reaction(2), maddening_whispers(5)
4:11.000 frostbolt Fluffy_Pillow 1078049.5/1100000: 98% mana icicles(4), chain_reaction(2), maddening_whispers(4)
4:12.487 water_jet Fluffy_Pillow 1078099.0/1100000: 98% mana icicles(5), chain_reaction(2), maddening_whispers(3)
4:12.487 frostbolt Fluffy_Pillow 1078099.0/1100000: 98% mana icicles(5), chain_reaction(2), maddening_whispers(3)
4:13.971 comet_storm Fluffy_Pillow 1078049.5/1100000: 98% mana fingers_of_frost, icicles(5), chain_reaction(3), maddening_whispers(2)
4:15.088 frost_bomb Fluffy_Pillow 1085480.0/1100000: 99% mana fingers_of_frost(2), icicles(5), chain_reaction(3)
4:16.204 ice_lance Fluffy_Pillow 1086332.5/1100000: 99% mana fingers_of_frost(2), icicles(5), chain_reaction(3)
4:17.320 ice_lance Fluffy_Pillow 1093746.5/1100000: 99% mana fingers_of_frost, chain_reaction(3)
4:18.434 frozen_orb Fluffy_Pillow 1100000.0/1100000: 100% mana chain_reaction(3)
4:19.548 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana chain_reaction(3)
4:21.035 ice_lance Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, fingers_of_frost, icicles, chain_reaction(3)
4:22.149 frostbolt Fluffy_Pillow 1085480.0/1100000: 99% mana brain_freeze, fingers_of_frost, chain_reaction
4:23.634 ice_lance Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles, chain_reaction
4:24.748 ice_lance Fluffy_Pillow 1085447.0/1100000: 99% mana brain_freeze, fingers_of_frost, chain_reaction(2)
4:25.862 frostbolt Fluffy_Pillow 1092828.0/1100000: 99% mana brain_freeze, chain_reaction(2)
4:27.347 flurry Fluffy_Pillow 1078066.0/1100000: 98% mana brain_freeze, icicles, chain_reaction(2)
4:28.462 ice_lance Fluffy_Pillow 1085463.5/1100000: 99% mana icicles, chain_reaction(2)
4:29.577 frost_bomb Fluffy_Pillow 1092861.0/1100000: 99% mana fingers_of_frost, chain_reaction(2)
4:30.693 ice_lance Fluffy_Pillow 1086332.5/1100000: 99% mana fingers_of_frost, chain_reaction(2)
4:31.808 ice_lance Fluffy_Pillow 1093730.0/1100000: 99% mana fingers_of_frost
4:32.922 ice_nova Fluffy_Pillow 1100000.0/1100000: 100% mana
4:34.037 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana
4:35.523 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana icicles
4:37.009 rune_of_power Fluffy_Pillow 1078082.5/1100000: 98% mana icicles(3), chain_reaction
4:38.123 frostbolt Fluffy_Pillow 1096463.5/1100000: 100% mana icicles(3), rune_of_power, chain_reaction
4:39.609 water_jet Fluffy_Pillow 1078082.5/1100000: 98% mana icicles(4), rune_of_power, chain_reaction
4:39.609 frostbolt Fluffy_Pillow 1078082.5/1100000: 98% mana icicles(4), rune_of_power, chain_reaction
4:41.095 ice_lance Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost, icicles(5), rune_of_power, chain_reaction
4:42.212 frostbolt Fluffy_Pillow 1085513.0/1100000: 99% mana fingers_of_frost, rune_of_power, chain_reaction(2)
4:43.698 frost_bomb Fluffy_Pillow 1078082.5/1100000: 98% mana fingers_of_frost, icicles, rune_of_power, chain_reaction(2)
4:44.813 ice_lance Fluffy_Pillow 1082730.0/1100000: 98% mana fingers_of_frost, icicles(2), rune_of_power, chain_reaction(3)
4:45.931 comet_storm Fluffy_Pillow 1090177.0/1100000: 99% mana rune_of_power, chain_reaction(3)
4:47.047 ebonbolt Fluffy_Pillow 1097591.0/1100000: 100% mana rune_of_power, chain_reaction(3)
4:49.272 frostbolt Fluffy_Pillow 1100000.0/1100000: 100% mana fingers_of_frost(2), chain_reaction(3)
4:50.759 ice_lance Fluffy_Pillow 1078099.0/1100000: 98% mana brain_freeze, fingers_of_frost(2), icicles, chain_reaction(3)
4:51.876 ice_lance Fluffy_Pillow 1085529.5/1100000: 99% mana brain_freeze, fingers_of_frost, chain_reaction
4:52.991 frostbolt Fluffy_Pillow 1092927.0/1100000: 99% mana brain_freeze, chain_reaction
4:54.477 rune_of_power Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles, chain_reaction
4:55.594 frostbolt Fluffy_Pillow 1096513.0/1100000: 100% mana brain_freeze, icicles(2), rune_of_power, chain_reaction(2)
4:57.080 flurry Fluffy_Pillow 1078082.5/1100000: 98% mana brain_freeze, icicles(3), rune_of_power, chain_reaction(2)
4:58.197 ice_lance Fluffy_Pillow 1085513.0/1100000: 99% mana icicles(3), rune_of_power, chain_reaction(3)
4:59.313 icy_veins Fluffy_Pillow 1092927.0/1100000: 99% mana rune_of_power, chain_reaction(3)
4:59.456 ice_nova Fluffy_Pillow 1095286.5/1100000: 100% mana icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
5:00.313 time_warp Fluffy_Pillow 1100000.0/1100000: 100% mana icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core
5:00.313 ray_of_frost Fluffy_Pillow 1056000.0/1100000: 96% mana bloodlust, icy_veins, rune_of_power, chain_reaction(3), chilled_to_the_core

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4876 4551 0
Agility 6579 6254 0
Stamina 40980 40980 25820
Intellect 37254 35548 26532 (965)
Spirit 1 1 0
Health 2458800 2458800 0
Mana 1100000 1100000 0
Spell Power 37254 35548 0
Crit 31.50% 31.50% 9276
Haste 25.01% 23.86% 7754
Damage / Heal Versatility 3.40% 3.40% 1361
ManaReg per Second 16500 16500 0
Mastery 32.92% 32.92% 2321
Armor 1810 1810 1810
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 881.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Sorcerous Shadowruby Pendant of the Fireflash
ilevel: 850, stats: { +1094 Sta, +1101 Crit, +734 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Robes of Celestial Adornment
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +855 Haste, +605 Crit }
Local Waist Pliable Spider Silk Cinch
ilevel: 880, stats: { 163 Armor, +1930 Sta, +1287 Int, +689 Mastery, +406 Crit }
Local Legs Leggings of the Lower Planes
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +1012 Crit, +448 Haste }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +735 Haste, +360 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +569 Haste, +252 Mastery }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Shard of the Exodar
ilevel: 895, stats: { +1665 Sta, +1397 Crit, +776 Haste }, enchant: { +200 Haste }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Haste }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Wriggling Sinew
ilevel: 880, stats: { +1043 Crit }
Local Back Mantle of the Victorious Dead
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Vers, +340 Haste }, enchant: { +200 Int }
Local Main Hand Ebonchill
ilevel: 906, weapon: { 5654 - 8482, 3.6 }, stats: { +2186 Int, +3279 Sta, +806 Haste, +806 Mastery, +11923 Int }

Talents

Level
15 Ray of Frost (Frost Mage) Lonely Winter (Frost Mage) Bone Chilling (Frost Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Ice Nova (Frost Mage) Frozen Touch (Frost Mage) Splitting Ice (Frost Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Frost Bomb (Frost Mage) Unstable Magic Arctic Gale (Frost Mage)
100 Thermal Void (Frost Mage) Glacial Spike (Frost Mage) Comet Storm (Frost Mage)

Profile

mage="Mage_Frost_T19M"
level=110
race=troll
role=spell
position=back
talents=1121113
artifact=53:139259:139269:139259:0:783:1:784:3:785:3:786:5:788:3:789:4:790:3:791:3:792:3:793:1:794:1:795:1:796:1:797:1:798:1:1296:1
spec=frost

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/frostbolt

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/ice_lance,if=buff.fingers_of_frost.react=0&prev_gcd.flurry
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/call_action_list,name=cooldowns
actions+=/blizzard,if=buff.potion_of_deadly_grace.up&!prev_off_gcd.water_jet
actions+=/ice_nova,if=debuff.winters_chill.up
actions+=/frostbolt,if=prev_off_gcd.water_jet
actions+=/water_jet,if=prev_gcd.frostbolt&buff.fingers_of_frost.stack<(2+artifact.icy_hand.enabled)&buff.brain_freeze.react=0
actions+=/ray_of_frost,if=buff.icy_veins.up|(cooldown.icy_veins.remains>action.ray_of_frost.cooldown&buff.rune_of_power.down)
actions+=/flurry,if=buff.brain_freeze.react&buff.fingers_of_frost.react=0&prev_gcd.frostbolt
actions+=/glacial_spike
actions+=/frozen_touch,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
actions+=/frost_bomb,if=debuff.frost_bomb.remains<action.ice_lance.travel_time&buff.fingers_of_frost.react>0
actions+=/ice_lance,if=buff.fingers_of_frost.react>0&cooldown.icy_veins.remains>10|buff.fingers_of_frost.react>2
actions+=/frozen_orb
actions+=/ice_nova
actions+=/comet_storm
actions+=/blizzard,if=talent.artic_gale.enabled
actions+=/ebonbolt,if=buff.fingers_of_frost.stack<=(0+artifact.icy_hand.enabled)
actions+=/frostbolt

actions.cooldowns=rune_of_power,if=cooldown.icy_veins.remains<cast_time|charges_fractional>1.9&cooldown.icy_veins.remains>10|buff.icy_veins.up|target.time_to_die.remains+5<charges_fractional*10
actions.cooldowns+=/icy_veins,if=buff.icy_veins.down
actions.cooldowns+=/mirror_image
actions.cooldowns+=/use_item,slot=neck
actions.cooldowns+=/use_item,slot=trinket2
actions.cooldowns+=/blood_fury
actions.cooldowns+=/berserking
actions.cooldowns+=/arcane_torrent
actions.cooldowns+=/potion,name=deadly_grace

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=sorcerous_shadowruby_pendant,id=130233,bonus_id=1758/689/601/669,gem_id=130219,enchant=mark_of_the_hidden_satyr,enchant_id=5439
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=mantle_of_the_victorious_dead,id=142540,bonus_id=1502,enchant=binding_of_intellect
chest=robes_of_celestial_adornment,id=142410,bonus_id=1502
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1806
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=pliable_spider_silk_cinch,id=138217,bonus_id=1806
legs=leggings_of_the_lower_planes,id=142413,bonus_id=1502
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1806
finger1=shard_of_the_exodar,id=132410,enchant=binding_of_haste
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_haste
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=wriggling_sinew,id=139326,bonus_id=1806
main_hand=ebonchill,id=128862,ilevel=906

# Gear Summary
# gear_ilvl=880.73
# gear_stamina=25820
# gear_intellect=26532
# gear_crit_rating=9276
# gear_haste_rating=7754
# gear_mastery_rating=2321
# gear_versatility_rating=1361
# gear_armor=1810

Paladin_Retribution_T19M : 439104 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
439104.1 439104.1 364.2 / 0.083% 62239.4 / 14.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 1.94% 60.0 100.0% 100%
Talents
  • 15: Final Verdict (Retribution Paladin)
  • 30: The Fires of Justice (Retribution Paladin)
  • 45: Fist of Justice
  • 60: Blade of Wrath (Retribution Paladin)
  • 75: Justicar's Vengeance (Retribution Paladin)
  • 90: Divine Intervention (Retribution Paladin)
  • 100: Crusade (Retribution Paladin)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Paladin_Retribution_T19M 439104
Blade of Justice 38015 8.7% 48.9 6.11sec 233341 230367 Direct 48.9 188408 376584 233342 23.9%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.93 48.93 0.00 0.00 1.0129 0.0000 11417683.54 16785076.32 31.98 230367.08 230367.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.25 76.12% 188407.59 161318 246010 188464.47 173237 204150 7017668 10316637 31.98
crit 11.68 23.88% 376584.46 322636 492019 376676.53 322636 492019 4400015 6468439 31.98
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Strikes an enemy with the Blade of Justice, dealing ${$sw2*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Greater Blessing of Might (blessing_of_might_proc) 34819 7.9% 189.3 1.99sec 55221 0 Direct 162.7 64256 0 64256 0.0%  

Stats details: blessing_of_might_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.35 162.72 0.00 0.00 0.0000 0.0000 10455882.95 10455882.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 162.72 100.00% 64255.55 9186 1022494 64289.10 44476 89487 10455883 10455883 0.00
 
 

Action details: blessing_of_might_proc

Static Values
  • id:205729
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205729
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:
  • description:{$@spelldesc203528=Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18160.31
  • base_dd_max:18160.31
 
Brutal Haymaker 2450 (11175) 0.6% (2.6%) 4.8 53.65sec 699013 0 Direct 4.8 123357 246745 153220 24.2%  

Stats details: brutal_haymaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.81 4.81 0.00 0.00 0.0000 0.0000 736506.20 1082733.87 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.64 75.79% 123357.38 109754 167375 122163.02 0 167375 449388 660643 31.64
crit 1.16 24.21% 246744.97 219508 334750 175605.32 0 334750 287118 422090 22.73
 
 

Action details: brutal_haymaker

Static Values
  • id:214169
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214169
  • name:Brutal Haymaker
  • school:physical
  • tooltip:Damage taken from the caster increased by {$s2=15}%.
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal {$214169s1=84038} Physical damage and increase all damage the target takes from you by {$214169s2=15}% for {$214169d=15 seconds}, up to {$214169s3=315142} extra damage dealt.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:161348.62
  • base_dd_max:161348.62
 
    Brutal Haymaker (_vulnerability) 8725 2.0% 53.1 4.09sec 49418 0 Direct 51.2 51251 0 51251 0.0%  

Stats details: brutal_haymaker_vulnerability

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.09 51.19 0.00 0.00 0.0000 0.0000 2623397.09 2623397.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.19 100.00% 51250.61 2 605059 52021.99 29479 110011 2623397 2623397 0.00
 
 

Action details: brutal_haymaker_vulnerability

Static Values
  • id:228784
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228784
  • name:Brutal Haymaker
  • school:physical
  • tooltip:
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal {$214169s1=84038} Physical damage and increase all damage the target takes from you by {$214169s2=15}% for {$214169d=15 seconds}, up to {$214169s3=315142} extra damage dealt.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:127592.91
  • base_dd_max:127592.91
 
Crusader Strike 50426 11.5% 106.2 2.81sec 142507 141114 Direct 106.2 92546 184965 142507 54.1%  

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.22 106.22 0.00 0.00 1.0099 0.0000 15137555.87 22253641.00 31.98 141113.77 141113.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.80 45.94% 92546.35 78894 120313 92591.29 84848 102089 4516254 6639321 31.98
crit 57.42 54.06% 184965.05 157788 240626 185048.56 171234 199045 10621302 15614320 31.98
 
 

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:3.500
  • base_execute_time:0.00
  • base_crit:0.30
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:
  • description:Strike the target for ${$sw2*$<mult>} Physical damage.$?a231667[ Maximum 2 charges.][]{$?s85256=true}[ |cFFFFFFFFGenerates {$s3=1} Holy Power.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Templar's Verdict (echoed_verdict) 19370 4.4% 88.7 3.38sec 65572 0 Direct 88.7 52888 105717 65572 24.0%  

Stats details: echoed_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.70 88.70 0.00 0.00 0.0000 0.0000 5816517.41 5816517.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.41 75.99% 52887.97 44840 74531 52908.20 49691 56226 3564928 3564928 0.00
crit 21.30 24.01% 105716.56 89681 149063 105749.27 90756 124220 2251589 2251589 0.00
 
 

Action details: echoed_verdict

Static Values
  • id:224266
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:224266
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals $sw1 Holy damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.40
 
Judgment 29553 6.7% 34.5 8.82sec 257510 250731 Direct 34.5 207700 415541 257581 24.0%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.47 34.46 0.00 0.00 1.0271 0.0000 8875125.21 8875125.21 0.00 250731.00 250731.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.19 76.00% 207699.69 178992 311605 207748.16 187692 228241 5439036 5439036 0.00
crit 8.27 24.00% 415541.03 357983 623210 415635.77 357983 623210 3436089 3436089 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 18845 4.3% 126.9 2.36sec 44560 18949 Direct 126.9 35926 71887 44560 24.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.92 126.92 0.00 0.00 2.3516 0.0000 5655366.95 8313925.10 31.98 18948.75 18948.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.44 75.99% 35925.88 30620 46696 35942.94 34093 37769 3464768 5093537 31.98
crit 30.47 24.01% 71886.83 61241 93392 71924.55 63158 81603 2190599 3220389 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 25419 5.7% 36.8 4.04sec 204431 0 Direct 36.8 164781 329173 204431 24.1%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.76 36.76 0.00 0.00 0.0000 0.0000 7515220.96 11048086.67 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.89 75.88% 164781.08 115571 176245 164766.62 153517 173495 4596562 6757381 31.98
crit 8.87 24.12% 329172.59 239232 352491 329075.34 251366 352491 2918659 4290705 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
shield_of_vengeance_proc 11779 2.7% 3.8 89.46sec 929390 0 Direct 3.6 788584 1567151 974978 23.9%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.80 3.62 0.00 0.00 0.0000 0.0000 3527319.14 3527319.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.75 76.06% 788584.46 558740 1704157 784278.62 0 1704157 2170093 2170093 0.00
crit 0.87 23.94% 1567150.89 1117480 3408314 976968.89 0 3408314 1357226 1357226 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:558740.00
  • base_dd_max:558740.00
 
Templar's Verdict 183396 41.8% 88.7 3.38sec 620669 609175 Direct 88.7 500540 1001760 620670 24.0%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.73 88.73 0.00 0.00 1.0189 0.0000 55069998.71 55069998.71 0.00 609174.66 609174.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.46 76.03% 500540.48 358722 745315 500712.33 459997 545012 33767119 33767119 0.00
crit 21.27 23.97% 1001759.90 717444 1490629 1002083.73 821730 1214063 21302880 21302880 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 16308 3.7% 9.8 32.47sec 501170 484914 Direct 9.8 201090 402798 249701 24.1%  
Periodic 58.0 34140 68302 42375 24.1% 19.3%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.78 9.78 58.01 58.01 1.0336 1.0000 4899087.15 4899087.15 0.00 71925.88 484914.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.42 75.90% 201089.83 181592 276927 201055.03 181592 245149 1491929 1491929 0.00
crit 2.36 24.10% 402798.33 363183 553854 372876.89 0 553854 949002 949002 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.0 75.89% 34140.23 30731 46864 34132.26 31840 36848 1503039 1503039 0.00
crit 14.0 24.11% 68301.58 61461 93729 68293.31 61461 81539 955118 955118 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=0&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Paladin_Retribution_T19M
Arcane Torrent 3.7 90.58sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:155145
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<5
Spelldata
  • id:155145
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$?s137027=false}[{$s2=1} Holy Power][{$s3=3}% of your mana]. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
 
Cleansed Drake's Breath 3.1 63.20sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.14 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
Crusade 3.0 120.42sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:231895
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:holy_power>=5
Spelldata
  • id:231895
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
 
Greater Blessing of Might 1.0 0.00sec

Stats details: greater_blessing_of_might

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: greater_blessing_of_might

Static Values
  • id:203528
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
Spelldata
  • id:203528
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
 
Judgment (_aoe) 34.5 8.82sec

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield of Vengeance 3.8 90.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 3.80 3.80 0.00 0.00 0.0000 0.0000 0.00 2613910.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.91 76.74% 0.00 0 0 0.00 0 0 0 1627268 99.57
crit 0.88 23.26% 0.00 0 0 0.00 0 0 0 986643 63.09
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Paladin_Retribution_T19M
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade of Wrath! 25.6 8.9 11.8sec 8.7sec 32.40% 32.40% 8.9(8.9) 25.2

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_blade_of_wrath
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • blade_of_wrath_1:32.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231843
  • name:Blade of Wrath!
  • tooltip:
  • description:{$@spelldesc231832=Your auto attacks have a chance to reset the cooldown of Blade of Justice.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 25.16% 0.0(0.0) 1.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Cleansed Ancient's Blessing 2.7 0.0 73.3sec 73.3sec 8.97% 8.97% 0.0(0.0) 2.6

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:8.97%

Trigger Attempt Success

  • trigger_pct:95.05%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 2.8 0.0 72.6sec 72.6sec 9.07% 9.07% 0.0(0.0) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:9.07%

Trigger Attempt Success

  • trigger_pct:95.56%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 2.8 0.0 73.4sec 73.4sec 9.03% 9.03% 0.0(0.0) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.03%

Trigger Attempt Success

  • trigger_pct:95.52%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crusade 3.0 33.9 120.4sec 7.4sec 28.49% 100.00% 22.1(60.6) 2.7

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.48%
  • crusade_4:2.43%
  • crusade_7:2.63%
  • crusade_10:2.83%
  • crusade_13:2.41%
  • crusade_15:17.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231895
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
Mark of the Claw 11.3 3.0 26.2sec 20.3sec 25.49% 25.49% 3.0(3.0) 11.1

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 121.4sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shield of Vengeance 3.8 0.0 90.0sec 90.0sec 18.46% 18.46% 0.0(0.0) 3.6

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:18.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
The Fires of Justice 15.5 0.4 18.5sec 18.0sec 9.86% 10.47% 0.4(0.4) 0.0

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_the_fires_of_justice
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • the_fires_of_justice_1:9.86%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:209785
  • name:The Fires of Justice
  • tooltip:Your next damaging or healing Holy Power spender costs {$s2=1} less Holy Power.
  • description:{$@spelldesc203316=Reduces the cooldown of Crusader Strike by ${$m2/-1000}.1 sec and gives it a {$h=15}% chance to reduce the cost of your next damaging or healing Holy Power ability by {$209785s1=1}.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Whisper of the Nathrezim 88.7 0.0 3.4sec 3.4sec 89.77% 77.30% 0.0(0.0) 19.3

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_whisper_of_the_nathrezim
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • whisper_of_the_nathrezim_1:89.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207635
  • name:Whisper of the Nathrezim
  • tooltip:Increases damage done by your next Templar's Verdict or Divine Storm by {$s1=25}%.
  • description:{$@spelldesc207633=Templar's Verdict and Divine Storm increase the damage of your next Templar's Verdict or Divine Storm within {$207635d=4 seconds} by {$207635s1=25}%.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Blessing of Might (blessing_of_might)

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_blessing_of_might
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_might_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203528
  • name:Greater Blessing of Might
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Paladin_Retribution_T19M
templars_verdict Holy Power 88.7 250.8 2.8 2.8 219606.6
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 9.78 45.86 (18.08%) 4.69 3.02 6.18%
arcane_torrent Holy Power 3.72 3.72 (1.47%) 1.00 0.00 0.00%
crusader_strike Holy Power 106.22 106.22 (41.88%) 1.00 0.00 0.00%
blade_of_justice Holy Power 48.93 97.86 (38.58%) 2.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.84 0.83
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.90 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
the_fires_of_justice 15.9 18.0sec
blade_of_wrath 34.4 8.7sec

Statistics & Data Analysis

Fight Length
Sample Data Paladin_Retribution_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Paladin_Retribution_T19M Damage Per Second
Count 7499
Mean 439104.09
Minimum 384694.03
Maximum 494880.15
Spread ( max - min ) 110186.11
Range [ ( max - min ) / 2 * 100% ] 12.55%
Standard Deviation 16092.3317
5th Percentile 413424.22
95th Percentile 466045.42
( 95th Percentile - 5th Percentile ) 52621.19
Mean Distribution
Standard Deviation 185.8306
95.00% Confidence Intervall ( 438739.87 - 439468.31 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5159
0.1 Scale Factor Error with Delta=300 2210658
0.05 Scale Factor Error with Delta=300 8842633
0.01 Scale Factor Error with Delta=300 221065831
Priority Target DPS
Sample Data Paladin_Retribution_T19M Priority Target Damage Per Second
Count 7499
Mean 439104.09
Minimum 384694.03
Maximum 494880.15
Spread ( max - min ) 110186.11
Range [ ( max - min ) / 2 * 100% ] 12.55%
Standard Deviation 16092.3317
5th Percentile 413424.22
95th Percentile 466045.42
( 95th Percentile - 5th Percentile ) 52621.19
Mean Distribution
Standard Deviation 185.8306
95.00% Confidence Intervall ( 438739.87 - 439468.31 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5159
0.1 Scale Factor Error with Delta=300 2210658
0.05 Scale Factor Error with Delta=300 8842633
0.01 Scale Factor Error with Delta=300 221065831
DPS(e)
Sample Data Paladin_Retribution_T19M Damage Per Second (Effective)
Count 7499
Mean 439104.09
Minimum 384694.03
Maximum 494880.15
Spread ( max - min ) 110186.11
Range [ ( max - min ) / 2 * 100% ] 12.55%
Damage
Sample Data Paladin_Retribution_T19M Damage
Count 7499
Mean 131729661.18
Minimum 95960759.14
Maximum 163812339.33
Spread ( max - min ) 67851580.19
Range [ ( max - min ) / 2 * 100% ] 25.75%
DTPS
Sample Data Paladin_Retribution_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Paladin_Retribution_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Paladin_Retribution_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Paladin_Retribution_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Paladin_Retribution_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Paladin_Retribution_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Paladin_Retribution_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Paladin_Retribution_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 greater_blessing_of_might
4 0.00 snapshot_stats
5 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
6 1.00 auto_attack
0.00 rebuke
7 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
0.00 holy_wrath
0.00 avenging_wrath
8 3.80 shield_of_vengeance
9 3.01 crusade,if=holy_power>=5
A 1.00 wake_of_ashes,if=holy_power>=0&time<2
0.00 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 blood_fury
0.00 berserking
B 3.72 arcane_torrent,if=holy_power<5
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
C 37.78 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
D 26.85 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
E 8.78 wake_of_ashes,if=holy_power=0|holy_power=1&(cooldown.blade_of_justice.remains>gcd|cooldown.divine_hammer.remains>gcd)|holy_power=2&(cooldown.zeal.charges_fractional<=0.65|cooldown.crusader_strike.charges_fractional<=0.65)
0.00 zeal,if=charges=2&holy_power<=4
F 55.76 crusader_strike,if=charges=2&holy_power<=4
G 48.93 blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
0.00 divine_hammer,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
H 34.47 judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&(cooldown.divine_hammer.remains>gcd|cooldown.blade_of_justice.remains>gcd))|(talent.greater_judgment.enabled&target.health.pct>50)
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
I 6.22 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
J 16.52 templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 zeal,if=holy_power<=4
K 50.47 crusader_strike,if=holy_power<=4
0.00 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
L 1.36 templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

Sample Sequence

0123568A9HCBFJGFIKKHIGFCFGCFHFCFGCFHFJFGFCFGCFGHCFDECFGCFHKDKGDFHKKJGKDKGHJFGDFKKHDGDECFKHJGFDGFHCFKD8GKKHCBKIGDECFGHCFKDGGHCFKK97CGHDFGJFGDEHCFKIGJFHKDKGKJKHKLGKGCKHIFKDGHDFKIECFGHCFGCFKKHCG8CFGCFBHDFGDFKDEHCFGCFJKHIFGDFKKHIGKDGKKHCKDGDEHCFG9CFGHCFKJKGJGFHDFGCFGCFDEHCFGCFKJGH8FDKKDGBFHIFKDGGHCFDECFGHCFGC

Sample Sequence Table

time name target resources buffs
Pre flask Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre food Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre augmentation Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre greater_blessing_of_might Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, potion_of_the_old_war
0:00.000 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:00.889 crusade Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:00.889 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:01.748 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:02.608 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:02.608 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:03.389 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(4), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:04.169 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(7), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:04.923 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(7), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:05.676 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(7), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw, potion_of_the_old_war
0:06.430 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:07.185 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(10), whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:07.938 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:08.693 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:09.447 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:10.201 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(13), whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:10.955 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(13), whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:11.711 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:12.464 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:13.218 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:13.971 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:14.725 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, potion_of_the_old_war
0:15.479 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
0:16.234 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
0:16.988 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
0:17.742 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
0:18.495 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
0:19.248 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:20.002 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:20.755 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:21.508 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:22.262 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_sisters_blessing, mark_of_the_claw, potion_of_the_old_war
0:23.017 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:23.770 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:24.525 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), whisper_of_the_nathrezim, cleansed_sisters_blessing
0:25.278 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:26.034 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:26.789 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:27.542 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:28.297 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim, cleansed_sisters_blessing
0:29.052 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim
0:29.806 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim
0:30.561 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), blade_of_wrath, whisper_of_the_nathrezim
0:31.314 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, whisper_of_the_nathrezim
0:32.217 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, whisper_of_the_nathrezim
0:33.120 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, whisper_of_the_nathrezim
0:34.023 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, whisper_of_the_nathrezim
0:34.925 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, whisper_of_the_nathrezim, mark_of_the_claw
0:35.814 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, whisper_of_the_nathrezim, mark_of_the_claw
0:36.703 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, whisper_of_the_nathrezim, mark_of_the_claw
0:37.589 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, whisper_of_the_nathrezim, mark_of_the_claw
0:38.481 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, whisper_of_the_nathrezim, mark_of_the_claw
0:39.372 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, whisper_of_the_nathrezim, mark_of_the_claw
0:40.263 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:41.435 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:42.603 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
0:43.772 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:44.943 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:46.113 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
0:47.284 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power
0:48.454 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
0:49.625 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:50.795 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
0:51.966 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
0:53.137 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:54.306 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
0:55.477 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
0:56.647 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
0:57.816 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
0:58.986 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:00.157 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:01.328 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:02.499 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:03.669 Waiting 0.200 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:03.869 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:05.217 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath
1:06.388 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath
1:07.559 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:08.731 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:09.902 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
1:11.073 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
1:12.243 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:13.413 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:14.583 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:15.753 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power
1:16.924 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:18.094 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:19.266 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
1:20.435 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:21.607 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:22.776 Waiting 0.900 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
1:23.676 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:25.082 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:26.252 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:27.424 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:28.595 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:29.767 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
1:30.000 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:31.171 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
1:32.343 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing
1:33.514 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance, cleansed_ancients_blessing
1:34.683 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power shield_of_vengeance, cleansed_ancients_blessing
1:35.854 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_claw
1:35.854 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_claw
1:36.935 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_claw
1:38.017 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_claw
1:39.098 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_claw
1:40.180 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_claw
1:41.269 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:42.364 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:43.460 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:44.555 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, cleansed_sisters_blessing
1:45.649 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath
1:46.818 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:47.989 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:49.159 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:50.331 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:51.501 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:52.672 Waiting 0.400 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:53.072 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim
1:54.453 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
1:55.626 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
1:56.797 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
1:57.966 Waiting 0.200 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:58.166 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
1:59.517 Waiting 1.200 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
2:00.717 crusade Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
2:00.889 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade
2:00.889 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, potion_of_the_old_war
2:02.021 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), whisper_of_the_nathrezim, potion_of_the_old_war
2:03.048 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:04.074 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:05.101 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:06.041 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), whisper_of_the_nathrezim, potion_of_the_old_war
2:06.982 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), whisper_of_the_nathrezim, potion_of_the_old_war
2:07.922 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:08.790 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:09.657 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:10.523 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), whisper_of_the_nathrezim, potion_of_the_old_war
2:11.319 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:12.113 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:12.910 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:13.668 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:14.428 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:15.186 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:15.945 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw, potion_of_the_old_war
2:16.703 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:17.472 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:18.416 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:19.185 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:19.953 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:20.722 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:21.492 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:22.262 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:23.030 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, potion_of_the_old_war
2:23.799 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:24.568 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:25.336 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, potion_of_the_old_war
2:26.104 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim
2:26.872 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
2:27.640 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
2:28.408 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
2:29.176 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
2:29.944 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
2:30.711 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), the_fires_of_justice, whisper_of_the_nathrezim
2:31.480 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
2:32.650 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:33.821 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
2:34.993 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
2:36.163 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:37.333 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
2:38.502 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
2:39.673 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power the_fires_of_justice, whisper_of_the_nathrezim
2:40.842 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim
2:42.013 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
2:43.182 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, mark_of_the_claw
2:44.337 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
2:45.493 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
2:46.649 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
2:47.804 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, mark_of_the_claw
2:48.959 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
2:50.114 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
2:51.285 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
2:52.453 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
2:53.623 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
2:54.795 Waiting 0.200 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, whisper_of_the_nathrezim, cleansed_wisps_blessing
2:54.995 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, whisper_of_the_nathrezim, cleansed_wisps_blessing
2:56.345 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, cleansed_wisps_blessing
2:57.514 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, cleansed_wisps_blessing
2:58.685 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
2:59.856 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
3:00.000 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, shield_of_vengeance
3:01.171 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
3:02.342 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
3:03.513 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
3:04.682 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance
3:05.851 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:05.854 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:07.009 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:08.164 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:09.318 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:10.473 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:11.626 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:12.782 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:13.937 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
3:15.089 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:16.243 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:17.399 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:18.552 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:19.706 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
3:20.861 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
3:22.015 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
3:23.170 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:24.325 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:25.480 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim, mark_of_the_claw
3:26.634 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power the_fires_of_justice, whisper_of_the_nathrezim, mark_of_the_claw
3:27.788 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:28.942 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:30.111 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:31.282 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:32.451 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim
3:33.621 Waiting 0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:33.821 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:35.158 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, mark_of_the_claw
3:36.314 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, mark_of_the_claw
3:37.469 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:38.622 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:39.777 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
3:40.931 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
3:42.085 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:43.255 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim
3:44.427 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:45.598 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power mark_of_the_claw
3:46.752 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:47.907 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power the_fires_of_justice, whisper_of_the_nathrezim, mark_of_the_claw
3:49.061 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:50.216 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, mark_of_the_claw
3:51.370 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim
3:52.542 Waiting 1.000 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
3:53.542 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
3:54.924 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
3:56.095 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
3:57.266 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
3:58.437 Waiting 2.300 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim, cleansed_wisps_blessing
4:00.737 crusade Paladin_Retribution_T19M 220000.0/220000: 100% mana | 5.0/5: 100% holy_power cleansed_wisps_blessing
4:00.889 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, cleansed_wisps_blessing
4:02.019 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing
4:03.045 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing
4:04.071 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), blade_of_wrath, whisper_of_the_nathrezim, cleansed_wisps_blessing
4:05.098 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), cleansed_wisps_blessing
4:06.125 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), whisper_of_the_nathrezim, cleansed_wisps_blessing
4:07.064 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), whisper_of_the_nathrezim, cleansed_wisps_blessing
4:08.006 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), whisper_of_the_nathrezim, mark_of_the_claw
4:08.935 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), whisper_of_the_nathrezim, mark_of_the_claw
4:09.791 Waiting 0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), whisper_of_the_nathrezim, mark_of_the_claw
4:09.991 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), whisper_of_the_nathrezim, mark_of_the_claw
4:11.060 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:11.915 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:12.711 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(13), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:13.505 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
4:14.311 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), the_fires_of_justice, blade_of_wrath, whisper_of_the_nathrezim
4:15.117 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:15.886 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
4:16.654 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:17.423 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:18.193 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim
4:18.959 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), whisper_of_the_nathrezim
4:19.728 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
4:20.497 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
4:21.265 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), whisper_of_the_nathrezim
4:22.138 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), whisper_of_the_nathrezim
4:22.906 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), whisper_of_the_nathrezim
4:23.673 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
4:24.441 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim
4:25.210 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), whisper_of_the_nathrezim
4:25.980 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), whisper_of_the_nathrezim
4:26.751 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, mark_of_the_claw
4:27.509 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:28.266 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:29.024 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:29.781 shield_of_vengeance Paladin_Retribution_T19M 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:30.000 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:30.759 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:31.517 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:32.671 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:33.840 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:35.010 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:36.180 arcane_torrent Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:36.180 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:37.351 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, whisper_of_the_nathrezim, shield_of_vengeance
4:38.522 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power the_fires_of_justice, shield_of_vengeance
4:39.692 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:40.863 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:42.034 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:43.203 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power whisper_of_the_nathrezim, shield_of_vengeance
4:44.373 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim, shield_of_vengeance, mark_of_the_claw
4:45.529 Waiting 0.900 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:46.429 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, mark_of_the_claw
4:47.832 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, mark_of_the_claw
4:48.987 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim, mark_of_the_claw
4:50.142 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:51.313 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:52.542 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
4:53.711 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power whisper_of_the_nathrezim
4:54.882 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power whisper_of_the_nathrezim
4:56.053 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power whisper_of_the_nathrezim
4:57.224 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
4:58.396 crusader_strike Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power blade_of_wrath, whisper_of_the_nathrezim
4:59.566 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power blade_of_wrath, whisper_of_the_nathrezim
5:00.739 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power blade_of_wrath, whisper_of_the_nathrezim

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 27937 26231 14754 (12368)
Agility 3202 3202 0
Stamina 42162 42162 26174
Intellect 7331 7331 0
Spirit 2 2 0
Health 2529720 2529720 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 27937 26231 0
Crit 22.90% 22.90% 5916
Haste 28.63% 27.48% 8931
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 27937 26231 0
Mastery 37.10% 37.10% 5856
Armor 4346 4346 4346
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Crown of Steely Brambles
ilevel: 880, stats: { 593 Armor, +2573 Sta, +1715 StrInt, +949 Crit, +511 Mastery }
Local Neck Cursed Beartooth Necklace
ilevel: 880, stats: { +1448 Sta, +1115 Mastery, +939 Haste }, enchant: mark_of_the_claw
Local Shoulders Midnight Herald's Pauldrons
ilevel: 880, stats: { 547 Armor, +1930 Sta, +1287 StrInt, +735 Haste, +360 Crit }
Local Chest Horror Inscribed Chestguard
ilevel: 880, stats: { 729 Armor, +2573 Sta, +1715 StrInt, +1043 Crit, +417 Haste }
Local Waist Waistplate of Nameless Horror
ilevel: 880, stats: { 410 Armor, +1930 Sta, +1287 StrInt, +665 Haste, +430 Crit }
Local Legs Storm-Battered Legplates
ilevel: 880, stats: { 638 Armor, +2573 Sta, +1715 StrInt, +855 Haste, +605 Mastery }
Local Feet Trampling Warboots
ilevel: 880, stats: { 501 Armor, +1930 Sta, +1287 StrInt, +618 Mastery, +477 Haste }
Local Wrists Dragonbone Wristclamps
ilevel: 880, stats: { 319 Armor, +1447 Sta, +965 StrInt, +551 Mastery, +270 Haste }
Local Hands Fitted Ironbark Gauntlets
ilevel: 880, stats: { 456 Armor, +1930 Sta, +1287 StrInt, +712 Haste, +383 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Haste }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Haste }
Local Trinket1 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Trinket2 Spiked Counterweight
ilevel: 880, stats: { +1043 Haste }
Local Back Whisper of the Nathrezim
ilevel: 895, stats: { 153 Armor, +1665 Sta, +1110 StrInt, +559 Crit, +310 Haste }, enchant: { +200 Str }
Local Main Hand Ashbringer
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Seal of Light (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Paladin_Retribution_T19M"
level=110
race=blood_elf
role=attack
position=back
talents=1112112
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:44:3:47:3:49:1:50:3:51:3:52:3:53:3:54:1:350:1:351:1:352:1:353:1:1275:1
spec=retribution

head=crown_of_steely_brambles,id=139231,bonus_id=1806
neck=cursed_beartooth_necklace,id=139239,bonus_id=1806,enchant=mark_of_the_claw
shoulders=midnight_heralds_pauldrons,id=139232,bonus_id=1806
back=whisper_of_the_nathrezim,id=137020,enchant=binding_of_strength
chest=horror_inscribed_chestguard,id=138216,bonus_id=1806
wrists=dragonbone_wristclamps,id=138218,bonus_id=1806
hands=fitted_ironbark_gauntlets,id=139225,bonus_id=1806
waist=waistplate_of_nameless_horror,id=139227,bonus_id=1806
legs=stormbattered_legplates,id=139230,bonus_id=1806
feet=trampling_warboots,id=139234,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=binding_of_haste
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=binding_of_haste
trinket1=natures_call,id=139334,bonus_id=1806
trinket2=spiked_counterweight,id=136715,bonus_id=1806
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=139265/139266/139265,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=882.73
# gear_strength=14754
# gear_stamina=26174
# gear_crit_rating=5916
# gear_haste_rating=8931
# gear_mastery_rating=5856
# gear_armor=4346

Priest_Shadow_T19M : 423791 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
423790.9 423790.9 236.6 / 0.056% 40883.5 / 9.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.16% 54.5 100.0% 100%
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Void Lord (Shadow Priest)
  • 75: Shadowy Insight (Shadow Priest)
  • 90: Power Infusion (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Priest_Shadow_T19M 423791
Deadly Grace 16498 3.8% 41.1 7.47sec 118842 0 Direct 41.0 95418 190782 118901 24.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.06 41.04 0.00 0.00 0.0000 0.0000 4879184.41 4879184.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.93 75.37% 95418.26 87090 104508 95412.84 91271 99283 2951268 2951268 0.00
crit 10.11 24.63% 190781.73 174181 209017 190758.35 0 209017 1927916 1927916 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 91873 21.7% 110.3 2.71sec 250186 288457 Direct 111.3 198641 397206 247941 24.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.34 111.34 0.00 0.00 0.8673 0.0000 27605603.66 27605603.66 0.00 288456.79 288456.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.70 75.17% 198641.12 153942 240149 198617.73 187947 207024 16625737 16625737 0.00
crit 27.64 24.83% 397206.28 307883 480298 397172.87 355990 439713 10979866 10979866 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 33281 7.9% 76.1 3.89sec 131718 94596 Periodic 224.3 35786 71603 44661 24.8% 32.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.06 0.00 224.31 224.31 1.3924 0.4315 10017908.69 10017908.69 0.00 94596.03 94596.03
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.7 75.22% 35785.86 29483 46111 35793.10 34097 37925 6037927 6037927 0.00
crit 55.6 24.78% 71603.09 58966 92221 71608.43 65673 78115 3979982 3979982 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Plague Swarm 17564 4.1% 20.5 14.42sec 257872 0 Periodic 84.3 50237 100462 62656 24.7% 54.8%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.48 0.00 84.28 84.28 0.0000 1.9556 5280791.59 5280791.59 0.00 32039.17 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.4 75.27% 50237.20 24 57685 50250.47 46449 53890 3187062 3187062 0.00
crit 20.8 24.73% 100461.81 48 115371 100522.53 85403 110846 2093730 2093730 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 5248 1.2% 5.2 10.69sec 300187 342239 Direct 5.2 240651 481214 300189 24.7%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.24 5.24 0.00 0.00 0.8773 0.0000 1572586.83 1572586.83 0.00 342238.70 342238.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.94 75.25% 240651.10 192121 249757 240479.13 0 249757 948665 948665 0.00
crit 1.30 24.75% 481214.31 384241 499514 371453.13 0 499514 623922 623922 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 55559 (62022) 13.1% (14.6%) 3.6 106.91sec 5212316 5917347 Direct 3.6 36954 73693 46225 25.2%  
Periodic 265.0 49985 99928 62387 24.8% 98.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 3.58 264.99 264.99 0.8810 1.1174 16697202.58 16697202.58 0.00 62289.74 5917347.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.67 74.77% 36953.84 31076 63023 36120.68 0 61084 98813 98813 0.00
crit 0.90 25.23% 73693.15 62153 124107 47006.20 0 124107 66479 66479 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.2 75.17% 49985.14 38 89202 49979.04 47275 52802 9956674 9956674 0.00
crit 65.8 24.83% 99928.30 80 178404 99925.50 88660 112498 6575237 6575237 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.410000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 6463 1.5% 188.7 1.53sec 10292 0 Direct 104.1 18666 0 18666 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 188.74 104.06 0.00 0.00 0.0000 0.0000 1942440.53 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.06 100.00% 18665.74 9603 142152 18687.37 15766 22105 1942441 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 5562 1.3% 85.5 3.47sec 19555 0 Direct 84.3 15894 31792 19837 24.8%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.50 84.28 0.00 0.00 0.0000 0.0000 1671907.61 1671907.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.38 75.20% 15894.43 12315 19212 15894.65 14819 17185 1007461 1007461 0.00
crit 20.90 24.80% 31791.62 24631 38424 31794.69 28079 35961 664447 664447 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Tormenting Cyclone 9983 2.4% 15.4 19.06sec 195046 0 Direct 105.7 22740 45483 28379 24.8%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.38 105.74 0.00 0.00 0.0000 0.0000 3000704.33 3000704.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.52 75.21% 22740.07 17562 27396 22746.95 20124 25352 1808297 1808297 0.00
crit 26.22 24.79% 45483.46 35123 54792 45504.08 38460 52966 1192408 1192408 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Vampiric Touch 69376 16.4% 1.0 200.32sec 20843201 23641201 Periodic 177.3 94318 188490 117604 24.7% 99.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 177.31 177.31 0.8823 1.6807 20851539.14 20851539.14 0.00 69764.89 23641200.84
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.5 75.27% 94318.14 19733 167502 94309.85 88030 100013 12588202 12588202 0.00
crit 43.8 24.73% 188489.98 55543 331362 188460.70 161621 220245 8263337 8263337 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 64105 15.1% 75.8 3.76sec 254143 298985 Direct 75.5 204575 408979 255274 24.8%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.81 75.47 0.00 0.00 0.8500 0.0000 19266294.25 19266294.25 0.00 298985.00 298985.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.75 75.20% 204574.93 147731 230460 204559.20 198025 211748 11610571 11610571 0.00
crit 18.72 24.80% 408979.01 295462 460921 408946.41 384101 449102 7655723 7655723 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 4342 1.0% 7.3 42.56sec 178040 0 Direct 14.6 71693 143482 89428 24.7%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 14.59 0.00 0.00 0.0000 0.0000 1304496.35 1304496.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.98 75.30% 71693.09 67176 80611 71682.86 67176 77924 787429 787429 0.00
crit 3.60 24.70% 143481.75 134351 161222 140719.54 0 161222 517067 517067 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 21485 5.1% 5.1 62.67sec 1266758 299785 Periodic 40.2 128772 257416 160837 24.9% 6.7%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.10 0.00 40.18 40.18 4.2256 0.5047 6462170.63 6462170.63 0.00 299785.24 299785.24
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.2 75.08% 128771.72 194 153697 128754.29 113328 140952 3884411 3884411 0.00
crit 10.0 24.92% 257416.11 389 307394 257451.73 130835 307394 2577760 2577760 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 128274 / 9591
melee 128274 2.3% 28.0 6.96sec 102406 132460 Direct 28.0 82074 164135 102406 24.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.99 27.99 0.00 0.00 0.7731 0.0000 2866558.87 2866558.87 0.00 132459.63 132459.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.06 75.22% 82074.13 73399 84409 82034.28 78904 84409 1728202 1728202 0.00
crit 6.94 24.78% 164134.88 146798 168817 163833.69 0 168817 1138357 1138357 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 43983 / 10589
Mind Flay (_void_tendril) 43983 (50830) 2.5% (4.1%) 7.4 38.29sec 710829 80313 Periodic 65.2 39147 78294 48863 24.8% 21.7%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.36 0.00 65.16 65.16 8.8508 1.0000 3184103.91 3184103.91 0.00 80313.09 80313.09
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.0 75.18% 39147.00 39147 39147 39147.00 39147 39147 1917806 1917806 0.00
crit 16.2 24.82% 78294.00 78294 78294 78294.00 78294 78294 1266298 1266298 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43859 0.6% 1.8 86.35sec 432984 48819 Periodic 16.1 39147 78294 48817 24.7% 5.4%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.82 0.00 16.11 16.11 8.8695 1.0000 786569.43 786569.43 0.00 48818.86 48818.86
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.1 75.30% 39147.00 39147 39147 39080.04 0 39147 474947 474947 0.00
crit 4.0 24.70% 78294.00 78294 78294 74972.60 0 78294 311622 311622 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43927 0.4% 1.1 98.19sec 434440 48938 Periodic 9.5 39147 78294 48934 25.0% 3.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.07 0.00 9.53 9.53 8.8781 1.0000 466277.81 466277.81 0.00 48937.64 48937.64
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.1 75.00% 39147.00 39147 39147 39038.06 0 39147 279767 279767 0.00
crit 2.4 25.00% 78294.00 78294 78294 72265.80 0 78294 186511 186511 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43058 0.3% 1.0 0.00sec 424594 48085 Periodic 8.8 39147 78294 48081 22.8% 2.9%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 8.83 8.83 8.8308 1.0000 424594.38 424594.38 0.00 48085.43 48085.43
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.8 77.18% 39147.00 39147 39147 39147.00 39147 39147 266802 266802 0.00
crit 2.0 22.82% 78294.00 78294 78294 72271.38 0 78294 157793 157793 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 37190 0.3% 1.0 0.00sec 371897 41322 Periodic 9.0 39147 78294 41322 5.6% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 371896.50 371896.50 0.00 41321.83 41321.83
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.5 94.44% 39147.00 39147 39147 39147.00 39147 39147 332750 332750 0.00
crit 0.5 5.56% 78294.00 78294 78294 39147.00 0 78294 39147 39147 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Priest_Shadow_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.0 181.92sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:false
  • if_expr:
 
Mental Fortitude 177.3 1.68sec

Stats details: mental_fortitude

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 177.31 177.31 0.00 0.00 0.0000 0.0000 0.00 13013879.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.26 75.16% 0.00 0 0 0.00 0 0 0 7837645 100.00
crit 44.05 24.84% 0.00 0 0 0.00 0 0 0 5176235 100.00
 
 

Action details: mental_fortitude

Static Values
  • id:194018
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M
  • harmful:true
  • if_expr:
Spelldata
  • id:194018
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63723.54
  • base_dd_max:63723.54
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Power Infusion 2.7 126.19sec

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.insanity_drain_stacks.stack>=85
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
 
Shadowfiend 1.9 198.60sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.90 0.00 0.00 0.00 0.8617 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Summons a shadowy fiend to attack the target for {$d=12 seconds}.
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - shadowfiend
Shadowcrawl 3.8 66.49sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.77 0.00 0.00 0.00 0.8589 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.0 0.0 181.9sec 181.9sec 6.76% 8.81% 0.0(0.0) 2.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 14.49% 0.0(0.0) 1.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 7.3 188.8 42.5sec 42.5sec 69.82% 69.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:5.04%
  • insanity_drain_stacks_2:2.43%
  • insanity_drain_stacks_3:2.50%
  • insanity_drain_stacks_4:2.48%
  • insanity_drain_stacks_5:2.40%
  • insanity_drain_stacks_6:2.42%
  • insanity_drain_stacks_7:2.38%
  • insanity_drain_stacks_8:2.39%
  • insanity_drain_stacks_9:2.45%
  • insanity_drain_stacks_10:2.36%
  • insanity_drain_stacks_11:2.90%
  • insanity_drain_stacks_12:2.87%
  • insanity_drain_stacks_13:2.37%
  • insanity_drain_stacks_14:3.22%
  • insanity_drain_stacks_15:2.67%
  • insanity_drain_stacks_16:2.36%
  • insanity_drain_stacks_17:2.56%
  • insanity_drain_stacks_18:2.39%
  • insanity_drain_stacks_19:2.27%
  • insanity_drain_stacks_20:2.29%
  • insanity_drain_stacks_21:2.25%
  • insanity_drain_stacks_22:2.12%
  • insanity_drain_stacks_23:1.97%
  • insanity_drain_stacks_24:1.80%
  • insanity_drain_stacks_25:1.51%
  • insanity_drain_stacks_26:1.30%
  • insanity_drain_stacks_27:1.09%
  • insanity_drain_stacks_28:0.96%
  • insanity_drain_stacks_29:0.89%
  • insanity_drain_stacks_30:0.85%
  • insanity_drain_stacks_31:0.80%
  • insanity_drain_stacks_32:0.69%
  • insanity_drain_stacks_33:0.50%
  • insanity_drain_stacks_34:0.25%
  • insanity_drain_stacks_35:0.10%
  • insanity_drain_stacks_36:0.02%
  • insanity_drain_stacks_37:0.00%
  • insanity_drain_stacks_38:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 7.3 0.0 39.8sec 39.8sec 43.01% 86.12% 0.0(0.0) 6.1

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_20:0.01%
  • lingering_insanity_21:0.68%
  • lingering_insanity_22:3.53%
  • lingering_insanity_23:1.73%
  • lingering_insanity_24:3.72%
  • lingering_insanity_25:1.64%
  • lingering_insanity_26:0.53%
  • lingering_insanity_27:0.80%
  • lingering_insanity_28:1.46%
  • lingering_insanity_29:3.83%
  • lingering_insanity_30:2.69%
  • lingering_insanity_31:3.28%
  • lingering_insanity_32:1.53%
  • lingering_insanity_33:1.13%
  • lingering_insanity_34:1.80%
  • lingering_insanity_35:2.24%
  • lingering_insanity_36:5.03%
  • lingering_insanity_37:4.21%
  • lingering_insanity_38:2.19%
  • lingering_insanity_39:0.91%
  • lingering_insanity_40:0.06%
  • lingering_insanity_41:0.01%
  • lingering_insanity_42:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.4 3.1 26.2sec 20.2sec 25.50% 25.50% 3.1(3.1) 11.1

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Mental Fortitude 1.0 176.3 3.5sec 1.7sec 98.81% 98.81% 176.3(176.3) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • mental_fortitude_1:98.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194018
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 265.3sec 0.0sec 19.61% 19.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power Infusion 2.7 0.0 126.1sec 126.1sec 17.41% 17.41% 0.0(0.0) 2.5

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • power_infusion_1:17.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Shadowy Insight 25.1 1.3 11.5sec 10.9sec 8.96% 8.96% 1.3(1.3) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

  • shadowy_insight_1:8.96%

Trigger Attempt Success

  • trigger_pct:9.97%

Spelldata details

  • id:162452
  • name:Shadowy Insight
  • tooltip:
  • description:Shadow Word: Pain periodic damage has a {$h=10}% chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
Sphere of Insanity 7.3 0.0 42.5sec 42.5sec 69.82% 71.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:69.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 1.0 192.0 0.0sec 0.5sec 34.37% 34.37% 192.0(192.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:34.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 5.1 0.0 62.7sec 62.7sec 6.75% 6.75% 0.0(0.0) 5.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 7.3 0.0 42.5sec 42.5sec 69.82% 73.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.44%
  • voidform_2:2.43%
  • voidform_3:2.42%
  • voidform_4:2.41%
  • voidform_5:2.40%
  • voidform_6:2.40%
  • voidform_7:2.39%
  • voidform_8:2.38%
  • voidform_9:2.37%
  • voidform_10:2.36%
  • voidform_11:2.35%
  • voidform_12:2.34%
  • voidform_13:2.33%
  • voidform_14:2.32%
  • voidform_15:2.31%
  • voidform_16:2.31%
  • voidform_17:2.30%
  • voidform_18:2.29%
  • voidform_19:2.28%
  • voidform_20:2.27%
  • voidform_21:2.26%
  • voidform_22:2.14%
  • voidform_23:1.99%
  • voidform_24:1.86%
  • voidform_25:1.70%
  • voidform_26:1.65%
  • voidform_27:1.61%
  • voidform_28:1.55%
  • voidform_29:1.41%
  • voidform_30:1.24%
  • voidform_31:1.07%
  • voidform_32:0.95%
  • voidform_33:0.88%
  • voidform_34:0.81%
  • voidform_35:0.70%
  • voidform_36:0.51%
  • voidform_37:0.26%
  • voidform_38:0.11%
  • voidform_39:0.02%
  • voidform_40:0.00%
  • voidform_41:0.00%
  • voidform_42:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend: Shadowcrawl 3.8 0.0 66.6sec 66.6sec 83.49% 78.43% 0.0(0.0) 3.7

Buff details

  • buff initial source:Priest_Shadow_T19M_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:83.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Priest_Shadow_T19M
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T19M
Resource Gains Type Count Total Average Overflow
Insanity Drained by Voidform Insanity 4198.64 -3191.56 (-4939.01%) -0.76 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 111.34 1319.06 (2041.28%) 11.85 17.03 1.27%
Insanity Gained from Mind Flay Insanity 224.31 448.61 (694.24%) 2.00 0.00 0.00%
Insanity Gained from Power Infusion Insanity 77.53 126.92 (196.40%) 1.64 69.55 35.40%
Insanity Gained from Shadow Word: Death Insanity 5.24 50.70 (78.46%) 9.68 1.76 3.35%
Insanity Gained from Shadow Word: Pain Casts Insanity 3.58 10.73 (16.60%) 3.00 0.00 0.00%
Insanity Gained from Vampiric Touch Casts Insanity 1.00 4.00 (6.19%) 4.00 0.00 0.00%
Insanity Gained from Void Bolt Insanity 75.81 1057.81 (1636.99%) 13.95 155.14 12.79%
Insanity Saved by Void Torrent Insanity 403.21 238.35 (368.85%) 0.59 0.00 0.00%
Health from Vampiric Touch Ticks Health 177.31 0.00 (0.00%) 0.00 10425925.92 100.00%
mp5_regen Mana 888.69 0.00 (0.00%) 0.00 2643029.52 100.00%
Resource RPS-Gain RPS-Loss
Insanity 10.83 10.62
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 64.71 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 85.5 3.5sec
Shadowy Insight Mind Blast CD Reset from Shadow Word: Pain 25.1 11.5sec
Shadowy Insight Mind Blast CD Reset lost to overflow 1.3 78.0sec
Void Eruption casted when a target with both DoTs was up 7.3 42.5sec
Void Tendril spawned from Call to the Void 8.9 30.8sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Priest_Shadow_T19M Damage Per Second
Count 7499
Mean 423790.89
Minimum 391259.51
Maximum 469353.77
Spread ( max - min ) 78094.26
Range [ ( max - min ) / 2 * 100% ] 9.21%
Standard Deviation 10454.8346
5th Percentile 407371.26
95th Percentile 441931.14
( 95th Percentile - 5th Percentile ) 34559.88
Mean Distribution
Standard Deviation 120.7301
95.00% Confidence Intervall ( 423554.26 - 424027.52 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2337
0.1 Scale Factor Error with Delta=300 933078
0.05 Scale Factor Error with Delta=300 3732312
0.01 Scale Factor Error with Delta=300 93307811
Priority Target DPS
Sample Data Priest_Shadow_T19M Priority Target Damage Per Second
Count 7499
Mean 423790.89
Minimum 391259.51
Maximum 469353.77
Spread ( max - min ) 78094.26
Range [ ( max - min ) / 2 * 100% ] 9.21%
Standard Deviation 10454.8346
5th Percentile 407371.26
95th Percentile 441931.14
( 95th Percentile - 5th Percentile ) 34559.88
Mean Distribution
Standard Deviation 120.7301
95.00% Confidence Intervall ( 423554.26 - 424027.52 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2337
0.1 Scale Factor Error with Delta=300 933078
0.05 Scale Factor Error with Delta=300 3732312
0.01 Scale Factor Error with Delta=300 93307811
DPS(e)
Sample Data Priest_Shadow_T19M Damage Per Second (Effective)
Count 7499
Mean 423790.89
Minimum 391259.51
Maximum 469353.77
Spread ( max - min ) 78094.26
Range [ ( max - min ) / 2 * 100% ] 9.21%
Damage
Sample Data Priest_Shadow_T19M Damage
Count 7499
Mean 120552830.58
Minimum 89682248.75
Maximum 153388577.26
Spread ( max - min ) 63706328.51
Range [ ( max - min ) / 2 * 100% ] 26.42%
DTPS
Sample Data Priest_Shadow_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Priest_Shadow_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Priest_Shadow_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Priest_Shadow_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 2.60 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 1.00 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 7.33 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
E 0.83 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
F 27.96 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
G 1.17 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
H 20.52 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
I 2.70 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
J 2.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
K 3.25 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
L 72.56 void_bolt
M 5.10 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
N 1.39 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
O 81.44 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
P 3.02 shadow_word_death,if=cooldown.shadow_word_death.charges=2
Q 1.90 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
R 0.98 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
S 0.00 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
T 36.37 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain

Sample Sequence

012456BCFFHFHBGDMLOOLTIJLOLOLOLOLOLOLOLOLOLOLOLOOLOOLOOLOOFFHFHFDTLOOLTLOOLOTLMLOOLOQLOOLTFHFHFHFHDTKOTLOTLOTLOTLTLOTLOTHFHFHFHFGBDMLOTLOTILOTLTLOOLOOLOOLOOLTLOTLOTLOTLTFHFHFHDTKOOLOTLTLOMLJOOLOTLOTLTLOOLOHFHFHGDTKOTLTLOOLTLOTLOPLNOLOHFHFHE7DMKOOKOOIKPRLOTLOQLTLOPLOTLOTLTLOOLPT

Sample Sequence Table

time name target resources buffs
Pre flask Priest_Shadow_T19M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Priest_Shadow_T19M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Priest_Shadow_T19M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity mark_of_the_claw, potion_of_deadly_grace
0:00.000 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity mark_of_the_claw, potion_of_deadly_grace
0:00.877 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:01.751 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:02.627 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace
0:03.503 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:08.138 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:09.027 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:10.529 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.0/100: 81% insanity bloodlust, shadowy_insight, potion_of_deadly_grace, mental_fortitude
0:11.416 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:12.295 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity bloodlust, mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:12.295 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:16.467 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.2/100: 94% insanity bloodlust, sphere_of_insanity, voidform(5), insanity_drain_stacks(2), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:17.302 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.3/100: 92% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:18.128 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.3/100: 96% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
0:18.955 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.8/100: 100% insanity bloodlust, sphere_of_insanity, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace, mental_fortitude
0:19.781 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity bloodlust, sphere_of_insanity, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace, mental_fortitude
0:21.735 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity bloodlust, shadowy_insight, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
0:21.735 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity bloodlust, power_infusion, shadowy_insight, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
0:21.735 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity bloodlust, berserking, power_infusion, shadowy_insight, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
0:22.490 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.6/100: 89% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace, mental_fortitude
0:23.245 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace, mental_fortitude
0:24.154 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(9), potion_of_deadly_grace, mental_fortitude
0:24.904 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 95% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace, mental_fortitude
0:25.787 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.7/100: 90% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
0:26.539 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.2/100: 94% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), potion_of_deadly_grace, mental_fortitude
0:27.403 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.3/100: 89% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), potion_of_deadly_grace, mental_fortitude
0:28.158 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.1/100: 93% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), mental_fortitude
0:28.991 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), mental_fortitude
0:29.740 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.1/100: 92% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), mark_of_the_claw, mental_fortitude
0:30.560 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mark_of_the_claw, mental_fortitude
0:31.312 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, berserking, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
0:32.147 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.6/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
0:32.896 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.8/100: 88% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), mark_of_the_claw, mental_fortitude
0:33.768 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.7/100: 87% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mark_of_the_claw, mental_fortitude
0:34.520 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.2/100: 88% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
0:35.481 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mark_of_the_claw, mental_fortitude
0:36.243 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mental_fortitude
0:37.182 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mental_fortitude
0:37.931 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.8/100: 86% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), mental_fortitude
0:38.865 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), mental_fortitude
0:39.616 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), mental_fortitude
0:40.688 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.1/100: 81% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mental_fortitude
0:41.442 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity power_infusion, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mental_fortitude
0:42.309 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mental_fortitude
0:43.190 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.7/100: 70% insanity sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mental_fortitude
0:44.069 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.1/100: 61% insanity sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mental_fortitude
0:44.936 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.6/100: 54% insanity sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mark_of_the_claw, mental_fortitude
0:45.788 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.5/100: 50% insanity sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mark_of_the_claw, mental_fortitude
0:46.637 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.1/100: 41% insanity sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mark_of_the_claw, mental_fortitude
0:47.480 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.5/100: 33% insanity sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mark_of_the_claw, mental_fortitude
0:48.316 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.3/100: 27% insanity sphere_of_insanity, voidform(37), insanity_drain_stacks(34), mark_of_the_claw, mental_fortitude
0:49.149 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity sphere_of_insanity, voidform(37), insanity_drain_stacks(34), mark_of_the_claw, mental_fortitude
0:50.040 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(38), mark_of_the_claw, mental_fortitude
0:50.865 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(38), mark_of_the_claw, mental_fortitude
0:51.690 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(38), mark_of_the_claw, mental_fortitude
0:53.201 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(38), mark_of_the_claw, mental_fortitude
0:54.026 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity lingering_insanity(38), mark_of_the_claw, mental_fortitude
0:58.370 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(38), mental_fortitude
0:59.204 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity lingering_insanity(38), mental_fortitude
0:59.204 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity sphere_of_insanity, voidform, lingering_insanity(38), insanity_drain_stacks, mental_fortitude
1:01.091 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity shadowy_insight, sphere_of_insanity, voidform(2), lingering_insanity(38), insanity_drain_stacks(2), mental_fortitude
1:01.905 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity sphere_of_insanity, voidform(3), lingering_insanity(38), insanity_drain_stacks(3), mental_fortitude
1:02.712 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity sphere_of_insanity, voidform(4), lingering_insanity(38), insanity_drain_stacks(4), mental_fortitude
1:03.516 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.6/100: 93% insanity sphere_of_insanity, voidform(5), lingering_insanity(38), insanity_drain_stacks(5), mental_fortitude
1:04.311 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.2/100: 91% insanity sphere_of_insanity, voidform(6), lingering_insanity(38), insanity_drain_stacks(6), mental_fortitude
1:06.222 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity shadowy_insight, sphere_of_insanity, voidform(8), lingering_insanity(38), insanity_drain_stacks(8), mental_fortitude
1:06.993 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.3/100: 84% insanity sphere_of_insanity, voidform(8), lingering_insanity(38), insanity_drain_stacks(8), mental_fortitude
1:07.975 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 83% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
1:09.034 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.8/100: 82% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
1:10.073 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.3/100: 83% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:11.112 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.5/100: 81% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
1:12.141 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.6/100: 70% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
1:13.150 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.6/100: 71% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:17.454 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.8/100: 66% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(15), mental_fortitude
1:18.421 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.9/100: 66% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(16), mental_fortitude
1:19.382 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.5/100: 62% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mental_fortitude
1:20.335 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.3/100: 58% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mental_fortitude
1:21.279 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.1/100: 58% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(19), mental_fortitude
1:22.216 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mental_fortitude
1:23.147 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.8/100: 37% insanity shadowy_insight, sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mental_fortitude
1:24.068 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.8/100: 35% insanity sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mental_fortitude
1:24.984 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.7/100: 30% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mental_fortitude
1:25.900 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.9/100: 24% insanity sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mental_fortitude
1:26.801 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.9/100: 22% insanity sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mental_fortitude
1:28.825 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(29), mental_fortitude
1:29.719 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(29), mental_fortitude
1:31.238 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity lingering_insanity(29), mental_fortitude
1:32.130 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity lingering_insanity(29), mental_fortitude
1:36.328 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity lingering_insanity(29), mark_of_the_claw, mental_fortitude
1:37.211 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity lingering_insanity(29), mark_of_the_claw, mental_fortitude
1:38.315 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity lingering_insanity(29), mark_of_the_claw, mental_fortitude
1:39.199 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(29), mark_of_the_claw, mental_fortitude
1:40.809 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity lingering_insanity(29), mental_fortitude
1:40.809 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity sphere_of_insanity, voidform, lingering_insanity(29), insanity_drain_stacks, mental_fortitude
1:42.796 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.4/100: 76% insanity sphere_of_insanity, voidform(2), lingering_insanity(29), insanity_drain_stacks(2), mental_fortitude
1:43.664 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.4/100: 83% insanity sphere_of_insanity, voidform(3), lingering_insanity(29), insanity_drain_stacks(3), mental_fortitude
1:44.533 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.9/100: 87% insanity sphere_of_insanity, voidform(4), lingering_insanity(29), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
1:45.381 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.8/100: 82% insanity sphere_of_insanity, voidform(5), lingering_insanity(29), insanity_drain_stacks(5), mark_of_the_claw, mental_fortitude
1:46.219 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.5/100: 88% insanity sphere_of_insanity, voidform(6), lingering_insanity(29), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
1:47.050 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 91% insanity sphere_of_insanity, voidform(7), lingering_insanity(29), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
1:47.876 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity sphere_of_insanity, voidform(8), lingering_insanity(29), insanity_drain_stacks(8), mark_of_the_claw, mental_fortitude
1:48.694 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity sphere_of_insanity, voidform(8), lingering_insanity(29), insanity_drain_stacks(8), mark_of_the_claw, mental_fortitude
1:49.704 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 90% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mark_of_the_claw, mental_fortitude
1:50.746 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.8/100: 80% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
1:51.786 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:52.825 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
1:53.845 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.4/100: 67% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:54.855 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.4/100: 68% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
1:57.060 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.1/100: 40% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
1:58.042 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.9/100: 40% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
1:59.019 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.7/100: 35% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
1:59.987 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.6/100: 22% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
2:00.933 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.3/100: 20% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mark_of_the_claw, mental_fortitude
2:01.874 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.3/100: 14% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
2:02.807 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity lingering_insanity(22), mark_of_the_claw, mental_fortitude
2:03.985 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity lingering_insanity(22), mark_of_the_claw, mental_fortitude
2:04.916 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(22), mark_of_the_claw, mental_fortitude
2:07.926 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(22), mental_fortitude
2:08.869 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(22), mental_fortitude
2:10.063 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity lingering_insanity(22), mental_fortitude
2:11.008 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(22), mark_of_the_claw, mental_fortitude
2:14.043 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(22), mark_of_the_claw, mental_fortitude
2:14.975 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity lingering_insanity(22), mark_of_the_claw, mental_fortitude
2:15.908 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity lingering_insanity(22), mark_of_the_claw, mental_fortitude
2:16.840 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.0/100: 97% insanity lingering_insanity(22), mark_of_the_claw, mental_fortitude
2:16.840 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.0/100: 97% insanity sphere_of_insanity, voidform, lingering_insanity(22), insanity_drain_stacks, mark_of_the_claw, mental_fortitude
2:21.062 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.7/100: 95% insanity sphere_of_insanity, voidform(5), lingering_insanity(22), insanity_drain_stacks(2), mental_fortitude
2:21.960 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity sphere_of_insanity, voidform(6), lingering_insanity(22), insanity_drain_stacks(3), mental_fortitude
2:22.851 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.7/100: 95% insanity sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(4), mental_fortitude
2:23.735 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(4), mental_fortitude
2:24.611 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity sphere_of_insanity, voidform(8), lingering_insanity(22), insanity_drain_stacks(5), mental_fortitude
2:25.606 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.2/100: 91% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
2:26.649 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.8/100: 83% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
2:26.649 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.8/100: 83% insanity power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
2:27.472 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), mark_of_the_claw, mental_fortitude
2:28.292 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.7/100: 95% insanity power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(9), mark_of_the_claw, mental_fortitude
2:29.102 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.3/100: 89% insanity power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), mark_of_the_claw, mental_fortitude
2:29.908 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), mark_of_the_claw, mental_fortitude
2:31.746 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity power_infusion, shadowy_insight, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), mental_fortitude
2:32.531 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.4/100: 82% insanity power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), mark_of_the_claw, mental_fortitude
2:33.313 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), mark_of_the_claw, mental_fortitude
2:34.087 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.5/100: 89% insanity power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), mark_of_the_claw, mental_fortitude
2:34.856 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.2/100: 87% insanity power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mark_of_the_claw, mental_fortitude
2:35.621 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mark_of_the_claw, mental_fortitude
2:36.385 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.7/100: 93% insanity power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
2:37.142 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), mark_of_the_claw, mental_fortitude
2:37.895 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.6/100: 89% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mark_of_the_claw, mental_fortitude
2:38.649 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mark_of_the_claw, mental_fortitude
2:39.397 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
2:40.149 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mark_of_the_claw, mental_fortitude
2:40.905 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
2:41.659 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
2:43.349 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.9/100: 62% insanity power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), mark_of_the_claw, mental_fortitude
2:44.106 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.6/100: 67% insanity power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), mental_fortitude
2:44.860 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.9/100: 66% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mental_fortitude
2:45.611 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mark_of_the_claw, mental_fortitude
2:46.364 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.8/100: 59% insanity power_infusion, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mark_of_the_claw, mental_fortitude
2:47.231 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.1/100: 52% insanity sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mark_of_the_claw, mental_fortitude
2:48.100 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mark_of_the_claw, mental_fortitude
2:48.961 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.5/100: 32% insanity sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mark_of_the_claw, mental_fortitude
2:49.819 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.9/100: 25% insanity sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mark_of_the_claw, mental_fortitude
2:50.676 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.5/100: 9% insanity sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mark_of_the_claw, mental_fortitude
2:51.523 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.1/100: 4% insanity sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mental_fortitude
2:53.500 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(35), mark_of_the_claw, mental_fortitude
2:54.343 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(35), mark_of_the_claw, mental_fortitude
2:57.024 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(35), mark_of_the_claw, mental_fortitude
2:57.872 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity lingering_insanity(35), mental_fortitude
3:01.877 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity lingering_insanity(35), mental_fortitude
3:02.779 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(35), mental_fortitude
3:05.713 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity lingering_insanity(35), mental_fortitude
3:05.713 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity sphere_of_insanity, voidform, lingering_insanity(35), insanity_drain_stacks, mental_fortitude
3:07.592 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity shadowy_insight, sphere_of_insanity, voidform(2), lingering_insanity(35), insanity_drain_stacks(2), mental_fortitude
3:08.424 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity sphere_of_insanity, voidform(3), lingering_insanity(35), insanity_drain_stacks(3), mental_fortitude
3:09.240 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity sphere_of_insanity, voidform(4), lingering_insanity(35), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
3:10.052 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.6/100: 93% insanity sphere_of_insanity, voidform(5), lingering_insanity(35), insanity_drain_stacks(5), mark_of_the_claw, mental_fortitude
3:10.852 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.2/100: 91% insanity sphere_of_insanity, voidform(6), lingering_insanity(35), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
3:11.647 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.4/100: 94% insanity sphere_of_insanity, voidform(6), lingering_insanity(35), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
3:12.441 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity sphere_of_insanity, voidform(7), lingering_insanity(35), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
3:13.224 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity sphere_of_insanity, voidform(8), lingering_insanity(35), insanity_drain_stacks(8), mark_of_the_claw, mental_fortitude
3:14.965 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.1/100: 76% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
3:16.171 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
3:17.211 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
3:21.436 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.5/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(12), mental_fortitude
3:22.420 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.7/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(13), mental_fortitude
3:22.420 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.7/100: 72% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(13), mental_fortitude
3:23.276 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(14), mark_of_the_claw, mental_fortitude
3:24.115 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.8/100: 70% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(15), mark_of_the_claw, mental_fortitude
3:24.944 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(16), mark_of_the_claw, mental_fortitude
3:25.769 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.3/100: 71% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
3:26.588 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.7/100: 62% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mark_of_the_claw, mental_fortitude
3:27.400 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.1/100: 64% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mark_of_the_claw, mental_fortitude
3:28.212 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(19), mark_of_the_claw, mental_fortitude
3:29.017 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.7/100: 51% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mark_of_the_claw, mental_fortitude
3:29.822 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.2/100: 52% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mental_fortitude
3:31.625 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.9/100: 26% insanity berserking, twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mental_fortitude
3:32.416 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity berserking, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mental_fortitude
3:33.318 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mental_fortitude
3:34.217 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.4/100: 13% insanity twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mental_fortitude
3:35.106 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.6/100: 12% insanity twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mental_fortitude
3:35.994 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:37.564 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:38.451 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:43.136 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:44.025 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:48.792 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:49.680 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity twist_of_fate, lingering_insanity(30), mental_fortitude
3:49.680 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(30), insanity_drain_stacks, mental_fortitude
3:51.655 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(30), insanity_drain_stacks(2), mental_fortitude
3:52.508 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(30), insanity_drain_stacks(3), mark_of_the_claw, mental_fortitude
3:53.481 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.5/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(30), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
3:54.324 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(30), insanity_drain_stacks(5), mark_of_the_claw, mental_fortitude
3:55.153 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(30), insanity_drain_stacks(6), mark_of_the_claw, mental_fortitude
3:57.132 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.2/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(30), insanity_drain_stacks(8), mark_of_the_claw, mental_fortitude
3:58.020 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.6/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mark_of_the_claw, mental_fortitude
3:59.071 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
4:00.284 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.1/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
4:01.315 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
4:03.620 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.9/100: 50% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
4:04.621 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
4:05.622 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
4:06.616 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
4:07.592 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
4:08.567 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
4:09.526 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.9/100: 20% insanity twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
4:10.480 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
4:11.413 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.9/100: 10% insanity twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mark_of_the_claw, mental_fortitude
4:12.339 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.2/100: 3% insanity twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mark_of_the_claw, mental_fortitude
4:13.259 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.2/100: 1% insanity twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(24), mark_of_the_claw, mental_fortitude
4:14.175 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(24), mark_of_the_claw, mental_fortitude
4:15.836 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity twist_of_fate, lingering_insanity(24), mark_of_the_claw, mental_fortitude
4:16.758 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity twist_of_fate, lingering_insanity(24), mental_fortitude
4:21.223 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity twist_of_fate, lingering_insanity(24), mark_of_the_claw, mental_fortitude
4:22.140 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity twist_of_fate, lingering_insanity(24), mark_of_the_claw, mental_fortitude
4:26.892 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, lingering_insanity(24), mental_fortitude
4:27.821 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, shadowy_insight, lingering_insanity(24), mental_fortitude
4:27.821 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, shadowy_insight, lingering_insanity(24), potion_of_deadly_grace, mental_fortitude
4:27.821 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, shadowy_insight, sphere_of_insanity, voidform, lingering_insanity(24), insanity_drain_stacks, potion_of_deadly_grace, mental_fortitude
4:32.033 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.7/100: 88% insanity twist_of_fate, shadowy_insight, sphere_of_insanity, voidform(5), lingering_insanity(24), insanity_drain_stacks(2), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:32.907 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.2/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(24), insanity_drain_stacks(3), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:33.773 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(24), insanity_drain_stacks(3), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:34.640 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.5/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(24), insanity_drain_stacks(4), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:35.496 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.8/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(24), insanity_drain_stacks(5), potion_of_deadly_grace, mental_fortitude
4:36.478 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(6), potion_of_deadly_grace, mental_fortitude
4:37.537 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
4:37.537 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
4:38.370 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace, mental_fortitude
4:39.198 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(9), potion_of_deadly_grace, mental_fortitude
4:40.019 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace, mental_fortitude
4:40.833 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
4:41.643 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.7/100: 93% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
4:42.453 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(12), potion_of_deadly_grace, mental_fortitude
4:43.251 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.3/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(13), potion_of_deadly_grace, mental_fortitude
4:44.046 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.3/100: 91% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), potion_of_deadly_grace, mental_fortitude
4:44.833 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.3/100: 79% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
4:45.616 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
4:47.489 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.2/100: 66% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), potion_of_deadly_grace, mental_fortitude
4:48.253 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.5/100: 73% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), potion_of_deadly_grace, mental_fortitude
4:49.016 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.5/100: 76% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), potion_of_deadly_grace, mental_fortitude
4:49.771 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.5/100: 75% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), potion_of_deadly_grace, mental_fortitude
4:50.521 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.0/100: 81% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), potion_of_deadly_grace, mental_fortitude
4:51.270 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.1/100: 82% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), potion_of_deadly_grace, mental_fortitude
4:52.022 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.9/100: 72% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), potion_of_deadly_grace, mental_fortitude
4:52.777 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), potion_of_deadly_grace, mental_fortitude
4:53.525 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), potion_of_deadly_grace, mental_fortitude
4:54.277 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.6/100: 68% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), potion_of_deadly_grace, mental_fortitude
4:55.029 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), potion_of_deadly_grace, mental_fortitude
4:56.700 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.7/100: 48% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), potion_of_deadly_grace, mental_fortitude
4:57.450 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.3/100: 51% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), potion_of_deadly_grace, mental_fortitude
4:58.363 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.5/100: 44% insanity twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mental_fortitude
4:59.244 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.3/100: 35% insanity twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mental_fortitude
5:00.113 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.7/100: 32% insanity twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mental_fortitude
5:00.978 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.8/100: 21% insanity twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mental_fortitude

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 42217 42217 26216
Intellect 39146 37440 28334 (2596)
Spirit 1 1 0
Health 2533020 2533020 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 39146 37440 0
Crit 24.40% 24.40% 6790
Haste 30.67% 29.51% 9592
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 8800 8800 0
Mastery 43.43% 43.43% 3280
Armor 1819 1819 1819
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 884.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_claw
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Dreamscale Inlaid Vestments
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +918 Haste, +542 Mastery }
Local Waist Mangaza's Madness
ilevel: 895, stats: { 172 Armor, +2219 Sta, +1479 Int, +745 Crit, +413 Haste }
Local Legs Ragged Horrorweave Leggings
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +824 Haste, +636 Mastery }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +735 Haste, +360 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +569 Haste, +252 Mastery }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Haste }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Haste }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 906, weapon: { 1922 - 3571, 1.8 }, stats: { +937 Int, +1405 Sta, +350 Crit, +337 Mastery, +11921 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Secrets of the Void
ilevel: 906, stats: { +1230 Int, +1844 Sta, +627 Haste, +278 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Priest_Shadow_T19M"
level=110
race=troll
role=spell
position=back
talents=1211311
artifact=47:139251:139257:139251:0:764:1:765:1:766:1:767:3:768:1:769:1:770:1:771:3:772:5:773:3:774:3:775:3:776:4:777:3:778:3:779:1:1347:1
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_claw
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=200int
chest=dreamscale_inlaid_vestments,id=138215,bonus_id=1806
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1806
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=mangazas_madness,id=132864
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1806
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=200haste
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200haste
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=139251/139257/139251,relic_id=1806/1806/1806
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=884.19
# gear_stamina=26216
# gear_intellect=28334
# gear_crit_rating=6790
# gear_haste_rating=9592
# gear_mastery_rating=3280
# gear_armor=1819

Priest_Shadow_T19M_S2M : 476939 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
476938.9 476938.9 812.7 / 0.170% 155255.9 / 32.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 4.65% 52.1 100.0% 100%
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Shadowy Insight (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Surrender to Madness (Shadow Priest)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Priest_Shadow_T19M_S2M 476939
Deadly Grace 18851 3.9% 46.0 6.41sec 121169 0 Direct 45.9 97152 194314 121186 24.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.95 45.95 0.00 0.00 0.0000 0.0000 5568168.36 5568168.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.58 75.26% 97151.56 79173 104508 96914.82 84121 101025 3359670 3359670 0.00
crit 11.37 24.74% 194313.53 158346 209017 193822.36 169656 209017 2208499 2208499 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 87337 18.3% 101.9 2.80sec 257263 292630 Direct 102.9 204263 408383 254761 24.7%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.86 102.86 0.00 0.00 0.8791 0.0000 26203587.98 26203587.98 0.00 292630.39 292630.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.41 75.26% 204263.13 153942 240149 204294.34 189526 214145 15811918 15811918 0.00
crit 25.45 24.74% 408383.29 307883 480298 408406.03 351757 453028 10391670 10391670 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 25638 5.4% 59.3 4.25sec 129903 90555 Periodic 173.6 35561 71100 44358 24.8% 26.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.27 0.00 173.57 173.57 1.4345 0.4498 7699324.71 7699324.71 0.00 90554.72 90554.72
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.6 75.25% 35561.27 29483 46111 35588.73 33495 37871 4644614 4644614 0.00
crit 43.0 24.75% 71099.83 58966 92221 71166.81 64511 80436 3054711 3054711 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Plague Swarm 17568 3.7% 20.4 14.36sec 257971 0 Periodic 83.8 50457 100830 62951 24.8% 54.5%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.44 0.00 83.76 83.76 0.0000 1.9563 5272775.59 5272775.59 0.00 32178.54 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.0 75.20% 50457.39 24 57685 50488.67 46672 54448 3178141 3178141 0.00
crit 20.8 24.80% 100829.92 48 115371 100894.79 80418 112412 2094635 2094635 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 8913 1.9% 8.5 10.74sec 312207 395072 Direct 8.5 249331 498630 312211 25.2%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.52 8.52 0.00 0.00 0.7903 0.0000 2660812.96 2660812.96 0.00 395072.45 395072.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 74.78% 249331.13 160101 249757 249346.36 219871 249757 1589016 1589016 0.00
crit 2.15 25.22% 498629.67 320201 499514 453475.82 0 499514 1071797 1071797 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 77958 (84906) 16.3% (17.8%) 2.8 73.71sec 9097956 10049191 Direct 2.8 32484 64963 40575 24.9%  
Periodic 263.3 70553 141264 88089 24.8% 97.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.79 2.79 263.26 263.26 0.9053 1.1176 23303570.63 23303570.63 0.00 85541.74 10049190.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.10 75.09% 32483.58 31076 65932 30828.46 0 63993 68058 68058 0.00
crit 0.69 24.91% 64963.17 62153 127985 34847.71 0 127985 45144 45144 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 198.0 75.20% 70553.04 27 145438 70655.37 51359 86820 13967628 13967628 0.00
crit 65.3 24.80% 141264.18 62 290875 141453.24 98050 183951 9222741 9222741 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.410000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 6948 1.5% 206.8 1.35sec 10059 0 Direct 112.5 18500 0 18500 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 206.84 112.47 0.00 0.00 0.0000 0.0000 2080685.13 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.47 100.00% 18499.86 9603 149834 18517.11 15438 22557 2080685 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 5726 1.2% 84.8 3.46sec 20258 0 Direct 83.7 16425 32844 20516 24.9%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.79 83.73 0.00 0.00 0.0000 0.0000 1717673.43 1717673.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.87 75.09% 16424.91 10708 19212 16426.13 14778 17818 1032571 1032571 0.00
crit 20.86 24.91% 32843.85 21416 38424 32853.80 27512 37570 685103 685103 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Tormenting Cyclone 10262 2.2% 15.3 18.92sec 200742 0 Direct 105.7 23322 46668 29114 24.8%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.33 105.72 0.00 0.00 0.0000 0.0000 3077865.51 3077865.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.49 75.19% 23321.59 15965 27396 23335.38 19918 26372 1853814 1853814 0.00
crit 26.23 24.81% 46667.70 31930 54792 46690.02 38197 54395 1224051 1224051 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Vampiric Touch 96903 20.3% 1.2 148.09sec 24457952 27383612 Periodic 175.0 132702 265376 165537 24.7% 97.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.18 0.00 175.02 175.02 0.8938 1.6796 28971861.34 28971861.34 0.00 98202.71 27383611.85
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.7 75.25% 132701.58 80 273101 132946.23 92971 159550 17477371 17477371 0.00
crit 43.3 24.75% 265375.77 426 546202 265810.94 182429 361043 11494490 11494490 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 69162 14.5% 79.2 3.53sec 261421 300031 Direct 79.0 209814 419647 261972 24.9%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.21 79.05 0.00 0.00 0.8713 0.0000 20708431.38 20708431.38 0.00 300030.88 300030.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.40 75.14% 209813.68 147731 230460 209730.67 195005 215398 12462304 12462304 0.00
crit 19.65 24.86% 419647.15 295462 460921 419464.66 384101 454519 8246128 8246128 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 2909 0.6% 5.2 38.83sec 167559 0 Direct 10.5 67290 134583 83783 24.5%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.24 10.48 0.00 0.00 0.0000 0.0000 878171.30 878171.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.91 75.50% 67290.22 67176 80611 67262.15 67176 71014 532498 532498 0.00
crit 2.57 24.50% 134582.83 134351 161222 126027.31 0 161222 345673 345673 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 15138 3.2% 3.3 78.14sec 1389500 328054 Periodic 28.3 131344 262571 163855 24.8% 4.4%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.34 0.00 28.33 28.33 4.2356 0.4699 4642288.84 4642288.84 0.00 328053.77 328053.77
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.3 75.22% 131344.15 261 153697 132182.04 112930 149040 2799112 2799112 0.00
crit 7.0 24.78% 262570.91 523 307394 263282.67 0 307394 1843177 1843177 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - mindbender 93819 / 22664
melee 93819 4.8% 82.3 3.27sec 82752 96467 Direct 82.3 66275 132527 82751 24.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.34 82.34 0.00 0.00 0.8578 0.0000 6813755.03 6813755.03 0.00 96467.02 96467.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.86 75.13% 66274.74 58719 67527 66271.03 65430 67144 4099848 4099848 0.00
crit 20.48 24.87% 132527.19 117438 135054 132521.80 126246 135054 2713907 2713907 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 43980 / 9129
Mind Flay (_void_tendril) 43980 (51393) 1.9% (3.4%) 6.3 40.31sec 782593 87262 Periodic 56.2 39147 78294 48871 24.8% 18.7%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.27 0.00 56.21 56.21 8.9683 1.0000 2747065.94 2747065.94 0.00 87262.16 87262.16
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.2 75.16% 39147.00 39147 39147 39147.00 39147 39147 1653863 1653863 0.00
crit 14.0 24.84% 78294.00 78294 78294 78294.00 78294 78294 1093203 1093203 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43886 0.5% 1.6 84.75sec 438149 48759 Periodic 14.5 39147 78294 48757 24.5% 4.8%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.61 0.00 14.51 14.51 8.9863 1.0000 707492.79 707492.79 0.00 48758.98 48758.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.9 75.45% 39147.00 39147 39147 39139.62 0 39147 428596 428596 0.00
crit 3.6 24.55% 78294.00 78294 78294 75078.46 0 78294 278897 278897 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 43918 0.3% 1.0 90.10sec 438378 48778 Periodic 9.4 39147 78294 48777 24.6% 3.1%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.05 0.00 9.40 9.40 8.9875 1.0000 458513.09 458513.09 0.00 48777.99 48777.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.1 75.40% 39147.00 39147 39147 39095.63 0 39147 277471 277471 0.00
crit 2.3 24.60% 78294.00 78294 78294 71615.38 0 78294 181042 181042 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 44388 0.3% 1.0 0.00sec 443876 49320 Periodic 9.0 39147 78294 49320 26.0% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 443876.47 443876.47 0.00 49319.61 49319.61
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.7 74.01% 39147.00 39147 39147 39147.00 39147 39147 260770 260770 0.00
crit 2.3 25.99% 78294.00 78294 78294 74505.58 0 78294 183107 183107 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 54806 0.4% 1.0 0.00sec 548058 60895 Periodic 9.0 39147 78294 60895 55.6% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 548058.00 548058.00 0.00 60895.33 60895.33
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.0 44.44% 39147.00 39147 39147 39147.00 39147 39147 156588 156588 0.00
crit 5.0 55.56% 78294.00 78294 78294 78294.00 78294 78294 391470 391470 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Priest_Shadow_T19M_S2M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:false
  • if_expr:
 
Berserking 1.5 261.89sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Dispersion 2.0 90.18sec

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.95 0.00 11.72 0.00 6.2519 1.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dispersion

Static Values
  • id:47585
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
Spelldata
  • id:47585
  • name:Dispersion
  • school:shadow
  • tooltip:Reduces all damage taken by {$s1=60}%. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:Disperse into pure Shadow energy for {$d=6 seconds}, reducing all damage you take by {$47585s1=60}%, but you are unable to attack or cast spells. Castable while stunned, feared, or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed. Voidform does not drain Insanity while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:false
  • if_expr:
 
Mental Fortitude 175.0 1.69sec

Stats details: mental_fortitude

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 175.02 175.02 0.00 0.00 0.0000 0.0000 0.00 18070591.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.73 75.27% 0.00 0 0 0.00 0 0 0 10901247 100.00
crit 43.29 24.73% 0.00 0 0 0.00 0 0 0 7169344 100.00
 
 

Action details: mental_fortitude

Static Values
  • id:194018
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Priest_Shadow_T19M_S2M
  • harmful:true
  • if_expr:
Spelldata
  • id:194018
  • name:Mental Fortitude
  • school:physical
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:60885.64
  • base_dd_max:60885.64
 
Mindbender 5.0 64.44sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.03 0.00 0.00 0.00 0.9416 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
Surrender to Madness 1.0 0.00sec

Stats details: surrender_to_madness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: surrender_to_madness

Static Values
  • id:193223
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:600.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
Spelldata
  • id:193223
  • name:Surrender to Madness
  • school:physical
  • tooltip:Generating {$s1=150}% more Insanity. When you exit Voidform, you will die.
  • description:All your Insanity-generating abilities generate {$s1=150}% more Insanity, and you can cast while moving, until you exit Voidform. Then you die. Horribly.
 
pet - mindbender
Shadowcrawl 14.7 19.43sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.67 0.00 0.00 0.00 0.9155 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Well Fed (azshari_salad) 1.0 0.0 0.0sec 0.0sec 95.67% 95.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:95.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 1.5 0.0 262.0sec 262.0sec 4.85% 6.14% 0.0(0.0) 1.4

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:4.85%

Trigger Attempt Success

  • trigger_pct:97.57%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 14.44% 0.0(0.0) 1.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 95.67% 95.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:95.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Dispersion 2.0 0.0 0.0sec 0.0sec 3.97% 3.97% 11.7(11.7) 2.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_dispersion
  • max_stacks:1
  • duration:6.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • dispersion_1:3.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:47585
  • name:Dispersion
  • tooltip:Reduces all damage taken by {$s1=60}%. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:Disperse into pure Shadow energy for {$d=6 seconds}, reducing all damage you take by {$47585s1=60}%, but you are unable to attack or cast spells. Castable while stunned, feared, or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed. Voidform does not drain Insanity while dispersed.
  • max_stacks:0
  • duration:6.00
  • cooldown:120.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 95.67% 95.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:95.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
insanity_drain_stacks 5.2 201.4 38.8sec 38.8sec 75.85% 75.85% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.32%
  • insanity_drain_stacks_2:2.22%
  • insanity_drain_stacks_3:2.96%
  • insanity_drain_stacks_4:1.89%
  • insanity_drain_stacks_5:1.74%
  • insanity_drain_stacks_6:1.74%
  • insanity_drain_stacks_7:1.75%
  • insanity_drain_stacks_8:1.75%
  • insanity_drain_stacks_9:1.75%
  • insanity_drain_stacks_10:1.74%
  • insanity_drain_stacks_11:1.79%
  • insanity_drain_stacks_12:1.79%
  • insanity_drain_stacks_13:1.76%
  • insanity_drain_stacks_14:1.80%
  • insanity_drain_stacks_15:1.80%
  • insanity_drain_stacks_16:1.81%
  • insanity_drain_stacks_17:1.82%
  • insanity_drain_stacks_18:1.82%
  • insanity_drain_stacks_19:1.77%
  • insanity_drain_stacks_20:1.78%
  • insanity_drain_stacks_21:1.67%
  • insanity_drain_stacks_22:1.48%
  • insanity_drain_stacks_23:1.48%
  • insanity_drain_stacks_24:1.27%
  • insanity_drain_stacks_25:1.25%
  • insanity_drain_stacks_26:1.13%
  • insanity_drain_stacks_27:0.98%
  • insanity_drain_stacks_28:0.84%
  • insanity_drain_stacks_29:0.69%
  • insanity_drain_stacks_30:0.55%
  • insanity_drain_stacks_31:0.44%
  • insanity_drain_stacks_32:0.38%
  • insanity_drain_stacks_33:0.35%
  • insanity_drain_stacks_34:0.34%
  • insanity_drain_stacks_35:0.34%
  • insanity_drain_stacks_36:0.34%
  • insanity_drain_stacks_37:0.34%
  • insanity_drain_stacks_38:0.34%
  • insanity_drain_stacks_39:0.34%
  • insanity_drain_stacks_40:0.34%
  • insanity_drain_stacks_41:0.34%
  • insanity_drain_stacks_42:0.34%
  • insanity_drain_stacks_43:0.34%
  • insanity_drain_stacks_44:0.34%
  • insanity_drain_stacks_45:0.34%
  • insanity_drain_stacks_46:0.34%
  • insanity_drain_stacks_47:0.34%
  • insanity_drain_stacks_48:0.34%
  • insanity_drain_stacks_49:0.34%
  • insanity_drain_stacks_50:0.34%
  • insanity_drain_stacks_51:0.34%
  • insanity_drain_stacks_52:0.34%
  • insanity_drain_stacks_53:0.34%
  • insanity_drain_stacks_54:0.34%
  • insanity_drain_stacks_55:0.34%
  • insanity_drain_stacks_56:0.34%
  • insanity_drain_stacks_57:0.34%
  • insanity_drain_stacks_58:0.34%
  • insanity_drain_stacks_59:1.09%
  • insanity_drain_stacks_60:0.90%
  • insanity_drain_stacks_61:0.37%
  • insanity_drain_stacks_62:0.34%
  • insanity_drain_stacks_63:0.34%
  • insanity_drain_stacks_64:0.34%
  • insanity_drain_stacks_65:0.34%
  • insanity_drain_stacks_66:0.34%
  • insanity_drain_stacks_67:0.34%
  • insanity_drain_stacks_68:0.34%
  • insanity_drain_stacks_69:0.34%
  • insanity_drain_stacks_70:0.34%
  • insanity_drain_stacks_71:0.34%
  • insanity_drain_stacks_72:0.33%
  • insanity_drain_stacks_73:0.33%
  • insanity_drain_stacks_74:0.33%
  • insanity_drain_stacks_75:0.33%
  • insanity_drain_stacks_76:0.33%
  • insanity_drain_stacks_77:0.32%
  • insanity_drain_stacks_78:2.17%
  • insanity_drain_stacks_79:0.32%
  • insanity_drain_stacks_80:0.31%
  • insanity_drain_stacks_81:0.31%
  • insanity_drain_stacks_82:0.31%
  • insanity_drain_stacks_83:0.31%
  • insanity_drain_stacks_84:0.31%
  • insanity_drain_stacks_85:0.31%
  • insanity_drain_stacks_86:0.31%
  • insanity_drain_stacks_87:0.31%
  • insanity_drain_stacks_88:0.31%
  • insanity_drain_stacks_89:0.31%
  • insanity_drain_stacks_90:0.30%
  • insanity_drain_stacks_91:0.30%
  • insanity_drain_stacks_92:0.29%
  • insanity_drain_stacks_93:0.28%
  • insanity_drain_stacks_94:0.27%
  • insanity_drain_stacks_95:0.25%
  • insanity_drain_stacks_96:0.21%
  • insanity_drain_stacks_97:0.14%
  • insanity_drain_stacks_98:0.10%
  • insanity_drain_stacks_99:0.07%
  • insanity_drain_stacks_100:0.07%
  • insanity_drain_stacks_101:0.07%
  • insanity_drain_stacks_102:0.06%
  • insanity_drain_stacks_103:0.05%
  • insanity_drain_stacks_104:0.05%
  • insanity_drain_stacks_105:0.05%
  • insanity_drain_stacks_106:0.04%
  • insanity_drain_stacks_107:0.04%
  • insanity_drain_stacks_108:0.03%
  • insanity_drain_stacks_109:0.04%
  • insanity_drain_stacks_110:0.04%
  • insanity_drain_stacks_111:0.02%
  • insanity_drain_stacks_112:0.00%
  • insanity_drain_stacks_113:0.00%
  • insanity_drain_stacks_114:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 5.2 0.0 58.5sec 58.5sec 17.11% 17.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_19:0.07%
  • lingering_insanity_20:0.46%
  • lingering_insanity_21:1.64%
  • lingering_insanity_22:0.87%
  • lingering_insanity_23:1.35%
  • lingering_insanity_24:0.89%
  • lingering_insanity_25:0.67%
  • lingering_insanity_26:1.27%
  • lingering_insanity_27:1.85%
  • lingering_insanity_28:1.37%
  • lingering_insanity_29:1.30%
  • lingering_insanity_30:0.87%
  • lingering_insanity_31:0.62%
  • lingering_insanity_32:0.78%
  • lingering_insanity_33:0.76%
  • lingering_insanity_34:0.93%
  • lingering_insanity_35:0.75%
  • lingering_insanity_36:0.44%
  • lingering_insanity_37:0.18%
  • lingering_insanity_38:0.05%
  • lingering_insanity_39:0.01%
  • lingering_insanity_40:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of the Claw 11.3 3.0 26.1sec 20.3sec 25.04% 25.04% 3.0(3.0) 10.9

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:550.00
  • stat:haste_rating
  • amount:550.00

Stack Uptimes

  • mark_of_the_claw_1:25.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=550}.
  • description:Critical strike and haste increased by {$s1=550}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Mental Fortitude 1.8 173.3 280.5sec 1.7sec 98.37% 98.37% 173.3(173.3) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_mental_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • mental_fortitude_1:98.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194018
  • name:Mental Fortitude
  • tooltip:
  • description:Healing from Vampiric Touch when you are at maximum health will shield you for the same amount. Shield cannot exceed ${$MHP*0.08} damage absorbed.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 257.3sec 0.0sec 19.02% 19.02% 0.0(0.0) 1.6

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:19.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadowform 1.0 0.0 0.0sec 0.0sec 95.67% 95.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:95.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowy Insight 24.3 2.2 11.8sec 10.8sec 12.79% 12.79% 2.2(2.2) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_shadowy_insight
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

  • shadowy_insight_1:12.79%

Trigger Attempt Success

  • trigger_pct:10.05%

Spelldata details

  • id:162452
  • name:Shadowy Insight
  • tooltip:
  • description:Shadow Word: Pain periodic damage has a {$h=10}% chance to reset the remaining cooldown on Mind Blast and cause your next Mind Blast to be instant.
  • max_stacks:2
  • duration:0.00
  • cooldown:0.00
  • default_chance:10.00%
Sphere of Insanity 5.2 0.0 38.8sec 38.8sec 75.85% 78.68% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:75.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Surrender to Madness 1.0 0.0 0.0sec 0.0sec 40.16% 44.68% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_surrender_to_madness
  • max_stacks:1
  • duration:180.00
  • cooldown:600.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • surrender_to_madness_1:40.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193223
  • name:Surrender to Madness
  • tooltip:Generating {$s1=150}% more Insanity. When you exit Voidform, you will die.
  • description:All your Insanity-generating abilities generate {$s1=150}% more Insanity, and you can cast while moving, until you exit Voidform. Then you die. Horribly.
  • max_stacks:0
  • duration:180.00
  • cooldown:600.00
  • default_chance:0.00%
Surrender to Madness (_death) 0.8 0.0 0.0sec 0.0sec 4.33% 4.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_surrender_to_madness_death
  • max_stacks:1
  • duration:0.00
  • cooldown:600.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • surrender_to_madness_death_1:4.33%

Trigger Attempt Success

  • trigger_pct:77.04%

Spelldata details

  • id:193223
  • name:Surrender to Madness
  • tooltip:Generating {$s1=150}% more Insanity. When you exit Voidform, you will die.
  • description:All your Insanity-generating abilities generate {$s1=150}% more Insanity, and you can cast while moving, until you exit Voidform. Then you die. Horribly.
  • max_stacks:0
  • duration:180.00
  • cooldown:600.00
  • default_chance:0.00%
Twist of Fate 1.8 225.7 80.5sec 0.4sec 33.65% 33.65% 225.7(225.7) 0.2

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:33.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 3.3 0.0 78.2sec 78.2sec 4.33% 4.33% 0.0(0.0) 3.3

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:4.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 5.2 0.0 38.8sec 38.8sec 75.85% 80.45% 6.1(6.1) 0.0

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:3.03%
  • voidform_2:2.21%
  • voidform_3:1.74%
  • voidform_4:1.74%
  • voidform_5:1.74%
  • voidform_6:1.74%
  • voidform_7:1.74%
  • voidform_8:1.74%
  • voidform_9:1.74%
  • voidform_10:1.74%
  • voidform_11:1.74%
  • voidform_12:1.74%
  • voidform_13:1.74%
  • voidform_14:1.74%
  • voidform_15:1.74%
  • voidform_16:1.74%
  • voidform_17:1.74%
  • voidform_18:1.74%
  • voidform_19:1.73%
  • voidform_20:1.72%
  • voidform_21:1.62%
  • voidform_22:1.48%
  • voidform_23:1.41%
  • voidform_24:1.28%
  • voidform_25:1.20%
  • voidform_26:1.12%
  • voidform_27:0.99%
  • voidform_28:0.88%
  • voidform_29:0.77%
  • voidform_30:0.69%
  • voidform_31:0.64%
  • voidform_32:0.59%
  • voidform_33:0.54%
  • voidform_34:0.47%
  • voidform_35:0.41%
  • voidform_36:0.37%
  • voidform_37:0.35%
  • voidform_38:0.34%
  • voidform_39:0.34%
  • voidform_40:0.34%
  • voidform_41:0.34%
  • voidform_42:0.34%
  • voidform_43:0.34%
  • voidform_44:0.34%
  • voidform_45:0.34%
  • voidform_46:0.34%
  • voidform_47:0.34%
  • voidform_48:0.34%
  • voidform_49:0.34%
  • voidform_50:0.34%
  • voidform_51:0.34%
  • voidform_52:0.34%
  • voidform_53:0.34%
  • voidform_54:0.34%
  • voidform_55:0.34%
  • voidform_56:0.34%
  • voidform_57:0.34%
  • voidform_58:0.34%
  • voidform_59:0.34%
  • voidform_60:0.34%
  • voidform_61:0.34%
  • voidform_62:0.34%
  • voidform_63:0.34%
  • voidform_64:0.34%
  • voidform_65:0.34%
  • voidform_66:0.34%
  • voidform_67:0.34%
  • voidform_68:0.34%
  • voidform_69:0.34%
  • voidform_70:0.34%
  • voidform_71:0.34%
  • voidform_72:0.34%
  • voidform_73:0.34%
  • voidform_74:0.34%
  • voidform_75:0.34%
  • voidform_76:0.34%
  • voidform_77:0.34%
  • voidform_78:0.34%
  • voidform_79:0.34%
  • voidform_80:0.33%
  • voidform_81:0.33%
  • voidform_82:0.33%
  • voidform_83:0.33%
  • voidform_84:0.33%
  • voidform_85:0.32%
  • voidform_86:2.17%
  • voidform_87:0.32%
  • voidform_88:0.31%
  • voidform_89:0.31%
  • voidform_90:0.31%
  • voidform_91:0.31%
  • voidform_92:0.31%
  • voidform_93:0.31%
  • voidform_94:0.31%
  • voidform_95:0.31%
  • voidform_96:0.31%
  • voidform_97:0.31%
  • voidform_98:0.30%
  • voidform_99:0.30%
  • voidform_100:2.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: Shadowcrawl 14.7 0.0 19.4sec 19.4sec 86.70% 85.71% 0.0(0.0) 9.7

Buff details

  • buff initial source:Priest_Shadow_T19M_S2M_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T19M_S2M
Resource Gains Type Count Total Average Overflow
Insanity Saved by Dispersion Insanity 233.35 321.86 (2568.41%) 1.38 0.00 0.00%
Insanity Drained by Voidform Insanity 4551.17 -5338.82 (-42603.04%) -1.17 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 102.86 1193.44 (9523.44%) 11.60 40.83 3.31%
Insanity Gained from Mind Flay Insanity 173.57 342.86 (2736.00%) 1.98 4.28 1.23%
Insanity Gained from Mindbender Insanity 82.34 281.32 (2244.90%) 3.42 48.04 14.59%
Insanity Gained from Shadow Word: Death Insanity 8.52 193.16 (1541.36%) 22.66 62.51 24.45%
Insanity Gained from Shadow Word: Pain Casts Insanity 2.79 6.14 (49.03%) 2.20 2.23 26.59%
Insanity Gained from Surrender to Madness Insanity 167.37 1639.62 (13083.92%) 9.80 894.22 35.29%
Insanity Gained from Vampiric Touch Casts Insanity 1.18 4.38 (34.99%) 3.70 0.35 7.46%
Insanity Gained from Void Bolt Insanity 79.21 1088.05 (8682.45%) 13.74 179.39 14.15%
Insanity Saved by Void Torrent Insanity 265.90 280.52 (2238.52%) 1.05 0.00 0.00%
Health from Vampiric Touch Ticks Health 175.02 0.00 (0.00%) 0.00 14486063.42 100.00%
mp5_regen Mana 996.46 0.00 (0.00%) 0.00 2643653.71 100.00%
Resource RPS-Gain RPS-Loss
Insanity 17.80 17.76
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 12.65 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 84.8 3.5sec
Shadowy Insight Mind Blast CD Reset from Shadow Word: Pain 24.3 11.8sec
Shadowy Insight Mind Blast CD Reset lost to overflow 2.2 59.8sec
Void Eruption casted when a target with both DoTs was up 5.2 38.8sec
Void Tendril spawned from Call to the Void 7.5 32.7sec

Statistics & Data Analysis

Fight Length
Sample Data Priest_Shadow_T19M_S2M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Priest_Shadow_T19M_S2M Damage Per Second
Count 7499
Mean 476938.93
Minimum 296711.39
Maximum 560697.12
Spread ( max - min ) 263985.73
Range [ ( max - min ) / 2 * 100% ] 27.68%
Standard Deviation 35906.6460
5th Percentile 389903.99
95th Percentile 523319.31
( 95th Percentile - 5th Percentile ) 133415.31
Mean Distribution
Standard Deviation 414.6419
95.00% Confidence Intervall ( 476126.25 - 477751.62 )
Normalized 95.00% Confidence Intervall ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 217
0.1% Error 21773
0.1 Scale Factor Error with Delta=300 11006097
0.05 Scale Factor Error with Delta=300 44024389
0.01 Scale Factor Error with Delta=300 1100609735
Priority Target DPS
Sample Data Priest_Shadow_T19M_S2M Priority Target Damage Per Second
Count 7499
Mean 476938.93
Minimum 296711.39
Maximum 560697.12
Spread ( max - min ) 263985.73
Range [ ( max - min ) / 2 * 100% ] 27.68%
Standard Deviation 35906.6460
5th Percentile 389903.99
95th Percentile 523319.31
( 95th Percentile - 5th Percentile ) 133415.31
Mean Distribution
Standard Deviation 414.6419
95.00% Confidence Intervall ( 476126.25 - 477751.62 )
Normalized 95.00% Confidence Intervall ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 217
0.1% Error 21773
0.1 Scale Factor Error with Delta=300 11006097
0.05 Scale Factor Error with Delta=300 44024389
0.01 Scale Factor Error with Delta=300 1100609735
DPS(e)
Sample Data Priest_Shadow_T19M_S2M Damage Per Second (Effective)
Count 7499
Mean 476938.93
Minimum 296711.39
Maximum 560697.12
Spread ( max - min ) 263985.73
Range [ ( max - min ) / 2 * 100% ] 27.68%
Damage
Sample Data Priest_Shadow_T19M_S2M Damage
Count 7499
Mean 132785217.14
Minimum 67542357.07
Maximum 173780727.07
Spread ( max - min ) 106238370.00
Range [ ( max - min ) / 2 * 100% ] 40.00%
DTPS
Sample Data Priest_Shadow_T19M_S2M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Priest_Shadow_T19M_S2M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Priest_Shadow_T19M_S2M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Priest_Shadow_T19M_S2M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Priest_Shadow_T19M_S2M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Priest_Shadow_T19M_S2M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Priest_Shadow_T19M_S2MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Priest_Shadow_T19M_S2M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
B 1.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
C 1.07 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
D 2.59 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
E 1.11 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
F 5.24 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
0.00 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
G 0.02 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
0.00 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
H 19.67 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
0.00 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
I 13.06 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain
actions.s2m
# count action,conditions
0.00 shadow_crash,if=talent.shadow_crash.enabled
J 1.91 mindbender,if=talent.mindbender.enabled
K 1.95 dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
0.00 power_infusion,if=buff.insanity_drain_stacks.stack>=85
L 0.92 berserking,if=buff.voidform.stack>=90
M 0.04 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
N 0.64 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
O 42.17 void_bolt
P 2.05 void_torrent
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
Q 3.52 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
R 43.54 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
S 4.97 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
T 0.13 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
U 0.07 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
V 10.94 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
actions.vf
# count action,conditions
W 0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
X 1.59 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
Y 0.58 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
Z 1.33 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
a 35.14 void_bolt
0.00 void_torrent,if=!talent.surrender_to_madness.enabled
b 1.29 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
c 0.01 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
d 39.14 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
e 0.00 shadow_word_death,if=cooldown.shadow_word_death.charges=2
f 0.46 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
g 0.07 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
h 0.01 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
0.00 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
0.00 mind_sear,if=active_enemies>=3,interrupt=1
i 23.70 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
0.00 shadow_word_pain

Sample Sequence

012456CDEHHIHFdiaiaddadiadiaddaiadiadiaiabaddHIHIHIHDFiadiXaddaiaYdiadiadiaddaddaddadIHIHHIHFiZiZdgaddadiaiadIHIHIHIDIFiadiadiadiaiaddaddaddHIHHHIBHFJKNPORRORVORVORVOVORRORSORROVORRORSORVOVORVORSORVOVOJRORRORRORROPORRORSOROVOQRORR7ORORROKOQRORLROROROQOROROROQORORO

Sample Sequence Table

time name target resources buffs
Pre flask Priest_Shadow_T19M_S2M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Priest_Shadow_T19M_S2M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Priest_Shadow_T19M_S2M 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.888 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity bloodlust, potion_of_deadly_grace
0:01.774 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity bloodlust, potion_of_deadly_grace
0:02.662 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity bloodlust, potion_of_deadly_grace
0:03.548 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity bloodlust, potion_of_deadly_grace
0:04.435 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:07.379 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:08.266 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, potion_of_deadly_grace, mental_fortitude
0:08.266 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace, mental_fortitude
0:09.146 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace, mental_fortitude
0:10.026 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.8/100: 99% insanity bloodlust, sphere_of_insanity, voidform(2), insanity_drain_stacks(2), potion_of_deadly_grace, mental_fortitude
0:10.889 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.7/100: 96% insanity bloodlust, sphere_of_insanity, voidform(3), insanity_drain_stacks(3), potion_of_deadly_grace, mental_fortitude
0:12.948 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.5/100: 91% insanity bloodlust, shadowy_insight, sphere_of_insanity, voidform(5), insanity_drain_stacks(5), potion_of_deadly_grace, mental_fortitude
0:13.786 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(6), potion_of_deadly_grace, mental_fortitude
0:14.619 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.5/100: 92% insanity bloodlust, sphere_of_insanity, voidform(7), insanity_drain_stacks(7), potion_of_deadly_grace, mental_fortitude
0:15.449 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.9/100: 99% insanity bloodlust, sphere_of_insanity, voidform(8), insanity_drain_stacks(8), potion_of_deadly_grace, mental_fortitude
0:16.268 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity bloodlust, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), potion_of_deadly_grace, mental_fortitude
0:17.082 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.3/100: 91% insanity bloodlust, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), potion_of_deadly_grace, mental_fortitude
0:17.897 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity bloodlust, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), potion_of_deadly_grace, mental_fortitude
0:18.698 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.1/100: 89% insanity bloodlust, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace, mental_fortitude
0:19.574 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.5/100: 89% insanity bloodlust, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace, mental_fortitude
0:20.367 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity bloodlust, shadowy_insight, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace, mental_fortitude
0:21.153 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.9/100: 86% insanity bloodlust, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace, mental_fortitude
0:21.933 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.9/100: 86% insanity bloodlust, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), potion_of_deadly_grace, mental_fortitude
0:22.729 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity bloodlust, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), potion_of_deadly_grace, mental_fortitude
0:23.499 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity bloodlust, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), potion_of_deadly_grace, mental_fortitude
0:25.318 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.3/100: 65% insanity bloodlust, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace, mental_fortitude
0:26.073 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.6/100: 69% insanity bloodlust, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace, mental_fortitude
0:26.825 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.2/100: 67% insanity bloodlust, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), potion_of_deadly_grace, mental_fortitude
0:27.576 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.7/100: 58% insanity bloodlust, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), potion_of_deadly_grace, mental_fortitude
0:28.328 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.1/100: 60% insanity bloodlust, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
0:29.082 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.9/100: 58% insanity bloodlust, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
0:29.830 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.6/100: 48% insanity bloodlust, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mental_fortitude
0:30.582 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.0/100: 49% insanity bloodlust, sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mental_fortitude
0:32.264 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity bloodlust, sphere_of_insanity, voidform(24), insanity_drain_stacks(24), mental_fortitude
0:33.012 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.3/100: 24% insanity bloodlust, sphere_of_insanity, voidform(25), insanity_drain_stacks(25), mental_fortitude
0:37.346 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.9/100: 17% insanity bloodlust, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mental_fortitude
0:38.101 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.2/100: 17% insanity bloodlust, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mental_fortitude
0:38.851 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.8/100: 13% insanity bloodlust, sphere_of_insanity, voidform(31), insanity_drain_stacks(27), mental_fortitude
0:39.602 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity bloodlust, lingering_insanity(32), mental_fortitude
0:40.461 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(32), mental_fortitude
0:42.021 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(32), mental_fortitude
0:42.894 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(32), mental_fortitude
0:47.498 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity lingering_insanity(32), mental_fortitude
0:48.373 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(32), mental_fortitude
0:52.971 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity lingering_insanity(32), mark_of_the_claw, mental_fortitude
0:53.833 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(32), mark_of_the_claw, mental_fortitude
0:54.696 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(32), mark_of_the_claw, mental_fortitude
0:54.696 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mark_of_the_claw, mental_fortitude
0:57.180 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
0:58.294 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mental_fortitude
0:59.399 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.8/100: 89% insanity sphere_of_insanity, voidform(5), insanity_drain_stacks(5), mental_fortitude
1:00.495 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity sphere_of_insanity, voidform(6), insanity_drain_stacks(6), mental_fortitude
1:01.571 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.2/100: 68% insanity shadowy_insight, sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mental_fortitude
1:02.638 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.6/100: 76% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(8), mental_fortitude
1:03.694 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
1:04.750 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.6/100: 80% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:05.788 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.6/100: 86% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
1:08.097 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.2/100: 71% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:09.104 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
1:09.104 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity berserking, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
1:09.977 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.2/100: 78% insanity berserking, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
1:10.843 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.5/100: 72% insanity berserking, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
1:11.699 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.2/100: 77% insanity berserking, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
1:12.548 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity berserking, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
1:13.395 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity berserking, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
1:14.233 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.1/100: 77% insanity berserking, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
1:15.071 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.4/100: 77% insanity berserking, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
1:15.898 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.3/100: 65% insanity berserking, shadowy_insight, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mental_fortitude
1:16.718 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity berserking, sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mental_fortitude
1:17.532 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity berserking, sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mental_fortitude
1:18.342 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity berserking, sphere_of_insanity, voidform(24), insanity_drain_stacks(24), mental_fortitude
1:19.155 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.5/100: 57% insanity sphere_of_insanity, voidform(25), insanity_drain_stacks(25), mental_fortitude
1:20.075 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.6/100: 50% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(26), mental_fortitude
1:20.988 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.4/100: 42% insanity sphere_of_insanity, voidform(27), insanity_drain_stacks(27), mental_fortitude
1:21.892 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.6/100: 39% insanity sphere_of_insanity, voidform(28), insanity_drain_stacks(28), mental_fortitude
1:22.792 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.7/100: 31% insanity sphere_of_insanity, voidform(29), insanity_drain_stacks(29), mental_fortitude
1:23.686 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity sphere_of_insanity, voidform(29), insanity_drain_stacks(29), mental_fortitude
1:24.573 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.3/100: 17% insanity sphere_of_insanity, voidform(30), insanity_drain_stacks(30), mental_fortitude
1:25.460 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(31), mental_fortitude
1:27.793 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity lingering_insanity(31), mental_fortitude
1:28.673 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity lingering_insanity(31), mental_fortitude
1:31.947 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(31), mental_fortitude
1:32.827 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(31), mental_fortitude
1:33.814 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(31), mental_fortitude
1:38.478 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity lingering_insanity(31), mental_fortitude
1:39.359 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(31), mental_fortitude
1:39.359 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
1:41.955 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mark_of_the_claw, mental_fortitude
1:43.053 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mark_of_the_claw, mental_fortitude
1:45.508 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.2/100: 70% insanity sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mark_of_the_claw, mental_fortitude
1:46.577 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(8), mental_fortitude
1:47.644 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.1/100: 72% insanity sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mental_fortitude
1:48.699 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.5/100: 61% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
1:49.743 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
1:50.777 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.7/100: 61% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
1:51.805 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.3/100: 58% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
1:52.818 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.5/100: 59% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
1:53.937 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.4/100: 53% insanity sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mental_fortitude
1:54.939 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.4/100: 41% insanity sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
1:55.929 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.8/100: 41% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
1:58.219 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.8/100: 9% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
1:59.177 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.7/100: 8% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
2:00.136 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(21), mental_fortitude
2:01.335 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(21), mental_fortitude
2:02.287 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(21), mark_of_the_claw, mental_fortitude
2:06.744 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity lingering_insanity(21), mark_of_the_claw, mental_fortitude
2:07.686 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(21), mark_of_the_claw, mental_fortitude
2:12.197 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity lingering_insanity(21), mental_fortitude
2:13.148 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity lingering_insanity(21), mental_fortitude
2:14.308 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity lingering_insanity(21), mental_fortitude
2:15.260 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity lingering_insanity(21), mental_fortitude
2:16.904 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity lingering_insanity(21), mental_fortitude
2:16.904 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
2:19.408 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
2:20.520 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity sphere_of_insanity, voidform(4), insanity_drain_stacks(4), mental_fortitude
2:21.628 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.3/100: 89% insanity sphere_of_insanity, voidform(5), insanity_drain_stacks(5), mental_fortitude
2:22.724 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity sphere_of_insanity, voidform(6), insanity_drain_stacks(6), mental_fortitude
2:23.802 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity sphere_of_insanity, voidform(7), insanity_drain_stacks(7), mental_fortitude
2:24.879 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 84% insanity sphere_of_insanity, voidform(8), insanity_drain_stacks(8), mental_fortitude
2:25.945 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mental_fortitude
2:26.991 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.1/100: 76% insanity sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mental_fortitude
2:28.029 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.4/100: 73% insanity sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mental_fortitude
2:29.058 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.5/100: 63% insanity sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mental_fortitude
2:30.075 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.5/100: 64% insanity sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mental_fortitude
2:32.330 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.3/100: 36% insanity shadowy_insight, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mental_fortitude
2:33.320 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.9/100: 36% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mental_fortitude
2:34.301 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.7/100: 32% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mental_fortitude
2:35.279 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.3/100: 26% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mental_fortitude
2:36.244 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.2/100: 25% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mental_fortitude
2:37.200 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.8/100: 20% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21), mental_fortitude
2:38.154 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.8/100: 13% insanity shadowy_insight, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), mental_fortitude
2:39.097 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.5/100: 12% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(23), mental_fortitude
2:40.031 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.5/100: 5% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(24), mental_fortitude
2:40.962 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:41.879 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:43.393 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:44.309 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:45.226 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:46.144 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity lingering_insanity(24), mark_of_the_claw, mental_fortitude
2:47.847 surrender_to_madness Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity shadowy_insight, lingering_insanity(24), mental_fortitude
2:47.847 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity surrender_to_madness, lingering_insanity(24), mental_fortitude
2:48.775 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, lingering_insanity(24), mental_fortitude
2:48.775 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform, insanity_drain_stacks, mental_fortitude
2:49.913 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity surrender_to_madness, sphere_of_insanity, voidform(2), insanity_drain_stacks(2), mental_fortitude
2:56.187 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity surrender_to_madness, sphere_of_insanity, voidform(2), insanity_drain_stacks(2), mental_fortitude
2:57.311 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.5/100: 95% insanity surrender_to_madness, sphere_of_insanity, voidform(3), insanity_drain_stacks(3), mental_fortitude
3:01.683 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity surrender_to_madness, sphere_of_insanity, voidform(7), insanity_drain_stacks(3), mental_fortitude
3:02.748 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity surrender_to_madness, sphere_of_insanity, voidform(8), insanity_drain_stacks(4), mental_fortitude
3:03.814 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(10), insanity_drain_stacks(6), mental_fortitude
3:04.861 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(11), insanity_drain_stacks(7), mental_fortitude
3:05.898 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity surrender_to_madness, sphere_of_insanity, voidform(12), insanity_drain_stacks(8), mental_fortitude
3:06.927 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.3/100: 99% insanity surrender_to_madness, sphere_of_insanity, voidform(13), insanity_drain_stacks(9), mental_fortitude
3:07.943 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.3/100: 96% insanity surrender_to_madness, sphere_of_insanity, voidform(14), insanity_drain_stacks(10), mental_fortitude
3:08.951 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.8/100: 87% insanity surrender_to_madness, sphere_of_insanity, voidform(15), insanity_drain_stacks(11), mental_fortitude
3:09.955 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(16), insanity_drain_stacks(12), mental_fortitude
3:10.948 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.8/100: 96% insanity surrender_to_madness, sphere_of_insanity, voidform(17), insanity_drain_stacks(13), mental_fortitude
3:11.932 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity surrender_to_madness, sphere_of_insanity, voidform(18), insanity_drain_stacks(14), mental_fortitude
3:12.971 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.8/100: 100% insanity surrender_to_madness, sphere_of_insanity, voidform(19), insanity_drain_stacks(15), mental_fortitude
3:13.939 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.8/100: 94% insanity surrender_to_madness, sphere_of_insanity, voidform(20), insanity_drain_stacks(16), mental_fortitude
3:14.897 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity surrender_to_madness, sphere_of_insanity, voidform(21), insanity_drain_stacks(17), mental_fortitude
3:16.927 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.6/100: 70% insanity shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(23), insanity_drain_stacks(19), mental_fortitude
3:17.865 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.8/100: 84% insanity surrender_to_madness, sphere_of_insanity, voidform(24), insanity_drain_stacks(20), mental_fortitude
3:18.794 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.8/100: 83% insanity surrender_to_madness, sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mental_fortitude
3:19.716 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.7/100: 96% insanity surrender_to_madness, sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mental_fortitude
3:20.632 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.9/100: 82% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mental_fortitude
3:21.546 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(27), insanity_drain_stacks(23), mental_fortitude
3:22.449 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mental_fortitude
3:23.345 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mental_fortitude
3:24.234 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.1/100: 81% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mental_fortitude
3:25.123 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(31), insanity_drain_stacks(27), mental_fortitude
3:26.002 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(32), insanity_drain_stacks(28), mental_fortitude
3:28.026 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.8/100: 54% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(34), insanity_drain_stacks(30), mental_fortitude
3:28.886 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.1/100: 74% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(35), insanity_drain_stacks(31), mental_fortitude
3:29.741 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.6/100: 80% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(35), insanity_drain_stacks(31), mental_fortitude
3:30.596 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(36), insanity_drain_stacks(32), mental_fortitude
3:31.440 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.9/100: 79% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(37), insanity_drain_stacks(33), mental_fortitude
3:32.281 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(38), insanity_drain_stacks(34), mental_fortitude
3:33.112 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(39), insanity_drain_stacks(35), mental_fortitude
3:33.940 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(40), insanity_drain_stacks(36), mental_fortitude
3:34.764 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.1/100: 87% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(40), insanity_drain_stacks(36), mental_fortitude
3:35.587 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.2/100: 74% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(41), insanity_drain_stacks(37), mental_fortitude
3:36.400 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(42), insanity_drain_stacks(38), mental_fortitude
3:38.303 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.6/100: 46% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(44), insanity_drain_stacks(40), mental_fortitude
3:39.102 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.8/100: 63% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(45), insanity_drain_stacks(41), mental_fortitude
3:39.898 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.6/100: 70% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(46), insanity_drain_stacks(42), mental_fortitude
3:40.689 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.4/100: 56% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(46), insanity_drain_stacks(42), mental_fortitude
3:41.475 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(47), insanity_drain_stacks(43), mental_fortitude
3:42.259 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.9/100: 80% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(48), insanity_drain_stacks(44), mental_fortitude
3:43.037 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.7/100: 76% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(49), insanity_drain_stacks(45), mental_fortitude
3:43.811 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.8/100: 77% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(50), insanity_drain_stacks(46), mental_fortitude
3:44.579 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(50), insanity_drain_stacks(46), mental_fortitude
3:45.347 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.1/100: 68% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(51), insanity_drain_stacks(47), mental_fortitude
3:46.110 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(52), insanity_drain_stacks(48), mental_fortitude
3:47.904 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.3/100: 37% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(54), insanity_drain_stacks(50), mark_of_the_claw, mental_fortitude
3:48.659 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.5/100: 53% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(54), insanity_drain_stacks(50), mark_of_the_claw, mental_fortitude
3:49.529 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(55), insanity_drain_stacks(51), mark_of_the_claw, mental_fortitude
3:50.280 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.5/100: 47% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(56), insanity_drain_stacks(52), mark_of_the_claw, mental_fortitude
3:51.032 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.7/100: 71% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(57), insanity_drain_stacks(53), mark_of_the_claw, mental_fortitude
3:51.786 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.5/100: 84% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(58), insanity_drain_stacks(54), mark_of_the_claw, mental_fortitude
3:52.542 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.2/100: 98% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(58), insanity_drain_stacks(54), mark_of_the_claw, mental_fortitude
3:53.295 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(59), insanity_drain_stacks(55), mental_fortitude
3:54.048 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(60), insanity_drain_stacks(56), mental_fortitude
3:54.800 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(61), insanity_drain_stacks(57), mental_fortitude
3:55.555 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.3/100: 82% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(61), insanity_drain_stacks(57), mental_fortitude
3:56.303 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.5/100: 95% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(62), insanity_drain_stacks(58), mental_fortitude
3:57.054 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.1/100: 98% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(63), insanity_drain_stacks(59), mental_fortitude
3:57.808 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.5/100: 81% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(64), insanity_drain_stacks(60), mental_fortitude
4:02.125 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.6/100: 89% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(68), insanity_drain_stacks(60), mental_fortitude
4:02.878 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.9/100: 79% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(69), insanity_drain_stacks(61), mental_fortitude
4:03.634 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.7/100: 90% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(69), insanity_drain_stacks(61), mental_fortitude
4:04.385 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.1/100: 96% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(70), insanity_drain_stacks(62), mental_fortitude
4:05.137 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.3/100: 70% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(71), insanity_drain_stacks(63), mental_fortitude
4:05.890 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.3/100: 70% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(72), insanity_drain_stacks(64), mental_fortitude
4:06.646 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(72), insanity_drain_stacks(64), mental_fortitude
4:07.395 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.4/100: 69% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(73), insanity_drain_stacks(65), mental_fortitude
4:08.632 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.1/100: 48% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(74), insanity_drain_stacks(66), mental_fortitude
4:09.384 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.7/100: 57% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(75), insanity_drain_stacks(67), mental_fortitude
4:10.372 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.8/100: 32% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(76), insanity_drain_stacks(68), mental_fortitude
4:11.344 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.2/100: 29% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(77), insanity_drain_stacks(69), mental_fortitude
4:12.096 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.7/100: 68% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(78), insanity_drain_stacks(70), mental_fortitude
4:12.851 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.4/100: 65% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(79), insanity_drain_stacks(71), mental_fortitude
4:13.607 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(79), insanity_drain_stacks(71), mental_fortitude
4:14.358 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(80), insanity_drain_stacks(72), mental_fortitude
4:15.109 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.6/100: 61% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(81), insanity_drain_stacks(73), mental_fortitude
4:15.109 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.6/100: 61% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(81), insanity_drain_stacks(73), potion_of_deadly_grace, mental_fortitude
4:15.862 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.2/100: 66% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(82), insanity_drain_stacks(74), potion_of_deadly_grace, mental_fortitude
4:17.004 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.3/100: 44% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(83), insanity_drain_stacks(75), potion_of_deadly_grace, mental_fortitude
4:17.757 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.8/100: 50% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(83), insanity_drain_stacks(75), potion_of_deadly_grace, mental_fortitude
4:18.507 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.3/100: 45% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(84), insanity_drain_stacks(76), potion_of_deadly_grace, mental_fortitude
4:19.258 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.3/100: 40% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(85), insanity_drain_stacks(77), potion_of_deadly_grace, mental_fortitude
4:20.012 dispersion Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(86), insanity_drain_stacks(78), potion_of_deadly_grace, mental_fortitude
4:26.345 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.6/100: 29% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(86), insanity_drain_stacks(78), potion_of_deadly_grace, mental_fortitude
4:27.099 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(87), insanity_drain_stacks(79), potion_of_deadly_grace, mental_fortitude
4:27.851 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(88), insanity_drain_stacks(80), potion_of_deadly_grace, mental_fortitude
4:28.605 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(88), insanity_drain_stacks(80), potion_of_deadly_grace, mental_fortitude
4:29.356 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(89), insanity_drain_stacks(81), potion_of_deadly_grace, mental_fortitude
4:30.108 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.6/100: 55% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(90), insanity_drain_stacks(82), potion_of_deadly_grace, mental_fortitude
4:30.108 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.6/100: 55% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(90), insanity_drain_stacks(82), potion_of_deadly_grace, mental_fortitude
4:30.861 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.8/100: 48% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(91), insanity_drain_stacks(83), potion_of_deadly_grace, mental_fortitude
4:31.615 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.3/100: 50% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(91), insanity_drain_stacks(83), potion_of_deadly_grace, mental_fortitude
4:32.367 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.8/100: 43% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(92), insanity_drain_stacks(84), potion_of_deadly_grace, mental_fortitude
4:33.174 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.4/100: 42% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(93), insanity_drain_stacks(85), potion_of_deadly_grace, mental_fortitude
4:33.926 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.6/100: 32% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(94), insanity_drain_stacks(86), potion_of_deadly_grace, mental_fortitude
4:34.728 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.8/100: 31% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(94), insanity_drain_stacks(86), potion_of_deadly_grace, mental_fortitude
4:35.469 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.6/100: 64% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(95), insanity_drain_stacks(87), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:36.253 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(96), insanity_drain_stacks(88), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:37.005 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.8/100: 52% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(97), insanity_drain_stacks(89), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:37.764 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(97), insanity_drain_stacks(89), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:38.514 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.3/100: 42% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(98), insanity_drain_stacks(90), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:39.266 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(99), insanity_drain_stacks(91), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:40.018 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.5/100: 32% insanity berserking, twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(92), mark_of_the_claw, potion_of_deadly_grace, mental_fortitude
4:40.872 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.5/100: 26% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(93), potion_of_deadly_grace, mental_fortitude
4:41.627 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(93), potion_of_deadly_grace, mental_fortitude
4:42.472 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(94), potion_of_deadly_grace, mental_fortitude
4:43.228 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.5/100: 38% insanity twist_of_fate, shadowy_insight, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(95), potion_of_deadly_grace, mental_fortitude
4:44.191 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.3/100: 24% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(96), potion_of_deadly_grace, mental_fortitude
4:44.945 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.1/100: 12% insanity twist_of_fate, surrender_to_madness, sphere_of_insanity, voidform(100), insanity_drain_stacks(97), potion_of_deadly_grace, mental_fortitude
4:45.944 Waiting 15.800 sec 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity surrender_to_madness_death

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 42217 42217 26216
Intellect 39146 37440 28334 (2596)
Spirit 1 1 0
Health 2533020 2533020 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 39146 37440 0
Crit 24.40% 24.40% 6790
Haste 30.67% 29.51% 9592
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 8800 8800 0
Mastery 43.43% 43.43% 3280
Armor 1819 1819 1819
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 884.00
Local Head Hood of Darkened Visions
ilevel: 880, stats: { 235 Armor, +2573 Sta, +1715 Int, +886 Crit, +574 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_claw
Local Shoulders Mantle of Perpetual Bloom
ilevel: 880, stats: { 217 Armor, +1930 Sta, +1287 Int, +759 Crit, +336 Haste }
Local Chest Dreamscale Inlaid Vestments
ilevel: 880, stats: { 290 Armor, +2573 Sta, +1715 Int, +918 Haste, +542 Mastery }
Local Waist Mangaza's Madness
ilevel: 895, stats: { 172 Armor, +2219 Sta, +1479 Int, +745 Crit, +413 Haste }
Local Legs Ragged Horrorweave Leggings
ilevel: 880, stats: { 253 Armor, +2573 Sta, +1715 Int, +824 Haste, +636 Mastery }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 880, stats: { 199 Armor, +1930 Sta, +1287 Int, +735 Haste, +360 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 880, stats: { 127 Armor, +1447 Sta, +965 Int, +569 Haste, +252 Mastery }
Local Hands Handwraps of Delusional Power
ilevel: 880, stats: { 181 Armor, +1930 Sta, +1287 Int, +712 Haste, +383 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Haste }
Local Finger2 Dreadful Cyclopean Signet
ilevel: 880, stats: { +1448 Sta, +1115 Haste, +939 Mastery }, enchant: { +200 Haste }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 906, weapon: { 1922 - 3571, 1.8 }, stats: { +937 Int, +1405 Sta, +350 Crit, +337 Mastery, +11921 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Secrets of the Void
ilevel: 906, stats: { +1230 Int, +1844 Sta, +627 Haste, +278 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Priest_Shadow_T19M_S2M"
level=110
race=troll
role=spell
position=back
talents=1212333
artifact=47:139251:139257:139251:0:764:1:765:1:766:1:767:3:768:1:769:1:770:1:771:3:772:5:773:3:774:3:775:3:776:4:777:3:778:3:779:1:1347:1
spec=shadow

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_claw
shoulders=mantle_of_perpetual_bloom,id=139192,bonus_id=1806
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=200int
chest=dreamscale_inlaid_vestments,id=138215,bonus_id=1806
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1806
hands=handwraps_of_delusional_power,id=138212,bonus_id=1806
waist=mangazas_madness,id=132864
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1806
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant=200haste
finger2=dreadful_cyclopean_signet,id=139237,bonus_id=1806,enchant=200haste
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=139251/139257/139251,relic_id=1806/1806/1806
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=884.19
# gear_stamina=26216
# gear_intellect=28334
# gear_crit_rating=6790
# gear_haste_rating=9592
# gear_mastery_rating=3280
# gear_armor=1819

Rogue_Assassination_Exsg_T19M : 436997 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
436996.8 436996.8 340.9 / 0.078% 58206.3 / 13.3% 17209.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
25.4 25.4 Energy 41.39% 36.3 100.0% 100%
Talents
  • 15: Elaborate Planning
  • 30: Nightstalker
  • 45: Deeper Stratagem
  • 75: Thuggee (Assassination Rogue)
  • 90: Exsanguinate
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Assassination_Exsg_T19M 436997
auto_attack_mh 17296 4.0% 198.3 1.52sec 26202 17468 Direct 198.3 21345 42689 26202 41.8% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.29 198.29 0.00 0.00 1.5000 0.0000 5195619.40 7638052.66 31.98 17467.61 17467.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.55 39.11% 21345.48 17700 27939 21351.41 20286 22857 1655367 2433546 31.98
crit 82.93 41.82% 42689.45 35399 55877 42697.97 40671 44993 3540253 5204507 31.98
miss 37.81 19.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 8574 2.0% 196.4 1.53sec 13112 8660 Direct 196.4 10658 21325 13112 42.0% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.41 196.41 0.00 0.00 1.5141 0.0000 2575419.86 3786111.15 31.98 8660.34 8660.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.78 39.09% 10658.48 8850 13969 10660.81 10024 11307 818353 1203056 31.98
crit 82.40 41.95% 21324.59 17700 27939 21329.61 20303 22608 1757067 2583055 31.98
miss 37.24 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deadly Poison (_dot) 18133 4.2% 363.6 0.95sec 14986 0 Periodic 99.5 38576 77165 54751 41.9% 0.0% 99.3%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 363.62 0.00 99.53 99.53 0.0000 3.0000 5449114.67 5449114.67 0.00 18250.22 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.8 58.08% 38576.15 28725 64695 38595.85 35470 42203 2230051 2230051 0.00
crit 41.7 41.92% 77165.04 57450 129391 77214.30 70105 86351 3219063 3219063 0.00
 
 

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:{$@spelldesc2823=Coats your weapons with a Lethal Poison that lasts for {$2823d=3600 seconds}. Each strike has a {$2823h=30}% chance to poison the enemy for ${$2818m1*4} Nature damage over {$2818d=12 seconds}. Subsequent poison applications will instantly deal {$113780s1=0} Nature damage.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.357500
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:12.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Deadly Poison (_instant) 41560 9.5% 362.6 0.95sec 34415 0 Direct 362.6 24255 48504 34415 41.9% 0.0%  

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 362.62 362.62 0.00 0.00 0.0000 0.0000 12479549.31 12479549.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 210.68 58.10% 24255.25 17757 39993 24267.58 22901 25992 5110158 5110158 0.00
crit 151.94 41.90% 48503.53 35514 79987 48530.03 45479 52520 7369392 7369392 0.00
 
 

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:
  • description:Poisoned weapons have a chance to deal {$s1=0} Nature damage to a target already affected by Deadly Poison.
 
Envenom 40943 9.4% 27.1 10.81sec 453177 451149 Direct 27.1 319107 637946 453180 42.0% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.14 27.14 0.00 0.00 1.0045 0.0000 12299224.05 12299224.05 0.00 451149.00 451149.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.73 57.95% 319106.81 243070 469243 319186.61 276776 373528 5018859 5018859 0.00
crit 11.41 42.05% 637946.00 486140 938487 637967.95 522601 827438 7280365 7280365 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
From the Shadows 10219 2.3% 142.4 3.77sec 21537 0 Direct 142.4 15175 30350 21537 41.9% 0.0%  

Stats details: from_the_shadows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 142.43 142.43 0.00 0.00 0.0000 0.0000 3067557.78 3067557.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.72 58.08% 15175.35 13012 16101 15183.78 14728 15551 1255270 1255270 0.00
crit 59.71 41.92% 30350.18 26024 32202 30365.99 29345 31272 1812287 1812287 0.00
 
 

Action details: from_the_shadows

Static Values
  • id:192434
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192434
  • name:From the Shadows
  • school:nature
  • tooltip:
  • description:{$@spelldesc192428=Declaring your Vendetta unleashes a barrage of poisoned daggers at the target for ${20*{$192434s1=10}*$m1} Nature damage over {$192432d=20 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.350000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10.00
  • base_dd_max:10.00
 
Garrote 38282 8.8% 20.0 15.46sec 576103 573530 Periodic 173.0 46814 93663 66457 41.9% 0.0% 97.3%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.96 0.00 172.99 172.99 1.0045 1.6915 11496399.33 11496399.33 0.00 36769.65 573529.53
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.5 58.07% 46813.66 33428 80666 46865.77 43316 51030 4702928 4702928 0.00
crit 72.5 41.93% 93662.82 66856 161331 93762.71 85558 106198 6793471 6793471 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Kingsbane 18925 (25671) 4.3% (5.9%) 6.8 46.52sec 1131442 1126488 Periodic 46.4 86368 172695 122456 41.8% 0.0% 30.9%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.81 0.00 46.43 46.43 1.0045 2.0000 5685446.42 5685446.42 0.00 77318.33 1126488.48
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.0 58.19% 86368.31 24116 219372 86395.64 59287 111659 2333535 2333535 0.00
crit 19.4 41.81% 172694.84 48232 438745 172728.49 102867 236951 3351912 3351912 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 4494 1.0% 6.8 46.52sec 197843 0 Direct 6.8 139835 279593 197850 41.5% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.81 6.81 0.00 0.00 0.0000 0.0000 1347911.85 1347911.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.99 58.49% 139835.37 124188 183425 139342.64 0 183425 557276 557276 0.00
crit 2.83 41.51% 279593.32 248377 366850 271613.28 0 366850 790636 790636 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 2251 0.5% 6.8 46.52sec 99104 0 Direct 6.8 69952 139719 99108 41.8% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.81 6.81 0.00 0.00 0.0000 0.0000 675202.38 675202.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.97 58.21% 69951.63 62094 91712 69795.35 0 91712 277439 277439 0.00
crit 2.85 41.79% 139719.16 124188 183425 135058.26 0 183425 397763 397763 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mark of the Hidden Satyr 5565 1.3% 17.0 17.54sec 98107 0 Direct 17.0 69081 138194 98107 42.0% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.04 17.04 0.00 0.00 0.0000 0.0000 1671859.14 1671859.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.88 58.00% 69081.11 62361 71716 69071.01 62361 71716 682817 682817 0.00
crit 7.16 42.00% 138193.60 124723 143431 138165.38 0 143431 989042 989042 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Mutilate 0 (58484) 0.0% (13.4%) 91.4 3.29sec 192258 191398

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.37 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 191397.80 191397.80
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit<=1&energy.deficit<=30
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage.{$?s1329=true}|!c1[][ Replaces Sinister Strike.] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 38994 8.9% 91.4 3.29sec 128185 0 Direct 91.4 86657 173246 128187 48.0% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.37 91.37 0.00 0.00 0.0000 0.0000 11711651.92 17217237.68 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.55 52.04% 86656.53 70291 110864 86681.70 78427 92535 4120185 6057062 31.98
crit 43.82 47.96% 173245.56 140583 221728 173274.13 162226 185911 7591467 11160176 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 19489 4.5% 91.4 3.29sec 64073 0 Direct 91.4 43310 86654 64073 47.9% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.37 91.37 0.00 0.00 0.0000 0.0000 5854072.45 8606041.02 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.60 52.10% 43309.88 35144 55429 43321.36 40723 46738 2061450 3030526 31.98
crit 43.77 47.90% 86653.68 70288 110859 86666.53 79289 94145 3792623 5575515 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Poison Bomb 16416 3.8% 33.8 6.42sec 145920 0 Direct 33.8 102695 205370 145920 42.1% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.80 33.80 0.00 0.00 0.0000 0.0000 4931757.08 4931757.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.57 57.90% 102694.82 101645 109378 102676.70 101645 108273 2009637 2009637 0.00
crit 14.23 42.10% 205369.92 203289 218756 205303.19 0 217037 2922120 2922120 0.00
 
 

Action details: poison_bomb

Static Values
  • id:192660
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192660
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc192657=Envenom has a chance to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$192660s1=1}*6} Nature damage over {$192661d=3 seconds} to all enemies within it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Potion of the Old War 18984 4.3% 24.2 5.38sec 232369 0 Direct 24.2 163686 327389 232367 42.0% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.16 24.16 0.00 0.00 0.0000 0.0000 5613784.64 8252795.18 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.02 58.04% 163685.66 145599 167439 163682.63 149239 167439 2295324 3374343 31.98
crit 10.14 41.96% 327388.61 291198 334878 327385.37 300905 334878 3318461 4878452 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rupture 136869 31.4% 20.6 14.82sec 2003403 1994450 Periodic 207.4 130685 261478 198566 51.9% 0.0% 97.3%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.55 0.00 207.36 207.36 1.0045 1.4110 41175429.09 41175429.09 0.00 131452.62 1994450.43
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.7 48.10% 130684.90 100 480321 130607.72 101454 182186 13034565 13034565 0.00
crit 107.6 51.90% 261477.74 142 960641 261287.00 203792 331007 28140864 28140864 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${{$s1=0}*1*8/2} over 8 sec 2 points: ${{$s1=0}*2*12/2} over 12 sec 3 points: ${{$s1=0}*3*16/2} over 16 sec 4 points: ${{$s1=0}*4*20/2} over 20 sec 5 points: ${{$s1=0}*5*24/2} over 24 sec{$?s193531=false}[ 6 points: ${{$s1=0}*6*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Rogue_Assassination_Exsg_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_Exsg_T19M
  • harmful:false
  • if_expr:
 
Blood Fury 2.0 186.48sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.vendetta.up
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
Exsanguinate 6.8 46.52sec

Stats details: exsanguinate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.83 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: exsanguinate

Static Values
  • id:200806
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
Spelldata
  • id:200806
  • name:Exsanguinate
  • school:physical
  • tooltip:
  • description:Twist your blades into the target's wounds, causing your Bleed effects on them to bleed out {$s1=100}% faster.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_Exsg_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_Exsg_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.6 139.56sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.62 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 3.6 93.59sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<20
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 10.6 6.6 28.6sec 17.1sec 45.11% 45.11% 6.6(6.6) 10.2

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.0 0.0 186.5sec 186.5sec 10.19% 10.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:10.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 11.72% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elaborate Planning 35.6 12.1 8.5sec 6.3sec 74.36% 59.63% 12.1(12.1) 34.9

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.15

Stack Uptimes

  • elaborate_planning_1:74.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Increases damage done by {$s1=15}%.
  • description:Increases damage done by {$s1=15}% for {$d=5 seconds}.
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom 16.8 10.3 17.7sec 10.8sec 57.74% 56.21% 10.3(10.3) 16.2

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:57.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 97.8sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Vanish 2.6 0.0 139.6sec 139.6sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Assassination_Exsg_T19M
envenom Energy 27.1 949.9 35.0 35.0 12947.6
envenom Combo Points 27.1 153.4 5.7 5.7 80180.0
garrote Energy 20.0 898.0 45.0 45.0 12802.3
kingsbane Energy 6.8 238.5 35.0 35.0 32326.7
mutilate Energy 91.4 5025.1 55.0 55.0 3495.6
rupture Energy 20.6 513.8 25.0 25.0 80136.7
rupture Combo Points 20.6 117.9 5.7 5.7 349147.9
Resource Gains Type Count Total Average Overflow
kingsbane Combo Points 6.81 6.81 (2.48%) 1.00 0.00 0.00%
mutilate Combo Points 91.37 179.77 (65.56%) 1.97 2.96 1.62%
garrote Combo Points 19.96 19.96 (7.28%) 1.00 0.00 0.00%
energy_regen Energy 1827.49 3502.93 (46.43%) 1.92 30.74 0.87%
seal_fate Combo Points 90.47 67.69 (24.68%) 0.75 22.78 25.18%
Venomous Vim Energy 380.33 3747.26 (49.67%) 9.85 56.00 1.47%
Urge to Kill Energy 3.65 293.95 (3.90%) 80.58 143.81 32.85%
Resource RPS-Gain RPS-Loss
Energy 25.09 25.36
Combo Points 0.91 0.90
Combat End Resource Mean Min Max
Energy 38.70 0.02 120.00
Combo Points 2.90 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
Seal Fate 90.5 4.3sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Assassination_Exsg_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Rogue_Assassination_Exsg_T19M Damage Per Second
Count 7499
Mean 436996.77
Minimum 389051.93
Maximum 498642.04
Spread ( max - min ) 109590.10
Range [ ( max - min ) / 2 * 100% ] 12.54%
Standard Deviation 15059.9401
5th Percentile 413054.05
95th Percentile 462646.23
( 95th Percentile - 5th Percentile ) 49592.18
Mean Distribution
Standard Deviation 173.9088
95.00% Confidence Intervall ( 436655.92 - 437337.63 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4562
0.1 Scale Factor Error with Delta=300 1936110
0.05 Scale Factor Error with Delta=300 7744442
0.01 Scale Factor Error with Delta=300 193611058
Priority Target DPS
Sample Data Rogue_Assassination_Exsg_T19M Priority Target Damage Per Second
Count 7499
Mean 436996.77
Minimum 389051.93
Maximum 498642.04
Spread ( max - min ) 109590.10
Range [ ( max - min ) / 2 * 100% ] 12.54%
Standard Deviation 15059.9401
5th Percentile 413054.05
95th Percentile 462646.23
( 95th Percentile - 5th Percentile ) 49592.18
Mean Distribution
Standard Deviation 173.9088
95.00% Confidence Intervall ( 436655.92 - 437337.63 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4562
0.1 Scale Factor Error with Delta=300 1936110
0.05 Scale Factor Error with Delta=300 7744442
0.01 Scale Factor Error with Delta=300 193611058
DPS(e)
Sample Data Rogue_Assassination_Exsg_T19M Damage Per Second (Effective)
Count 7499
Mean 436996.77
Minimum 389051.93
Maximum 498642.04
Spread ( max - min ) 109590.10
Range [ ( max - min ) / 2 * 100% ] 12.54%
Damage
Sample Data Rogue_Assassination_Exsg_T19M Damage
Count 7499
Mean 131229999.38
Minimum 95452975.33
Maximum 169663215.35
Spread ( max - min ) 74210240.02
Range [ ( max - min ) / 2 * 100% ] 28.27%
DTPS
Sample Data Rogue_Assassination_Exsg_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Assassination_Exsg_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Assassination_Exsg_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Assassination_Exsg_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Assassination_Exsg_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Assassination_Exsg_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Assassination_Exsg_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Assassination_Exsg_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=old_war
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
9 2.01 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
A 0.00 call_action_list,name=cds
B 4.26 rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
0.00 pool_resource,for_next=1
C 6.81 kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
D 0.00 run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
E 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
F 0.00 call_action_list,name=exsang,if=dot.rupture.exsanguinated
G 6.54 rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
H 0.00 call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
I 0.00 call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
J 0.00 call_action_list,name=build_ex,if=talent.exsanguinate.enabled
K 0.00 call_action_list,name=build_noex,if=!talent.exsanguinate.enabled
actions.build_ex
# count action,conditions
0.00 hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
0.00 hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
0.00 fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
0.00 fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
0.00 hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&((dot.rupture.exsanguinated&dot.rupture.remains<=2)|cooldown.exsanguinate.remains<=2))
L 2.51 mutilate,if=combo_points.deficit<=1&energy.deficit<=30
M 88.86 mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2
actions.cds
# count action,conditions
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
N 0.17 vendetta,if=target.time_to_die<20
O 3.48 vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
0.00 vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
0.00 vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25
actions.exsang
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die>6
P 2.90 rupture,if=combo_points>=cp_max_spend&ticks_remain<2
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
Q 16.23 envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang_combo
# count action,conditions
R 2.62 vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
S 6.86 rupture,if=combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)
T 6.83 exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
U 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
0.00 hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
V 0.00 call_action_list,name=build_ex
actions.finish_ex
# count action,conditions
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
0.00 rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
0.00 death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
W 9.23 envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
X 1.68 envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.garrote
# count action,conditions
0.00 pool_resource,for_next=1
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
0.00 pool_resource,for_next=1
Y 19.96 garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

Sample Sequence

012456YMGO9MMRSTCMQMMQYMQMMPMMWYMMGMMWYMMSTCMQMMQYMQMMBMMYGMMWMYMWMO8MSTCMQMMQYMQMMBMMGYMWMMWYMLRSTCMQMMQYMQMMPMYMGMMWMYMWMO9MSTCMMQMYMQMMPMMYGMMWMMXYMMSTCMQMYMQMMPMMYGMMMWMYMWMOMRSTCMQMYMQMMQMM

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Assassination_Exsg_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Assassination_Exsg_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Assassination_Exsg_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.004 mutilate Fluffy_Pillow 89.2/120: 74% energy | 1.0/6: 17% combo_points bloodlust, potion_of_the_old_war
0:02.007 rupture Fluffy_Pillow 58.4/120: 49% energy | 3.0/6: 50% combo_points bloodlust, potion_of_the_old_war
0:03.012 vendetta Fluffy_Pillow 48.2/120: 40% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:03.012 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:03.012 mutilate Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:04.015 mutilate Fluffy_Pillow 100.4/120: 84% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:05.020 vanish Fluffy_Pillow 60.9/120: 51% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:05.020 rupture Fluffy_Pillow 60.9/120: 51% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, vanish, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:06.025 exsanguinate Fluffy_Pillow 71.3/120: 59% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:07.031 kingsbane Fluffy_Pillow 106.8/120: 89% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:08.034 mutilate Fluffy_Pillow 107.2/120: 89% energy | 2.0/6: 33% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:09.039 envenom Fluffy_Pillow 87.7/120: 73% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:10.045 mutilate Fluffy_Pillow 88.1/120: 73% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:11.049 mutilate Fluffy_Pillow 68.6/120: 57% energy | 2.0/6: 33% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:12.053 envenom Fluffy_Pillow 49.0/120: 41% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:13.059 Waiting 1.700 sec 38.8/120: 32% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:14.759 garrote Fluffy_Pillow 72.9/120: 61% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:16.004 mutilate Fluffy_Pillow 55.5/120: 46% energy | 1.0/6: 17% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:17.007 Waiting 0.100 sec 34.7/120: 29% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, envenom, elaborate_planning, potion_of_the_old_war
0:17.107 envenom Fluffy_Pillow 46.1/120: 38% energy | 5.0/6: 83% combo_points bloodlust, blood_fury, envenom, potion_of_the_old_war
0:18.111 Waiting 0.900 sec 35.3/120: 29% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:19.011 mutilate Fluffy_Pillow 58.0/120: 48% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:20.014 Waiting 1.000 sec 27.2/120: 23% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:21.014 mutilate Fluffy_Pillow 61.4/120: 51% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:22.020 Waiting 0.800 sec 40.6/120: 34% energy | 6.0/6: 100% combo_points bloodlust, envenom, elaborate_planning, potion_of_the_old_war
0:22.820 rupture Fluffy_Pillow 51.9/120: 43% energy | 6.0/6: 100% combo_points bloodlust, envenom, potion_of_the_old_war
0:23.824 mutilate Fluffy_Pillow 61.1/120: 51% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:24.829 Waiting 1.130 sec 20.3/120: 17% energy | 3.0/6: 50% combo_points bloodlust, envenom, elaborate_planning
0:25.959 mutilate Fluffy_Pillow 56.3/120: 47% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:26.964 Waiting 2.069 sec 15.5/120: 13% energy | 5.0/6: 83% combo_points bloodlust, elaborate_planning
0:29.033 envenom Fluffy_Pillow 84.8/120: 71% energy | 5.0/6: 83% combo_points bloodlust
0:30.037 garrote Fluffy_Pillow 64.0/120: 53% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:31.041 Waiting 0.200 sec 53.2/120: 44% energy | 1.0/6: 17% combo_points bloodlust, envenom, elaborate_planning
0:31.241 mutilate Fluffy_Pillow 56.0/120: 47% energy | 1.0/6: 17% combo_points bloodlust, envenom, elaborate_planning
0:32.246 Waiting 1.489 sec 15.2/120: 13% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning
0:33.735 mutilate Fluffy_Pillow 56.3/120: 47% energy | 4.0/6: 67% combo_points bloodlust, envenom, elaborate_planning
0:34.740 Waiting 0.669 sec 15.5/120: 13% energy | 6.0/6: 100% combo_points bloodlust, envenom
0:35.409 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points bloodlust
0:36.413 Waiting 0.700 sec 34.2/120: 28% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning
0:37.113 mutilate Fluffy_Pillow 64.1/120: 53% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning
0:38.118 Waiting 0.919 sec 23.3/120: 19% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:39.037 mutilate Fluffy_Pillow 56.3/120: 47% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:40.043 Waiting 2.988 sec 15.3/120: 13% energy | 5.0/6: 83% combo_points elaborate_planning
0:43.031 envenom Fluffy_Pillow 87.8/120: 73% energy | 5.0/6: 83% combo_points
0:44.035 Waiting 1.600 sec 63.8/120: 53% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:45.635 garrote Fluffy_Pillow 101.2/120: 84% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
0:46.641 mutilate Fluffy_Pillow 67.1/120: 56% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
0:47.647 Waiting 1.000 sec 43.3/120: 36% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, blood_frenzy
0:48.647 mutilate Fluffy_Pillow 55.1/120: 46% energy | 4.0/6: 67% combo_points envenom, blood_frenzy
0:49.652 Waiting 0.400 sec 32.0/120: 27% energy | 6.0/6: 100% combo_points blood_frenzy
0:50.052 rupture Fluffy_Pillow 36.7/120: 31% energy | 6.0/6: 100% combo_points blood_frenzy
0:51.057 exsanguinate Fluffy_Pillow 43.6/120: 36% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
0:52.062 kingsbane Fluffy_Pillow 75.5/120: 63% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
0:53.065 mutilate Fluffy_Pillow 72.4/120: 60% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy
0:54.070 envenom Fluffy_Pillow 49.3/120: 41% energy | 6.0/6: 100% combo_points elaborate_planning, blood_frenzy
0:55.076 Waiting 0.800 sec 46.2/120: 38% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
0:55.876 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
0:56.880 Waiting 0.300 sec 32.5/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
0:57.180 mutilate Fluffy_Pillow 56.0/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
0:58.184 Waiting 0.300 sec 32.2/120: 27% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
0:58.484 envenom Fluffy_Pillow 35.4/120: 30% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
0:59.489 Waiting 0.900 sec 32.3/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:00.389 garrote Fluffy_Pillow 63.0/120: 52% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:01.641 Waiting 0.400 sec 42.8/120: 36% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
1:02.041 mutilate Fluffy_Pillow 57.5/120: 48% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
1:03.044 Waiting 0.100 sec 34.4/120: 29% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, blood_frenzy
1:03.144 envenom Fluffy_Pillow 35.6/120: 30% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, blood_frenzy
1:04.149 Waiting 1.116 sec 22.4/120: 19% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:05.265 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:06.270 Waiting 1.109 sec 22.5/120: 19% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy
1:07.379 mutilate Fluffy_Pillow 55.6/120: 46% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy
1:08.382 Waiting 0.411 sec 22.5/120: 19% energy | 4.0/6: 67% combo_points envenom, blood_frenzy
1:08.793 rupture Fluffy_Pillow 47.1/120: 39% energy | 4.0/6: 67% combo_points envenom
1:09.797 Waiting 1.000 sec 33.0/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:10.797 mutilate Fluffy_Pillow 63.9/120: 53% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:11.801 Waiting 1.477 sec 19.8/120: 17% energy | 2.0/6: 33% combo_points elaborate_planning
1:13.278 mutilate Fluffy_Pillow 55.9/120: 47% energy | 2.0/6: 33% combo_points elaborate_planning
1:14.282 Waiting 1.136 sec 12.7/120: 11% energy | 5.0/6: 83% combo_points blood_frenzy
1:15.418 garrote Fluffy_Pillow 46.2/120: 38% energy | 5.0/6: 83% combo_points blood_frenzy
1:16.640 rupture Fluffy_Pillow 25.6/120: 21% energy | 6.0/6: 100% combo_points blood_frenzy
1:17.645 Waiting 1.209 sec 22.5/120: 19% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
1:18.854 mutilate Fluffy_Pillow 56.8/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
1:19.859 Waiting 1.855 sec 13.7/120: 11% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
1:21.714 mutilate Fluffy_Pillow 55.6/120: 46% energy | 3.0/6: 50% combo_points blood_frenzy
1:22.719 Waiting 2.509 sec 22.5/120: 19% energy | 5.0/6: 83% combo_points blood_frenzy
1:25.228 envenom Fluffy_Pillow 80.4/120: 67% energy | 5.0/6: 83% combo_points
1:26.233 mutilate Fluffy_Pillow 56.3/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:27.239 Waiting 4.000 sec 32.2/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
1:31.239 garrote Fluffy_Pillow 118.2/120: 99% energy | 3.0/6: 50% combo_points blood_frenzy
1:32.245 mutilate Fluffy_Pillow 85.1/120: 71% energy | 4.0/6: 67% combo_points blood_frenzy
1:33.250 Waiting 1.400 sec 62.0/120: 52% energy | 6.0/6: 100% combo_points blood_frenzy
1:34.650 envenom Fluffy_Pillow 88.6/120: 74% energy | 6.0/6: 100% combo_points blood_frenzy
1:35.654 mutilate Fluffy_Pillow 75.4/120: 63% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:36.659 vendetta Fluffy_Pillow 42.3/120: 35% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
1:36.659 potion Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
1:36.659 mutilate Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:37.664 rupture Fluffy_Pillow 86.9/120: 72% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:38.670 exsanguinate Fluffy_Pillow 83.7/120: 70% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:39.673 kingsbane Fluffy_Pillow 114.7/120: 96% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:40.678 mutilate Fluffy_Pillow 110.6/120: 92% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:41.681 envenom Fluffy_Pillow 86.5/120: 72% energy | 6.0/6: 100% combo_points elaborate_planning, potion_of_the_old_war
1:42.685 mutilate Fluffy_Pillow 82.4/120: 69% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:43.689 mutilate Fluffy_Pillow 58.4/120: 49% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:44.692 Waiting 0.100 sec 34.3/120: 29% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:44.792 envenom Fluffy_Pillow 45.4/120: 38% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:45.796 Waiting 0.900 sec 41.3/120: 34% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:46.696 garrote Fluffy_Pillow 61.1/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:47.700 Waiting 0.800 sec 37.0/120: 31% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:48.500 mutilate Fluffy_Pillow 55.7/120: 46% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:49.504 Waiting 0.300 sec 31.6/120: 26% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:49.804 envenom Fluffy_Pillow 44.9/120: 37% energy | 5.0/6: 83% combo_points envenom, potion_of_the_old_war
1:50.808 Waiting 1.000 sec 41.8/120: 35% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:51.808 mutilate Fluffy_Pillow 63.6/120: 53% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:52.812 Waiting 1.000 sec 40.5/120: 34% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:53.812 mutilate Fluffy_Pillow 62.3/120: 52% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:54.816 Waiting 1.600 sec 39.2/120: 33% energy | 5.0/6: 83% combo_points envenom, blood_frenzy, potion_of_the_old_war
1:56.416 rupture Fluffy_Pillow 78.1/120: 65% energy | 5.0/6: 83% combo_points envenom, blood_frenzy, potion_of_the_old_war
1:57.420 mutilate Fluffy_Pillow 75.0/120: 62% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
1:58.425 Waiting 0.300 sec 41.9/120: 35% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy, potion_of_the_old_war
1:58.725 mutilate Fluffy_Pillow 55.4/120: 46% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy, potion_of_the_old_war
1:59.731 Waiting 1.073 sec 12.3/120: 10% energy | 6.0/6: 100% combo_points elaborate_planning, blood_frenzy, potion_of_the_old_war
2:00.804 rupture Fluffy_Pillow 44.0/120: 37% energy | 6.0/6: 100% combo_points elaborate_planning, potion_of_the_old_war
2:02.575 garrote Fluffy_Pillow 48.3/120: 40% energy | 0.0/6: 0% combo_points elaborate_planning
2:03.579 Waiting 1.200 sec 24.2/120: 20% energy | 1.0/6: 17% combo_points elaborate_planning
2:04.779 mutilate Fluffy_Pillow 57.3/120: 48% energy | 1.0/6: 17% combo_points elaborate_planning
2:05.783 Waiting 2.982 sec 13.2/120: 11% energy | 5.0/6: 83% combo_points elaborate_planning
2:08.765 envenom Fluffy_Pillow 85.7/120: 71% energy | 5.0/6: 83% combo_points
2:09.770 mutilate Fluffy_Pillow 61.6/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:10.773 Waiting 1.700 sec 37.5/120: 31% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
2:12.473 mutilate Fluffy_Pillow 66.0/120: 55% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
2:13.477 Waiting 2.600 sec 31.9/120: 27% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
2:16.077 envenom Fluffy_Pillow 80.6/120: 67% energy | 6.0/6: 100% combo_points blood_frenzy
2:17.081 Waiting 0.300 sec 77.5/120: 65% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:17.381 garrote Fluffy_Pillow 81.0/120: 68% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:18.580 mutilate Fluffy_Pillow 60.2/120: 50% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
2:19.586 Waiting 2.900 sec 27.1/120: 23% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, blood_frenzy
2:22.486 mutilate Fluffy_Pillow 91.4/120: 76% energy | 5.0/6: 83% combo_points envenom, blood_frenzy
2:23.492 vanish Fluffy_Pillow 58.3/120: 49% energy | 6.0/6: 100% combo_points blood_frenzy
2:23.492 rupture Fluffy_Pillow 58.3/120: 49% energy | 6.0/6: 100% combo_points vanish, blood_frenzy
2:24.495 exsanguinate Fluffy_Pillow 55.2/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
2:25.500 kingsbane Fluffy_Pillow 87.0/120: 73% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
2:26.505 mutilate Fluffy_Pillow 83.9/120: 70% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy
2:27.509 envenom Fluffy_Pillow 60.8/120: 51% energy | 6.0/6: 100% combo_points elaborate_planning, blood_frenzy
2:28.513 mutilate Fluffy_Pillow 57.7/120: 48% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:29.517 Waiting 0.900 sec 34.5/120: 29% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
2:30.417 mutilate Fluffy_Pillow 55.2/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
2:31.420 Waiting 0.100 sec 32.0/120: 27% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy
2:31.520 envenom Fluffy_Pillow 43.2/120: 36% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy
2:32.525 Waiting 0.100 sec 40.1/120: 33% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:32.625 garrote Fluffy_Pillow 51.3/120: 43% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:33.629 Waiting 1.000 sec 28.2/120: 23% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
2:34.629 mutilate Fluffy_Pillow 60.0/120: 50% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, blood_frenzy
2:35.636 Waiting 0.700 sec 26.9/120: 22% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, blood_frenzy
2:36.336 envenom Fluffy_Pillow 35.2/120: 29% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, blood_frenzy
2:37.341 Waiting 1.100 sec 32.1/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:38.441 mutilate Fluffy_Pillow 55.1/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:39.444 Waiting 1.100 sec 31.1/120: 26% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:40.544 mutilate Fluffy_Pillow 63.0/120: 53% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
2:41.549 rupture Fluffy_Pillow 39.0/120: 32% energy | 6.0/6: 100% combo_points envenom
2:42.553 Waiting 1.000 sec 34.9/120: 29% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:43.553 mutilate Fluffy_Pillow 55.8/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:44.556 Waiting 2.899 sec 22.6/120: 19% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy
2:47.455 garrote Fluffy_Pillow 86.9/120: 72% energy | 2.0/6: 33% combo_points blood_frenzy
2:48.630 mutilate Fluffy_Pillow 75.8/120: 63% energy | 3.0/6: 50% combo_points blood_frenzy
2:49.636 rupture Fluffy_Pillow 32.7/120: 27% energy | 6.0/6: 100% combo_points blood_frenzy
2:50.639 Waiting 1.400 sec 39.6/120: 33% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
2:52.039 mutilate Fluffy_Pillow 56.1/120: 47% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
2:53.044 Waiting 1.200 sec 33.0/120: 28% energy | 4.0/6: 67% combo_points elaborate_planning, blood_frenzy
2:54.244 mutilate Fluffy_Pillow 56.6/120: 47% energy | 4.0/6: 67% combo_points elaborate_planning
2:55.248 Waiting 3.031 sec 22.5/120: 19% energy | 6.0/6: 100% combo_points
2:58.279 envenom Fluffy_Pillow 85.5/120: 71% energy | 6.0/6: 100% combo_points
2:59.282 mutilate Fluffy_Pillow 71.4/120: 59% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:00.285 Waiting 3.000 sec 37.3/120: 31% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
3:03.285 garrote Fluffy_Pillow 99.9/120: 83% energy | 2.0/6: 33% combo_points envenom
3:04.288 mutilate Fluffy_Pillow 75.8/120: 63% energy | 3.0/6: 50% combo_points envenom
3:05.293 Waiting 1.700 sec 41.8/120: 35% energy | 5.0/6: 83% combo_points
3:06.993 envenom Fluffy_Pillow 80.3/120: 67% energy | 5.0/6: 83% combo_points
3:07.998 mutilate Fluffy_Pillow 56.2/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:09.002 vendetta Fluffy_Pillow 32.1/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:09.002 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:09.002 mutilate Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning
3:10.008 rupture Fluffy_Pillow 75.9/120: 63% energy | 6.0/6: 100% combo_points blood_fury, envenom, elaborate_planning
3:11.014 exsanguinate Fluffy_Pillow 81.9/120: 68% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
3:12.019 kingsbane Fluffy_Pillow 112.8/120: 94% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
3:13.024 mutilate Fluffy_Pillow 108.8/120: 91% energy | 1.0/6: 17% combo_points blood_fury, elaborate_planning
3:14.028 mutilate Fluffy_Pillow 84.7/120: 71% energy | 4.0/6: 67% combo_points blood_fury, elaborate_planning
3:15.032 envenom Fluffy_Pillow 61.6/120: 51% energy | 6.0/6: 100% combo_points blood_fury, blood_frenzy
3:16.037 mutilate Fluffy_Pillow 58.4/120: 49% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
3:17.041 Waiting 1.800 sec 35.3/120: 29% energy | 2.0/6: 33% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
3:18.841 garrote Fluffy_Pillow 96.6/120: 81% energy | 2.0/6: 33% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
3:19.847 mutilate Fluffy_Pillow 73.5/120: 61% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
3:20.852 envenom Fluffy_Pillow 50.4/120: 42% energy | 5.0/6: 83% combo_points blood_fury, envenom, blood_frenzy
3:21.856 Waiting 0.800 sec 37.3/120: 31% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
3:22.656 mutilate Fluffy_Pillow 56.7/120: 47% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
3:23.662 Waiting 1.000 sec 33.6/120: 28% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
3:24.662 mutilate Fluffy_Pillow 55.4/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
3:25.667 Waiting 2.100 sec 32.3/120: 27% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy
3:27.767 rupture Fluffy_Pillow 87.2/120: 73% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
3:28.773 mutilate Fluffy_Pillow 84.1/120: 70% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:29.778 Waiting 0.500 sec 50.0/120: 42% energy | 3.0/6: 50% combo_points elaborate_planning
3:30.278 mutilate Fluffy_Pillow 55.5/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning
3:31.282 Waiting 2.400 sec 31.4/120: 26% energy | 5.0/6: 83% combo_points elaborate_planning
3:33.682 garrote Fluffy_Pillow 77.5/120: 65% energy | 5.0/6: 83% combo_points
3:34.846 rupture Fluffy_Pillow 65.2/120: 54% energy | 6.0/6: 100% combo_points
3:35.851 Waiting 0.400 sec 51.1/120: 43% energy | 0.0/6: 0% combo_points elaborate_planning
3:36.251 mutilate Fluffy_Pillow 55.5/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning
3:37.256 Waiting 1.400 sec 31.4/120: 26% energy | 3.0/6: 50% combo_points elaborate_planning
3:38.656 mutilate Fluffy_Pillow 56.6/120: 47% energy | 3.0/6: 50% combo_points elaborate_planning
3:39.661 Waiting 3.023 sec 22.6/120: 19% energy | 6.0/6: 100% combo_points elaborate_planning
3:42.684 envenom Fluffy_Pillow 85.5/120: 71% energy | 6.0/6: 100% combo_points
3:43.690 mutilate Fluffy_Pillow 71.4/120: 60% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:44.695 Waiting 0.800 sec 37.3/120: 31% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:45.495 mutilate Fluffy_Pillow 56.0/120: 47% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:46.500 Waiting 1.396 sec 12.0/120: 10% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
3:47.896 envenom Fluffy_Pillow 47.2/120: 39% energy | 6.0/6: 100% combo_points envenom
3:48.902 Waiting 0.600 sec 43.1/120: 36% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:49.502 garrote Fluffy_Pillow 49.7/120: 41% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:50.506 Waiting 1.866 sec 15.6/120: 13% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
3:52.372 mutilate Fluffy_Pillow 55.9/120: 47% energy | 1.0/6: 17% combo_points envenom, elaborate_planning
3:53.378 Waiting 1.300 sec 32.5/120: 27% energy | 4.0/6: 67% combo_points envenom, blood_frenzy
3:54.678 mutilate Fluffy_Pillow 57.9/120: 48% energy | 4.0/6: 67% combo_points envenom, blood_frenzy
3:55.683 Waiting 0.100 sec 24.8/120: 21% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
3:55.783 rupture Fluffy_Pillow 25.9/120: 22% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
3:56.788 exsanguinate Fluffy_Pillow 22.8/120: 19% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:57.795 kingsbane Fluffy_Pillow 54.7/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:58.799 Waiting 0.100 sec 51.6/120: 43% energy | 1.0/6: 17% combo_points elaborate_planning, blood_frenzy
3:58.899 mutilate Fluffy_Pillow 62.8/120: 52% energy | 1.0/6: 17% combo_points elaborate_planning, blood_frenzy
3:59.903 envenom Fluffy_Pillow 39.7/120: 33% energy | 5.0/6: 83% combo_points elaborate_planning, blood_frenzy
4:00.908 Waiting 0.800 sec 36.6/120: 30% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:01.708 mutilate Fluffy_Pillow 56.0/120: 47% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:02.712 Waiting 2.200 sec 32.8/120: 27% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:04.912 garrote Fluffy_Pillow 106.8/120: 89% energy | 3.0/6: 50% combo_points envenom
4:05.916 mutilate Fluffy_Pillow 82.8/120: 69% energy | 4.0/6: 67% combo_points blood_frenzy
4:06.919 envenom Fluffy_Pillow 59.6/120: 50% energy | 6.0/6: 100% combo_points blood_frenzy
4:07.924 Waiting 0.800 sec 46.5/120: 39% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:08.724 mutilate Fluffy_Pillow 66.0/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:09.726 Waiting 1.000 sec 42.8/120: 36% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
4:10.726 mutilate Fluffy_Pillow 64.7/120: 54% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
4:11.731 Waiting 1.800 sec 41.5/120: 35% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy
4:13.531 rupture Fluffy_Pillow 82.8/120: 69% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
4:14.533 mutilate Fluffy_Pillow 79.7/120: 66% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
4:15.538 Waiting 0.200 sec 46.6/120: 39% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
4:15.738 mutilate Fluffy_Pillow 58.9/120: 49% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
4:16.743 Waiting 2.955 sec 15.7/120: 13% energy | 5.0/6: 83% combo_points elaborate_planning
4:19.698 garrote Fluffy_Pillow 87.8/120: 73% energy | 5.0/6: 83% combo_points
4:20.917 rupture Fluffy_Pillow 66.1/120: 55% energy | 6.0/6: 100% combo_points
4:21.922 mutilate Fluffy_Pillow 62.0/120: 52% energy | 0.0/6: 0% combo_points elaborate_planning
4:22.927 Waiting 1.600 sec 28.0/120: 23% energy | 2.0/6: 33% combo_points elaborate_planning
4:24.527 mutilate Fluffy_Pillow 55.4/120: 46% energy | 2.0/6: 33% combo_points elaborate_planning
4:25.530 Waiting 1.439 sec 21.3/120: 18% energy | 4.0/6: 67% combo_points elaborate_planning
4:26.969 mutilate Fluffy_Pillow 57.0/120: 47% energy | 4.0/6: 67% combo_points
4:27.973 Waiting 2.994 sec 22.9/120: 19% energy | 6.0/6: 100% combo_points
4:30.967 envenom Fluffy_Pillow 85.5/120: 71% energy | 6.0/6: 100% combo_points
4:31.973 mutilate Fluffy_Pillow 71.4/120: 60% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:32.977 Waiting 2.600 sec 37.3/120: 31% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:35.577 garrote Fluffy_Pillow 85.6/120: 71% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:36.581 mutilate Fluffy_Pillow 61.6/120: 51% energy | 4.0/6: 67% combo_points envenom
4:37.586 Waiting 2.200 sec 27.5/120: 23% energy | 6.0/6: 100% combo_points envenom
4:39.786 envenom Fluffy_Pillow 81.4/120: 68% energy | 6.0/6: 100% combo_points
4:40.789 mutilate Fluffy_Pillow 57.3/120: 48% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:41.793 vendetta Fluffy_Pillow 33.3/120: 28% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
4:41.793 mutilate Fluffy_Pillow 120.0/120: 100% energy | 4.0/6: 67% combo_points envenom, elaborate_planning
4:42.799 vanish Fluffy_Pillow 75.9/120: 63% energy | 6.0/6: 100% combo_points envenom, elaborate_planning
4:42.799 rupture Fluffy_Pillow 75.9/120: 63% energy | 6.0/6: 100% combo_points vanish, envenom, elaborate_planning
4:43.804 exsanguinate Fluffy_Pillow 81.9/120: 68% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:44.809 kingsbane Fluffy_Pillow 112.8/120: 94% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:45.814 mutilate Fluffy_Pillow 108.8/120: 91% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:46.819 envenom Fluffy_Pillow 84.7/120: 71% energy | 5.0/6: 83% combo_points elaborate_planning
4:47.823 mutilate Fluffy_Pillow 80.6/120: 67% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:48.825 Waiting 2.600 sec 56.5/120: 47% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
4:51.425 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy
4:52.428 mutilate Fluffy_Pillow 96.9/120: 81% energy | 3.0/6: 50% combo_points envenom, blood_frenzy
4:53.433 envenom Fluffy_Pillow 73.7/120: 61% energy | 6.0/6: 100% combo_points blood_frenzy
4:54.437 mutilate Fluffy_Pillow 60.6/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:55.442 Waiting 0.700 sec 37.5/120: 31% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, blood_frenzy
4:56.142 mutilate Fluffy_Pillow 55.8/120: 46% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, blood_frenzy
4:57.144 Waiting 0.300 sec 22.6/120: 19% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy
4:57.444 envenom Fluffy_Pillow 36.2/120: 30% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy
4:58.450 Waiting 1.062 sec 23.1/120: 19% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:59.512 mutilate Fluffy_Pillow 55.6/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
5:00.517 Waiting 1.051 sec 22.3/120: 19% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
5:01.568 mutilate Fluffy_Pillow 63.7/120: 53% energy | 3.0/6: 50% combo_points envenom, elaborate_planning

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8809 8484 0
Agility 29481 27775 17426 (11258)
Stamina 41234 41234 25459
Intellect 5322 4997 0
Spirit 2 2 0
Health 2474040 2474040 0
Energy 120 120 0
Combo Points 6 6 0
Crit 41.91% 41.91% 9417
Haste 8.82% 8.82% 2865
Damage / Heal Versatility 7.68% 6.74% 2696
Attack Power 29481 27775 0
Mastery 80.28% 80.28% 4226
Armor 2244 2244 2244
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +1012 Crit, +448 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Zoldyck Family Training Shackles
ilevel: 895, stats: { 167 Armor, +1665 Sta, +1110 Agi, +620 Mastery, +248 Haste }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Dingy Suramar Mercantile Signet
ilevel: 860, stats: { +1201 Sta, +1362 Crit, +545 Vers }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Thrice-Accursed Compass
ilevel: 860, stats: { +1353 Agi, +322 Mastery, +322 Crit, +322 Haste }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand The Kingslayers
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand The Kingslayers
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Assassination_Exsg_T19M"
level=110
race=orc
role=attack
position=back
talents=2110131
artifact=43:0:0:0:0:323:3:324:3:325:3:326:3:327:3:328:3:329:3:330:3:331:3:332:1:333:1:334:1:335:1:337:1:346:1:347:1:1276:1
spec=assassination

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions+=/blood_fury,if=debuff.vendetta.up
actions+=/berserking,if=debuff.vendetta.up
actions+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions+=/call_action_list,name=cds
actions+=/rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
actions+=/pool_resource,for_next=1
actions+=/kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
actions+=/run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
actions+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions+=/call_action_list,name=exsang,if=dot.rupture.exsanguinated
actions+=/rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
actions+=/call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
actions+=/call_action_list,name=build_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=build_noex,if=!talent.exsanguinate.enabled

actions.build_ex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_ex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_ex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_ex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_ex+=/hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&((dot.rupture.exsanguinated&dot.rupture.remains<=2)|cooldown.exsanguinate.remains<=2))
actions.build_ex+=/mutilate,if=combo_points.deficit<=1&energy.deficit<=30
actions.build_ex+=/mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2

actions.build_noex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_noex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_noex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_noex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_noex+=/hemorrhage,if=combo_points.deficit>=1&refreshable
actions.build_noex+=/mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2

actions.cds=marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=target.time_to_die<20
actions.cds+=/vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
actions.cds+=/vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
actions.cds+=/vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25

actions.exsang=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die>6
actions.exsang+=/rupture,if=combo_points>=cp_max_spend&ticks_remain<2
actions.exsang+=/death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang+=/envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)

actions.exsang_combo=vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
actions.exsang_combo+=/rupture,if=combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)
actions.exsang_combo+=/exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
actions.exsang_combo+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions.exsang_combo+=/hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
actions.exsang_combo+=/call_action_list,name=build_ex

actions.finish_ex=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_ex+=/rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
actions.finish_ex+=/death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)

actions.finish_noex=variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_noex+=/rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_noex+=/rupture,if=combo_points>=cp_max_spend&((dot.rupture.refreshable|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
actions.finish_noex+=/death_from_above,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
actions.finish_noex+=/envenom,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)

actions.garrote=pool_resource,for_next=1
actions.garrote+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
actions.garrote+=/pool_resource,for_next=1
actions.garrote+=/garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=grove_keepers_robe,id=139207,bonus_id=1806
wrists=zoldyck_family_training_shackles,id=137098
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=dingy_suramar_mercantile_signet,id=141492,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=thriceaccursed_compass,id=141537
main_hand=the_kingslayers,id=128870,bonus_id=741,gem_id=139268/139261/139260,relic_id=1806/1806/1806
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=881.69
# gear_agility=17426
# gear_stamina=25459
# gear_crit_rating=9417
# gear_haste_rating=2865
# gear_mastery_rating=4226
# gear_versatility_rating=2696
# gear_armor=2244

Rogue_Assassination_T19M : 435262 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
435262.3 435262.3 352.3 / 0.081% 60595.8 / 13.9% 19485.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
22.3 22.3 Energy 50.61% 31.5 100.0% 100%
Talents
  • 15: Elaborate Planning
  • 30: Nightstalker
  • 45: Deeper Stratagem
  • 75: Thuggee (Assassination Rogue)
  • 90: Agonizing Poison (Assassination Rogue)
  • 100: Venom Rush (Assassination Rogue)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Assassination_T19M 435262
auto_attack_mh 21436 4.9% 192.8 1.56sec 33401 21676 Direct 192.8 27523 55072 33401 40.3% 18.9%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 192.81 192.81 0.00 0.00 1.5409 0.0000 6440089.43 9467541.48 31.98 21675.77 21675.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.67 40.80% 27522.57 16484 38212 27521.69 25854 29327 2165261 3183139 31.98
crit 77.62 40.26% 55071.65 32967 76424 55070.89 51487 59518 4274829 6284403 31.98
miss 36.52 18.94% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 10613 2.4% 191.0 1.57sec 16695 10725 Direct 191.0 13764 27528 16695 40.3% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 190.99 190.99 0.00 0.00 1.5566 0.0000 3188590.01 4687529.34 31.98 10725.23 10725.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.75 40.71% 13763.95 8242 19106 13763.96 12996 14650 1070185 1573274 31.98
crit 76.95 40.29% 27528.03 16484 38212 27526.16 25754 29442 2118405 3114255 31.98
miss 36.29 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Envenom 63467 14.6% 32.4 9.12sec 588599 585970 Direct 32.4 419482 839416 588597 40.3% 0.0%  

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.41 32.41 0.00 0.00 1.0045 0.0000 19074489.24 19074489.24 0.00 585969.81 585969.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.36 59.73% 419481.68 200635 711183 419784.12 344933 528823 8119361 8119361 0.00
crit 13.05 40.27% 839415.58 401270 1422365 840074.55 642974 1203578 10955129 10955129 0.00
 
 

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
From the Shadows 18326 4.2% 203.9 2.77sec 27025 0 Direct 203.9 19265 38525 27025 40.3% 0.0%  

Stats details: from_the_shadows

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.95 203.95 0.00 0.00 0.0000 0.0000 5511718.99 5511718.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.78 59.71% 19264.77 12294 22346 19262.50 18429 19866 2345978 2345978 0.00
crit 82.17 40.29% 38524.61 24588 44692 38518.54 36997 39977 3165741 3165741 0.00
 
 

Action details: from_the_shadows

Static Values
  • id:192434
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192434
  • name:From the Shadows
  • school:nature
  • tooltip:
  • description:{$@spelldesc192428=Declaring your Vendetta unleashes a barrage of poisoned daggers at the target for ${20*{$192434s1=10}*$m1} Nature damage over {$192432d=20 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.350000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10.00
  • base_dd_max:10.00
 
Garrote 42450 9.8% 17.5 17.83sec 728828 725583 Periodic 149.8 60683 121309 85140 40.3% 0.0% 99.7%

Stats details: garrote

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.50 0.00 149.83 149.83 1.0045 2.0000 12756476.25 12756476.25 0.00 40210.55 725583.09
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.4 59.66% 60682.87 31582 104485 60712.28 55543 66803 5424380 5424380 0.00
crit 60.4 40.34% 121308.67 63164 208970 121370.65 108317 138328 7332097 7332097 0.00
 
 

Action details: garrote

Static Values
  • id:703
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
Spelldata
  • id:703
  • name:Garrote
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 seconds.
  • description:Garrote the enemy, causing $o1 Bleed damage over {$d=18 seconds}.$?a231719[ Silences the target for {$1330d=3 seconds} when used from Stealth.][] |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.900000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Horrific Slam 20454 4.7% 116.0 2.22sec 53007 0 Direct 116.0 37784 75564 53006 40.3% 0.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.99 115.99 0.00 0.00 0.0000 0.0000 6148039.95 6148039.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.25 59.71% 37783.56 25217 42422 37792.28 34469 40575 2616519 2616519 0.00
crit 46.74 40.29% 75563.58 50433 84844 75574.32 68832 82136 3531521 3531521 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Kingsbane 17445 (26260) 4.0% (6.0%) 6.9 46.42sec 1143778 1138726 Periodic 46.9 79476 158900 111481 40.3% 0.0% 31.2%

Stats details: kingsbane

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.89 0.00 46.93 46.93 1.0045 2.0000 5231356.60 5231356.60 0.00 78154.08 1138726.16
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.0 59.70% 79476.06 24883 234421 79640.22 58808 107212 2226615 2226615 0.00
crit 18.9 40.30% 158900.03 49766 521586 159256.82 115807 227831 3004742 3004742 0.00
 
 

Action details: kingsbane

Static Values
  • id:192759
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
Spelldata
  • id:192759
  • name:Kingsbane
  • school:nature
  • tooltip:Suffering $w4 Nature damage every $t4 sec.
  • description:Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.360000
  • spell_power_mod.tick:0.000000
  • base_td:5.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Kingsbane (_mh) 5873 1.3% 6.9 46.42sec 255828 0 Direct 6.9 182834 364062 255837 40.3% 0.0%  

Stats details: kingsbane_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.89 6.89 0.00 0.00 0.0000 0.0000 1761488.33 1761488.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.11 59.72% 182834.12 126230 273796 182665.75 0 258521 751852 751852 0.00
crit 2.77 40.28% 364061.94 233355 547591 353139.49 0 517042 1009636 1009636 0.00
 
 

Action details: kingsbane_mh

Static Values
  • id:222062
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222062
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
    Kingsbane (_oh) 2942 0.7% 6.9 46.42sec 128181 0 Direct 6.9 91347 182883 128184 40.2% 0.0%  

Stats details: kingsbane_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.89 6.89 0.00 0.00 0.0000 0.0000 882585.20 882585.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.11 59.76% 91346.86 63115 136898 91131.65 0 129261 375869 375869 0.00
crit 2.77 40.24% 182882.65 116677 273796 177081.62 0 258521 506717 506717 0.00
 
 

Action details: kingsbane_oh

Static Values
  • id:192760
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192760
  • name:Kingsbane
  • school:nature
  • tooltip:
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by {$192853s1=15}%. |cFFFFFFFFAwards {$s6=1} combo $lpoint:points;.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.40
 
Mark of the Hidden Satyr 7113 1.6% 16.5 18.07sec 129601 0 Direct 16.5 92352 184515 129598 40.4% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.48 16.48 0.00 0.00 0.0000 0.0000 2136345.58 2136345.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.82 59.58% 92351.74 62361 104911 92317.42 77614 102124 907059 907059 0.00
crit 6.66 40.42% 184514.55 124723 209822 184317.40 0 209822 1229287 1229287 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Mutilate 0 (62257) 0.0% (14.3%) 77.3 3.89sec 242038 240954

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.28 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 240954.19 240954.19
 
 

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit<=1&energy.deficit<=30
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Attack with both weapons, dealing a total of ${$5374sw2+$27576sw2} Physical damage.{$?s1329=true}|!c1[][ Replaces Sinister Strike.] |cFFFFFFFFAwards {$s2=2} combo $lpoint:points;.|r
 
    Mutilate (_mh) 41502 9.5% 77.3 3.89sec 161349 0 Direct 77.3 110220 220420 161348 46.4% 0.0%  

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.28 77.28 0.00 0.00 0.0000 0.0000 12469065.17 18330706.91 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.42 53.60% 110219.88 65423 151533 110224.98 100293 121435 4565855 6712240 31.98
crit 35.86 46.40% 220419.78 130846 303065 220385.07 194351 241921 7903210 11618467 31.98
 
 

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
    Mutilate Off-Hand (mutilate_oh) 20755 4.8% 77.3 3.89sec 80690 0 Direct 77.3 55138 110274 80691 46.3% 0.0%  

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.28 77.28 0.00 0.00 0.0000 0.0000 6235726.63 9167108.81 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.47 53.66% 55137.95 32710 75762 55138.56 49277 59672 2286363 3361170 31.98
crit 35.81 46.34% 110274.34 65419 151525 110263.42 99654 120985 3949364 5805939 31.98
 
 

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:
  • description:Instantly attacks for $sw2 Physical damage. Awards 2 combo points.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.60
 
Poison Bomb 24698 5.7% 36.6 6.14sec 203084 0 Direct 36.6 144831 289696 203085 40.2% 0.0%  

Stats details: poison_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.60 36.60 0.00 0.00 0.0000 0.0000 7433741.84 7433741.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.88 59.79% 144831.33 102968 165772 144878.42 127917 161004 3169573 3169573 0.00
crit 14.72 40.21% 289695.59 205935 331544 289735.03 0 324535 4264169 4264169 0.00
 
 

Action details: poison_bomb

Static Values
  • id:192660
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:192660
  • name:Poison Bomb
  • school:nature
  • tooltip:
  • description:{$@spelldesc192657=Envenom has a chance to smash a vial of poison at the target's location, creating a pool of acidic death that deals ${{$192660s1=1}*6} Nature damage over {$192661d=3 seconds} to all enemies within it.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Potion of the Old War 22986 5.2% 23.3 4.24sec 291060 0 Direct 23.3 207379 414904 291059 40.3% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.34 23.34 0.00 0.00 0.0000 0.0000 6793543.10 9987151.86 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.93 59.68% 207379.25 145599 222798 207334.19 179979 222798 2888547 4246438 31.98
crit 9.41 40.32% 414903.81 291198 445597 414868.14 318706 445597 3904996 5740714 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rupture 115203 26.5% 11.8 26.14sec 2936237 2923085 Periodic 146.5 157269 314769 236504 50.3% 0.0% 97.1%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.80 0.00 146.51 146.51 1.0045 1.9928 34650254.78 34650254.78 0.00 114050.51 2923085.44
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.8 49.69% 157269.21 64 632111 157268.28 125104 209689 11449548 11449548 0.00
crit 73.7 50.31% 314768.67 126 1264222 314695.24 249874 406968 23200707 23200707 0.00
 
 

Action details: rupture

Static Values
  • id:1943
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that tears open the target, dealing Bleed damage over time. Lasts longer per combo point. 1 point : ${{$s1=0}*1*8/2} over 8 sec 2 points: ${{$s1=0}*2*12/2} over 12 sec 3 points: ${{$s1=0}*3*16/2} over 16 sec 4 points: ${{$s1=0}*4*20/2} over 20 sec 5 points: ${{$s1=0}*5*24/2} over 24 sec{$?s193531=false}[ 6 points: ${{$s1=0}*6*28/2} over 28 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.250000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:4.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Rogue_Assassination_T19M
Agonizing Poison 193.0 1.67sec

Stats details: agonizing_poison

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 192.99 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: agonizing_poison

Static Values
  • id:200803
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200803
  • name:Agonizing Poison
  • school:nature
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=20}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${{$200803s1=4}}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T19M
  • harmful:false
  • if_expr:
 
Blood Fury 2.9 124.02sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.vendetta.up
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Vanish 2.9 122.72sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 
Vendetta 5.3 62.01sec

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.27 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<20
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by {$s1=30}%, and making the target visible to you even through concealments such as stealth and invisibility.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 10.8 6.5 28.1sec 17.1sec 45.19% 45.19% 6.5(6.5) 10.3

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood Fury 2.9 0.0 124.0sec 124.0sec 14.04% 14.04% 0.0(0.0) 2.7

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:14.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 12.38% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Elaborate Planning 33.0 11.2 9.1sec 6.8sec 69.14% 56.47% 11.2(11.2) 32.3

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_elaborate_planning
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.15

Stack Uptimes

  • elaborate_planning_1:69.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193641
  • name:Elaborate Planning
  • tooltip:Increases damage done by {$s1=15}%.
  • description:Increases damage done by {$s1=15}% for {$d=5 seconds}.
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Envenom 19.0 13.4 15.8sec 9.1sec 62.02% 59.32% 13.4(13.4) 18.4

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • envenom_1:62.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by {$s2=30}%.
  • description:Finishing move that drives your poisoned blades in deep, dealing instant Nature damage and increasing your poison application chance by {$s2=30}%. Damage and duration increased per combo point. 1 point : ${$m1*1} damage, 2 sec 2 points: ${$m1*2} damage, 3 sec 3 points: ${$m1*3} damage, 4 sec 4 points: ${$m1*4} damage, 5 sec 5 points: ${$m1*5} damage, 6 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 7 sec][]{$?s32645=true}|!c1[][ Replaces Eviscerate.]
  • max_stacks:0
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
Horrific Appendages 6.1 2.1 47.8sec 34.4sec 29.56% 29.56% 118.1(118.1) 5.8

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:29.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 68.9sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Vanish 2.9 0.0 122.7sec 122.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Assassination_T19M
envenom Energy 32.4 1134.2 35.0 35.0 16817.1
envenom Combo Points 32.4 163.0 5.0 5.0 117013.3
garrote Energy 17.5 787.6 45.0 45.0 16196.3
kingsbane Energy 6.9 241.0 35.0 35.0 32679.2
mutilate Energy 77.3 4250.4 55.0 55.0 4400.7
rupture Energy 11.8 295.0 25.0 25.0 117450.3
rupture Combo Points 11.8 70.8 6.0 6.0 489376.1
Resource Gains Type Count Total Average Overflow
kingsbane Combo Points 6.89 6.12 (2.59%) 0.89 0.76 11.09%
mutilate Combo Points 77.28 150.81 (63.87%) 1.95 3.75 2.43%
garrote Combo Points 17.50 17.50 (7.41%) 1.00 0.00 0.00%
energy_regen Energy 2087.93 3327.69 (50.20%) 1.59 107.87 3.14%
seal_fate Combo Points 74.45 61.67 (26.12%) 0.83 12.77 17.16%
Venomous Vim Energy 295.78 2853.91 (43.05%) 9.65 103.85 3.51%
Urge to Kill Energy 5.27 447.93 (6.76%) 84.96 184.77 29.20%
Resource RPS-Gain RPS-Loss
Energy 22.05 22.31
Combo Points 0.79 0.78
Combat End Resource Mean Min Max
Energy 41.30 0.03 120.00
Combo Points 2.28 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 3.1%

Procs

Count Interval
Seal Fate 74.4 5.2sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Assassination_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Rogue_Assassination_T19M Damage Per Second
Count 7499
Mean 435262.26
Minimum 378083.75
Maximum 494748.41
Spread ( max - min ) 116664.66
Range [ ( max - min ) / 2 * 100% ] 13.40%
Standard Deviation 15566.8926
5th Percentile 410867.31
95th Percentile 461657.25
( 95th Percentile - 5th Percentile ) 50789.94
Mean Distribution
Standard Deviation 179.7630
95.00% Confidence Intervall ( 434909.94 - 435614.59 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4913
0.1 Scale Factor Error with Delta=300 2068652
0.05 Scale Factor Error with Delta=300 8274609
0.01 Scale Factor Error with Delta=300 206865243
Priority Target DPS
Sample Data Rogue_Assassination_T19M Priority Target Damage Per Second
Count 7499
Mean 435262.26
Minimum 378083.75
Maximum 494748.41
Spread ( max - min ) 116664.66
Range [ ( max - min ) / 2 * 100% ] 13.40%
Standard Deviation 15566.8926
5th Percentile 410867.31
95th Percentile 461657.25
( 95th Percentile - 5th Percentile ) 50789.94
Mean Distribution
Standard Deviation 179.7630
95.00% Confidence Intervall ( 434909.94 - 435614.59 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4913
0.1 Scale Factor Error with Delta=300 2068652
0.05 Scale Factor Error with Delta=300 8274609
0.01 Scale Factor Error with Delta=300 206865243
DPS(e)
Sample Data Rogue_Assassination_T19M Damage Per Second (Effective)
Count 7499
Mean 435262.26
Minimum 378083.75
Maximum 494748.41
Spread ( max - min ) 116664.66
Range [ ( max - min ) / 2 * 100% ] 13.40%
Damage
Sample Data Rogue_Assassination_T19M Damage
Count 7499
Mean 130713511.12
Minimum 93047544.94
Maximum 171610365.97
Spread ( max - min ) 78562821.02
Range [ ( max - min ) / 2 * 100% ] 30.05%
DTPS
Sample Data Rogue_Assassination_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Assassination_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Assassination_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Assassination_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Assassination_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Assassination_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Assassination_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Assassination_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 apply_poison
5 0.00 stealth
6 0.00 potion,name=old_war
7 0.00 marked_for_death,if=raid_event.adds.in>40
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
9 2.87 blood_fury,if=debuff.vendetta.up
0.00 berserking,if=debuff.vendetta.up
0.00 arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
A 0.00 call_action_list,name=cds
0.00 rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
0.00 pool_resource,for_next=1
B 6.89 kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
C 0.00 run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
D 0.00 call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
E 0.00 call_action_list,name=exsang,if=dot.rupture.exsanguinated
0.00 rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
F 0.00 call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
G 0.00 call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
H 0.00 call_action_list,name=build_ex,if=talent.exsanguinate.enabled
I 0.00 call_action_list,name=build_noex,if=!talent.exsanguinate.enabled
actions.build_noex
# count action,conditions
0.00 hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
0.00 hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
0.00 fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
0.00 fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
0.00 hemorrhage,if=combo_points.deficit>=1&refreshable
J 77.28 mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2
actions.cds
# count action,conditions
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
K 0.31 vendetta,if=target.time_to_die<20
L 4.97 vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
0.00 vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
M 2.90 vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25
actions.finish_noex
# count action,conditions
0.00 variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
0.00 rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
P 11.80 rupture,if=combo_points>=cp_max_spend&((dot.rupture.refreshable|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
0.00 death_from_above,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
Q 32.41 envenom,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
actions.garrote
# count action,conditions
0.00 pool_resource,for_next=1
0.00 garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
0.00 pool_resource,for_next=1
R 17.50 garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

Sample Sequence

012456RJJMPL9BJJQJQJRQJJQJJRPJJQJJQRBJQJJJPRJQL8JJQJJQRJJPJJBQRJQJJJPJRJMPJJQL9JJQJRBQJJQJQRJJPJJQRJQJJPJJQLBRJQJQJJQRJJPJJQJRJQJQBJJPRJL9JJMPJJQRJQJQJJQBRJPJJQJR

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Assassination_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Assassination_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Assassination_T19M 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre apply_poison Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.004 mutilate Fluffy_Pillow 88.8/120: 74% energy | 1.0/6: 17% combo_points bloodlust, potion_of_the_old_war
0:02.008 mutilate Fluffy_Pillow 58.8/120: 49% energy | 5.0/6: 83% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:03.015 Waiting 0.508 sec 18.9/120: 16% energy | 6.0/6: 100% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:03.523 vanish Fluffy_Pillow 26.5/120: 22% energy | 6.0/6: 100% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:03.523 rupture Fluffy_Pillow 26.5/120: 22% energy | 6.0/6: 100% combo_points bloodlust, vanish, blood_frenzy, potion_of_the_old_war
0:04.525 vendetta Fluffy_Pillow 26.5/120: 22% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:04.525 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:04.525 kingsbane Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:05.529 mutilate Fluffy_Pillow 110.0/120: 92% energy | 2.0/6: 33% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:06.534 mutilate Fluffy_Pillow 80.1/120: 67% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:07.538 envenom Fluffy_Pillow 50.1/120: 42% energy | 6.0/6: 100% combo_points bloodlust, blood_fury, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:08.542 Waiting 1.000 sec 40.1/120: 33% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:09.542 mutilate Fluffy_Pillow 65.1/120: 54% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:10.546 Waiting 0.500 sec 35.1/120: 29% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:11.046 envenom Fluffy_Pillow 42.6/120: 35% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:12.051 Waiting 0.900 sec 42.6/120: 36% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:12.951 mutilate Fluffy_Pillow 56.1/120: 47% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:13.955 Waiting 0.800 sec 26.1/120: 22% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:14.755 garrote Fluffy_Pillow 48.1/120: 40% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:16.005 envenom Fluffy_Pillow 41.8/120: 35% energy | 4.0/6: 67% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:17.010 Waiting 1.012 sec 21.8/120: 18% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:18.022 mutilate Fluffy_Pillow 57.0/120: 47% energy | 0.0/6: 0% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:19.029 Waiting 1.232 sec 17.0/120: 14% energy | 3.0/6: 50% combo_points bloodlust, blood_fury, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:20.261 mutilate Fluffy_Pillow 55.5/120: 46% energy | 3.0/6: 50% combo_points bloodlust, envenom, elaborate_planning, blood_frenzy, potion_of_the_old_war
0:21.267 Waiting 0.733 sec 15.5/120: 13% energy | 6.0/6: 100% combo_points bloodlust, envenom, blood_frenzy, potion_of_the_old_war
0:22.000 envenom Fluffy_Pillow 46.5/120: 39% energy | 6.0/6: 100% combo_points bloodlust, envenom, blood_frenzy, potion_of_the_old_war
0:23.005 Waiting 1.000 sec 26.0/120: 22% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:24.005 mutilate Fluffy_Pillow 59.7/120: 50% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning
0:25.009 Waiting 1.274 sec 18.5/120: 15% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning
0:26.283 mutilate Fluffy_Pillow 56.0/120: 47% energy | 2.0/6: 33% combo_points bloodlust, envenom, elaborate_planning
0:27.288 Waiting 3.343 sec 14.8/120: 12% energy | 5.0/6: 83% combo_points bloodlust, envenom
0:30.631 garrote Fluffy_Pillow 100.7/120: 84% energy | 5.0/6: 83% combo_points bloodlust
0:31.636 rupture Fluffy_Pillow 79.5/120: 66% energy | 6.0/6: 100% combo_points bloodlust
0:32.641 mutilate Fluffy_Pillow 78.3/120: 65% energy | 0.0/6: 0% combo_points bloodlust, elaborate_planning
0:33.643 Waiting 0.400 sec 47.1/120: 39% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:34.043 mutilate Fluffy_Pillow 62.6/120: 52% energy | 3.0/6: 50% combo_points bloodlust, elaborate_planning
0:35.048 Waiting 0.664 sec 21.4/120: 18% energy | 5.0/6: 83% combo_points bloodlust, elaborate_planning, horrific_appendages
0:35.712 envenom Fluffy_Pillow 40.5/120: 34% energy | 5.0/6: 83% combo_points bloodlust, elaborate_planning, horrific_appendages
0:36.718 Waiting 1.000 sec 30.5/120: 25% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:37.718 mutilate Fluffy_Pillow 55.5/120: 46% energy | 0.0/6: 0% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:38.724 Waiting 1.300 sec 25.6/120: 21% energy | 3.0/6: 50% combo_points bloodlust, envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:40.024 mutilate Fluffy_Pillow 64.7/120: 54% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:41.028 Waiting 0.627 sec 21.2/120: 18% energy | 6.0/6: 100% combo_points envenom, horrific_appendages, blood_frenzy
0:41.655 envenom Fluffy_Pillow 38.4/120: 32% energy | 6.0/6: 100% combo_points envenom, horrific_appendages, blood_frenzy
0:42.661 Waiting 6.000 sec 25.0/120: 21% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
0:48.661 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, horrific_appendages
0:49.666 kingsbane Fluffy_Pillow 95.6/120: 80% energy | 1.0/6: 17% combo_points horrific_appendages
0:50.670 mutilate Fluffy_Pillow 81.2/120: 68% energy | 2.0/6: 33% combo_points horrific_appendages
0:51.674 envenom Fluffy_Pillow 46.8/120: 39% energy | 4.0/6: 67% combo_points horrific_appendages
0:52.678 Waiting 1.200 sec 32.4/120: 27% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
0:53.878 mutilate Fluffy_Pillow 55.1/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
0:54.883 Waiting 1.403 sec 20.7/120: 17% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages
0:56.286 mutilate Fluffy_Pillow 55.6/120: 46% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages
0:57.290 Waiting 2.308 sec 11.2/120: 9% energy | 5.0/6: 83% combo_points horrific_appendages
0:59.598 mutilate Fluffy_Pillow 55.6/120: 46% energy | 5.0/6: 83% combo_points
1:00.601 rupture Fluffy_Pillow 31.2/120: 26% energy | 6.0/6: 100% combo_points
1:01.605 Waiting 5.079 sec 16.8/120: 14% energy | 0.0/6: 0% combo_points elaborate_planning
1:06.684 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
1:07.688 mutilate Fluffy_Pillow 85.6/120: 71% energy | 1.0/6: 17% combo_points
1:08.691 envenom Fluffy_Pillow 61.2/120: 51% energy | 5.0/6: 83% combo_points
1:09.696 vendetta Fluffy_Pillow 36.8/120: 31% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:09.696 potion Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:09.696 mutilate Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:10.700 mutilate Fluffy_Pillow 95.6/120: 80% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:11.705 Waiting 0.500 sec 51.2/120: 43% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:12.205 envenom Fluffy_Pillow 66.5/120: 55% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:13.210 Waiting 0.300 sec 52.1/120: 43% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:13.510 mutilate Fluffy_Pillow 55.3/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:14.515 Waiting 1.486 sec 20.9/120: 17% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:16.001 mutilate Fluffy_Pillow 56.6/120: 47% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:17.006 Waiting 1.061 sec 22.2/120: 19% energy | 5.0/6: 83% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:18.067 envenom Fluffy_Pillow 43.4/120: 36% energy | 5.0/6: 83% combo_points envenom, potion_of_the_old_war
1:19.071 Waiting 5.600 sec 29.1/120: 24% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, potion_of_the_old_war
1:24.671 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, blood_frenzy, potion_of_the_old_war
1:25.676 mutilate Fluffy_Pillow 86.6/120: 72% energy | 1.0/6: 17% combo_points envenom, blood_frenzy, potion_of_the_old_war
1:26.680 mutilate Fluffy_Pillow 63.1/120: 53% energy | 3.0/6: 50% combo_points blood_frenzy, potion_of_the_old_war
1:27.685 Waiting 0.461 sec 19.7/120: 16% energy | 6.0/6: 100% combo_points blood_frenzy, potion_of_the_old_war
1:28.146 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points blood_frenzy, potion_of_the_old_war
1:29.151 Waiting 1.200 sec 31.6/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy, potion_of_the_old_war
1:30.351 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy, potion_of_the_old_war
1:31.355 Waiting 1.266 sec 21.9/120: 18% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy, potion_of_the_old_war
1:32.621 mutilate Fluffy_Pillow 56.5/120: 47% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy, potion_of_the_old_war
1:33.624 Waiting 1.037 sec 13.1/120: 11% energy | 5.0/6: 83% combo_points blood_frenzy, potion_of_the_old_war
1:34.661 kingsbane Fluffy_Pillow 45.0/120: 37% energy | 5.0/6: 83% combo_points blood_frenzy, potion_of_the_old_war
1:35.670 Waiting 0.478 sec 21.0/120: 18% energy | 6.0/6: 100% combo_points
1:36.148 envenom Fluffy_Pillow 36.1/120: 30% energy | 6.0/6: 100% combo_points
1:37.152 Waiting 5.515 sec 21.7/120: 18% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
1:42.667 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, blood_frenzy
1:43.673 mutilate Fluffy_Pillow 86.6/120: 72% energy | 1.0/6: 17% combo_points blood_frenzy
1:44.677 envenom Fluffy_Pillow 63.1/120: 53% energy | 4.0/6: 67% combo_points blood_frenzy
1:45.681 Waiting 0.500 sec 39.7/120: 33% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:46.181 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
1:47.183 Waiting 1.462 sec 22.0/120: 18% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
1:48.645 mutilate Fluffy_Pillow 58.0/120: 48% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
1:49.650 Waiting 2.079 sec 13.6/120: 11% energy | 5.0/6: 83% combo_points envenom, elaborate_planning
1:51.729 mutilate Fluffy_Pillow 55.6/120: 46% energy | 5.0/6: 83% combo_points
1:52.734 rupture Fluffy_Pillow 32.1/120: 27% energy | 6.0/6: 100% combo_points blood_frenzy
1:53.739 Waiting 1.447 sec 18.7/120: 16% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
1:55.186 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
1:56.190 Waiting 4.468 sec 21.9/120: 18% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
2:00.658 garrote Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points blood_frenzy
2:01.664 mutilate Fluffy_Pillow 86.6/120: 72% energy | 4.0/6: 67% combo_points horrific_appendages, blood_frenzy
2:02.671 Waiting 0.700 sec 62.3/120: 52% energy | 6.0/6: 100% combo_points horrific_appendages
2:03.371 vanish Fluffy_Pillow 69.7/120: 58% energy | 6.0/6: 100% combo_points horrific_appendages
2:03.523 rupture Fluffy_Pillow 71.3/120: 59% energy | 6.0/6: 100% combo_points vanish, horrific_appendages
2:04.529 mutilate Fluffy_Pillow 67.1/120: 56% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages, blood_frenzy
2:05.533 Waiting 1.000 sec 33.6/120: 28% energy | 3.0/6: 50% combo_points elaborate_planning, horrific_appendages, blood_frenzy
2:06.533 mutilate Fluffy_Pillow 55.1/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning, horrific_appendages, blood_frenzy
2:07.537 Waiting 0.488 sec 21.7/120: 18% energy | 6.0/6: 100% combo_points elaborate_planning, horrific_appendages, blood_frenzy
2:08.025 envenom Fluffy_Pillow 37.3/120: 31% energy | 6.0/6: 100% combo_points elaborate_planning, horrific_appendages, blood_frenzy
2:09.029 Waiting 0.500 sec 23.9/120: 20% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:09.529 vendetta Fluffy_Pillow 29.6/120: 25% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:09.696 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:09.696 mutilate Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:10.700 mutilate Fluffy_Pillow 96.6/120: 80% energy | 4.0/6: 67% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:11.705 envenom Fluffy_Pillow 53.1/120: 44% energy | 6.0/6: 100% combo_points blood_fury, envenom, elaborate_planning, horrific_appendages, blood_frenzy
2:12.709 Waiting 0.500 sec 49.7/120: 41% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
2:13.209 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
2:14.215 Waiting 4.459 sec 22.0/120: 18% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
2:18.674 garrote Fluffy_Pillow 119.3/120: 99% energy | 3.0/6: 50% combo_points blood_fury, envenom
2:19.679 kingsbane Fluffy_Pillow 84.9/120: 71% energy | 4.0/6: 67% combo_points blood_fury, envenom
2:20.683 envenom Fluffy_Pillow 80.5/120: 67% energy | 5.0/6: 83% combo_points blood_fury, envenom
2:21.687 mutilate Fluffy_Pillow 56.1/120: 47% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
2:22.692 Waiting 1.400 sec 31.7/120: 26% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning
2:24.092 mutilate Fluffy_Pillow 56.7/120: 47% energy | 3.0/6: 50% combo_points blood_fury, envenom, elaborate_planning, blood_frenzy
2:25.097 Waiting 0.950 sec 23.3/120: 19% energy | 6.0/6: 100% combo_points envenom, elaborate_planning, blood_frenzy
2:26.047 envenom Fluffy_Pillow 44.2/120: 37% energy | 6.0/6: 100% combo_points envenom, blood_frenzy
2:27.052 Waiting 1.300 sec 30.8/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:28.352 mutilate Fluffy_Pillow 55.7/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:29.358 Waiting 0.733 sec 22.3/120: 19% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, blood_frenzy
2:30.091 envenom Fluffy_Pillow 40.7/120: 34% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, blood_frenzy
2:31.096 Waiting 5.600 sec 27.3/120: 23% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
2:36.696 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
2:37.700 mutilate Fluffy_Pillow 85.6/120: 71% energy | 1.0/6: 17% combo_points
2:38.706 mutilate Fluffy_Pillow 61.2/120: 51% energy | 3.0/6: 50% combo_points
2:39.713 Waiting 0.768 sec 16.9/120: 14% energy | 6.0/6: 100% combo_points
2:40.481 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points
2:41.486 Waiting 1.000 sec 30.6/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning
2:42.486 mutilate Fluffy_Pillow 61.2/120: 51% energy | 0.0/6: 0% combo_points elaborate_planning
2:43.490 Waiting 1.777 sec 16.8/120: 14% energy | 3.0/6: 50% combo_points elaborate_planning
2:45.267 mutilate Fluffy_Pillow 55.6/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning
2:46.271 Waiting 0.462 sec 21.2/120: 18% energy | 6.0/6: 100% combo_points
2:46.733 envenom Fluffy_Pillow 36.0/120: 30% energy | 6.0/6: 100% combo_points
2:47.737 Waiting 6.962 sec 11.7/120: 10% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:54.699 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points
2:55.705 mutilate Fluffy_Pillow 85.6/120: 71% energy | 1.0/6: 17% combo_points
2:56.709 envenom Fluffy_Pillow 61.2/120: 51% energy | 4.0/6: 67% combo_points
2:57.712 Waiting 0.800 sec 36.8/120: 31% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:58.512 mutilate Fluffy_Pillow 65.3/120: 54% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
2:59.517 Waiting 1.387 sec 20.9/120: 17% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:00.904 mutilate Fluffy_Pillow 55.6/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:01.909 Waiting 1.118 sec 12.1/120: 10% energy | 6.0/6: 100% combo_points blood_frenzy
3:03.027 rupture Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points blood_frenzy
3:04.034 Waiting 0.500 sec 41.6/120: 35% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:04.534 mutilate Fluffy_Pillow 57.3/120: 48% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:05.537 Waiting 1.865 sec 13.9/120: 12% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
3:07.402 mutilate Fluffy_Pillow 55.4/120: 46% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
3:08.407 Waiting 0.367 sec 21.9/120: 18% energy | 5.0/6: 83% combo_points blood_frenzy
3:08.774 envenom Fluffy_Pillow 36.1/120: 30% energy | 5.0/6: 83% combo_points blood_frenzy
3:09.779 vendetta Fluffy_Pillow 12.7/120: 11% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:09.779 kingsbane Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:10.784 Waiting 1.900 sec 116.6/120: 97% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:12.684 garrote Fluffy_Pillow 120.0/120: 100% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, horrific_appendages
3:13.689 mutilate Fluffy_Pillow 86.6/120: 72% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:14.693 envenom Fluffy_Pillow 63.1/120: 53% energy | 5.0/6: 83% combo_points envenom, horrific_appendages, blood_frenzy
3:15.696 Waiting 0.500 sec 39.7/120: 33% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:16.196 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:17.203 Waiting 1.059 sec 22.0/120: 18% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:18.262 envenom Fluffy_Pillow 44.2/120: 37% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:19.270 Waiting 1.300 sec 30.8/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:20.570 mutilate Fluffy_Pillow 65.8/120: 55% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages, blood_frenzy
3:21.575 Waiting 1.131 sec 22.3/120: 19% energy | 3.0/6: 50% combo_points envenom, elaborate_planning, blood_frenzy
3:22.706 mutilate Fluffy_Pillow 55.3/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
3:23.710 Waiting 1.330 sec 10.9/120: 9% energy | 5.0/6: 83% combo_points envenom
3:25.040 envenom Fluffy_Pillow 45.0/120: 37% energy | 5.0/6: 83% combo_points
3:26.046 Waiting 4.600 sec 30.6/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
3:30.646 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points envenom
3:31.650 mutilate Fluffy_Pillow 85.6/120: 71% energy | 1.0/6: 17% combo_points
3:32.654 mutilate Fluffy_Pillow 61.2/120: 51% energy | 4.0/6: 67% combo_points
3:33.661 Waiting 0.770 sec 16.9/120: 14% energy | 6.0/6: 100% combo_points
3:34.431 rupture Fluffy_Pillow 35.0/120: 29% energy | 6.0/6: 100% combo_points
3:35.438 Waiting 1.100 sec 30.8/120: 26% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:36.538 mutilate Fluffy_Pillow 63.5/120: 53% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
3:37.543 Waiting 1.329 sec 20.1/120: 17% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy
3:38.872 mutilate Fluffy_Pillow 55.4/120: 46% energy | 2.0/6: 33% combo_points elaborate_planning, blood_frenzy
3:39.877 Waiting 1.136 sec 11.9/120: 10% energy | 6.0/6: 100% combo_points blood_frenzy
3:41.013 envenom Fluffy_Pillow 45.0/120: 37% energy | 6.0/6: 100% combo_points blood_frenzy
3:42.019 Waiting 1.200 sec 31.6/120: 26% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:43.219 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
3:44.223 Waiting 4.465 sec 21.9/120: 18% energy | 2.0/6: 33% combo_points envenom, elaborate_planning, blood_frenzy
3:48.688 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points
3:49.692 mutilate Fluffy_Pillow 85.6/120: 71% energy | 3.0/6: 50% combo_points horrific_appendages
3:50.697 envenom Fluffy_Pillow 61.2/120: 51% energy | 6.0/6: 100% combo_points horrific_appendages
3:51.702 Waiting 0.800 sec 36.8/120: 31% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
3:52.502 mutilate Fluffy_Pillow 65.3/120: 54% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
3:53.506 Waiting 0.787 sec 20.9/120: 17% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, horrific_appendages
3:54.293 envenom Fluffy_Pillow 39.2/120: 33% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, horrific_appendages
3:56.065 kingsbane Fluffy_Pillow 42.9/120: 36% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, horrific_appendages
3:57.070 Waiting 1.500 sec 28.6/120: 24% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, horrific_appendages
3:58.570 mutilate Fluffy_Pillow 64.4/120: 54% energy | 1.0/6: 17% combo_points envenom, elaborate_planning, horrific_appendages
3:59.575 Waiting 1.470 sec 20.0/120: 17% energy | 5.0/6: 83% combo_points envenom, horrific_appendages
4:01.045 mutilate Fluffy_Pillow 55.6/120: 46% energy | 5.0/6: 83% combo_points horrific_appendages
4:02.052 Waiting 0.459 sec 21.2/120: 18% energy | 6.0/6: 100% combo_points horrific_appendages
4:02.511 rupture Fluffy_Pillow 36.1/120: 30% energy | 6.0/6: 100% combo_points horrific_appendages
4:03.516 Waiting 3.115 sec 21.7/120: 18% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages
4:06.631 garrote Fluffy_Pillow 94.6/120: 79% energy | 0.0/6: 0% combo_points elaborate_planning, horrific_appendages
4:07.636 mutilate Fluffy_Pillow 60.2/120: 50% energy | 1.0/6: 17% combo_points horrific_appendages
4:08.640 Waiting 0.900 sec 35.8/120: 30% energy | 3.0/6: 50% combo_points horrific_appendages
4:09.540 vendetta Fluffy_Pillow 45.3/120: 38% energy | 3.0/6: 50% combo_points horrific_appendages
4:09.779 blood_fury Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points horrific_appendages
4:09.779 mutilate Fluffy_Pillow 120.0/120: 100% energy | 3.0/6: 50% combo_points blood_fury, horrific_appendages
4:10.783 mutilate Fluffy_Pillow 95.6/120: 80% energy | 5.0/6: 83% combo_points blood_fury, horrific_appendages
4:11.785 vanish Fluffy_Pillow 51.2/120: 43% energy | 6.0/6: 100% combo_points blood_fury, horrific_appendages
4:11.785 rupture Fluffy_Pillow 51.2/120: 43% energy | 6.0/6: 100% combo_points blood_fury, vanish, horrific_appendages
4:12.790 mutilate Fluffy_Pillow 56.8/120: 47% energy | 0.0/6: 0% combo_points blood_fury, elaborate_planning
4:13.795 Waiting 2.189 sec 12.4/120: 10% energy | 2.0/6: 33% combo_points blood_fury, elaborate_planning
4:15.984 mutilate Fluffy_Pillow 55.6/120: 46% energy | 2.0/6: 33% combo_points blood_fury, elaborate_planning
4:16.989 Waiting 0.400 sec 31.2/120: 26% energy | 5.0/6: 83% combo_points blood_fury
4:17.389 envenom Fluffy_Pillow 35.4/120: 30% energy | 5.0/6: 83% combo_points blood_fury
4:18.394 Waiting 6.276 sec 21.0/120: 18% energy | 0.0/6: 0% combo_points blood_fury, envenom, elaborate_planning
4:24.670 garrote Fluffy_Pillow 120.0/120: 100% energy | 0.0/6: 0% combo_points blood_fury, blood_frenzy
4:25.674 mutilate Fluffy_Pillow 86.6/120: 72% energy | 1.0/6: 17% combo_points blood_frenzy
4:26.679 envenom Fluffy_Pillow 63.1/120: 53% energy | 5.0/6: 83% combo_points blood_frenzy
4:27.684 Waiting 0.500 sec 39.7/120: 33% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:28.184 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:29.189 Waiting 1.059 sec 22.0/120: 18% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, blood_frenzy
4:30.248 envenom Fluffy_Pillow 44.2/120: 37% energy | 4.0/6: 67% combo_points envenom, elaborate_planning, blood_frenzy
4:31.253 Waiting 1.300 sec 30.5/120: 25% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:32.553 mutilate Fluffy_Pillow 64.3/120: 54% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:33.556 Waiting 1.484 sec 19.9/120: 17% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:35.040 mutilate Fluffy_Pillow 55.6/120: 46% energy | 3.0/6: 50% combo_points envenom, elaborate_planning
4:36.046 Waiting 0.460 sec 21.2/120: 18% energy | 6.0/6: 100% combo_points envenom
4:36.506 envenom Fluffy_Pillow 36.0/120: 30% energy | 6.0/6: 100% combo_points envenom
4:37.511 Waiting 3.362 sec 11.7/120: 10% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:40.873 kingsbane Fluffy_Pillow 87.2/120: 73% energy | 0.0/6: 0% combo_points envenom, elaborate_planning
4:42.070 Waiting 0.600 sec 74.8/120: 62% energy | 1.0/6: 17% combo_points envenom
4:42.670 garrote Fluffy_Pillow 91.2/120: 76% energy | 1.0/6: 17% combo_points envenom
4:43.673 mutilate Fluffy_Pillow 56.8/120: 47% energy | 2.0/6: 33% combo_points envenom
4:44.677 rupture Fluffy_Pillow 33.1/120: 28% energy | 6.0/6: 100% combo_points blood_frenzy
4:45.681 Waiting 1.367 sec 19.6/120: 16% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
4:47.048 mutilate Fluffy_Pillow 55.4/120: 46% energy | 0.0/6: 0% combo_points elaborate_planning, blood_frenzy
4:48.051 Waiting 1.969 sec 21.9/120: 18% energy | 3.0/6: 50% combo_points elaborate_planning, blood_frenzy
4:50.020 mutilate Fluffy_Pillow 64.6/120: 54% energy | 3.0/6: 50% combo_points blood_frenzy
4:51.023 Waiting 0.400 sec 31.1/120: 26% energy | 6.0/6: 100% combo_points blood_frenzy
4:51.423 envenom Fluffy_Pillow 35.7/120: 30% energy | 6.0/6: 100% combo_points blood_frenzy
4:52.428 Waiting 1.636 sec 22.3/120: 19% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:54.064 mutilate Fluffy_Pillow 61.1/120: 51% energy | 0.0/6: 0% combo_points envenom, elaborate_planning, blood_frenzy
4:55.068 Waiting 5.600 sec 27.3/120: 23% energy | 2.0/6: 33% combo_points envenom, elaborate_planning
5:00.668 garrote Fluffy_Pillow 120.0/120: 100% energy | 2.0/6: 33% combo_points

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8809 8484 0
Agility 27853 26146 15875 (11258)
Stamina 40528 40528 24916
Intellect 5322 4997 0
Spirit 2 2 0
Health 2431680 2431680 0
Energy 120 120 0
Combo Points 6 6 0
Crit 40.31% 40.31% 8859
Haste 5.66% 5.66% 1839
Damage / Heal Versatility 7.68% 6.74% 2696
Attack Power 27853 26146 0
Mastery 96.88% 96.88% 5677
Armor 2244 2244 2244
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 880.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Soultrapper's Pendant
ilevel: 860, stats: { +1201 Sta, +1144 Crit, +762 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +1012 Crit, +448 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Zoldyck Family Training Shackles
ilevel: 895, stats: { 167 Armor, +1665 Sta, +1110 Agi, +620 Mastery, +248 Haste }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Dingy Suramar Mercantile Signet
ilevel: 860, stats: { +1201 Sta, +1362 Crit, +545 Vers }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand The Kingslayers
ilevel: 894, weapon: { 3437 - 6384, 1.8 }, stats: { +838 Agi, +1257 Sta, +335 Crit, +321 Mastery }, relics: { +48 ilevels, +48 ilevels, +48 ilevels }
Local Off Hand The Kingslayers
ilevel: 894, weapon: { 3437 - 6384, 1.8 }, stats: { +838 Agi, +1257 Sta, +335 Crit, +321 Mastery }

Talents

Level
15 Master Poisoner (Assassination Rogue) Elaborate Planning Hemorrhage (Assassination Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Leeching Poison (Assassination Rogue) Elusiveness Cheat Death
75 Thuggee (Assassination Rogue) Prey on the Weak Internal Bleeding (Assassination Rogue)
90 Agonizing Poison (Assassination Rogue) Alacrity Exsanguinate
100 Venom Rush (Assassination Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Assassination_T19M"
level=110
race=orc
role=attack
position=back
talents=2110111
artifact=43:0:0:0:0:323:3:324:3:325:3:326:3:327:3:328:3:329:3:330:3:331:3:332:1:333:1:334:1:335:1:337:1:346:1:347:1:1276:1
spec=assassination

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/apply_poison
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40

# Executed every time the actor is available.
actions=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|debuff.vendetta.up
actions+=/blood_fury,if=debuff.vendetta.up
actions+=/berserking,if=debuff.vendetta.up
actions+=/arcane_torrent,if=debuff.vendetta.up&energy.deficit>50
actions+=/call_action_list,name=cds
actions+=/rupture,if=talent.exsanguinate.enabled&combo_points>=2+artifact.urge_to_kill.enabled*2&!ticking&(artifact.urge_to_kill.enabled|time<10)
actions+=/pool_resource,for_next=1
actions+=/kingsbane,if=(!talent.exsanguinate.enabled&(debuff.vendetta.up|cooldown.vendetta.remains>10))|(talent.exsanguinate.enabled&dot.rupture.exsanguinated)
actions+=/run_action_list,name=exsang_combo,if=talent.exsanguinate.enabled&cooldown.exsanguinate.remains<3&(debuff.vendetta.up|cooldown.vendetta.remains>25)
actions+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions+=/call_action_list,name=exsang,if=dot.rupture.exsanguinated
actions+=/rupture,if=talent.exsanguinate.enabled&remains-cooldown.exsanguinate.remains<(4+cp_max_spend*4)*0.3&new_duration-cooldown.exsanguinate.remains>=(4+cp_max_spend*4)*0.3+3
actions+=/call_action_list,name=finish_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=finish_noex,if=!talent.exsanguinate.enabled
actions+=/call_action_list,name=build_ex,if=talent.exsanguinate.enabled
actions+=/call_action_list,name=build_noex,if=!talent.exsanguinate.enabled

actions.build_ex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_ex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_ex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_ex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_ex+=/hemorrhage,if=(combo_points.deficit>=1&refreshable)|(combo_points.deficit=1&((dot.rupture.exsanguinated&dot.rupture.remains<=2)|cooldown.exsanguinate.remains<=2))
actions.build_ex+=/mutilate,if=combo_points.deficit<=1&energy.deficit<=30
actions.build_ex+=/mutilate,if=combo_points.deficit>=2&cooldown.garrote.remains>2

actions.build_noex=hemorrhage,cycle_targets=1,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives<=4
actions.build_noex+=/hemorrhage,cycle_targets=1,max_cycle_targets=3,if=combo_points.deficit>=1&refreshable&dot.rupture.remains>6&spell_targets.fan_of_knives>1&spell_targets.fan_of_knives=5
actions.build_noex+=/fan_of_knives,if=(spell_targets>=2+debuff.vendetta.up&(combo_points.deficit>=1|energy.deficit<=30))|(!artifact.bag_of_tricks.enabled&spell_targets>=7+2*debuff.vendetta.up)
actions.build_noex+=/fan_of_knives,if=(debuff.vendetta.up&buff.the_dreadlords_deceit.stack>=29-(debuff.vendetta.remains<=3)*14)|(cooldown.vendetta.remains>60&cooldown.vendetta.remains<65&buff.the_dreadlords_deceit.stack>=5)
actions.build_noex+=/hemorrhage,if=combo_points.deficit>=1&refreshable
actions.build_noex+=/mutilate,if=combo_points.deficit>=1&cooldown.garrote.remains>2

actions.cds=marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|combo_points.deficit>=5
actions.cds+=/vendetta,if=target.time_to_die<20
actions.cds+=/vendetta,if=dot.rupture.ticking&(!talent.exsanguinate.enabled|cooldown.exsanguinate.remains<1+4*!artifact.urge_to_kill.enabled)&(energy<55|time<10|spell_targets.fan_of_knives>=2|!artifact.urge_to_kill.enabled)
actions.cds+=/vanish,if=!dot.rupture.exsanguinated&((talent.subterfuge.enabled&combo_points<=2)|(talent.shadow_focus.enabled&combo_points.deficit>=2))
actions.cds+=/vanish,if=!talent.exsanguinate.enabled&talent.nightstalker.enabled&combo_points>=cp_max_spend&gcd.remains=0&energy>=25

actions.exsang=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die>6
actions.exsang+=/rupture,if=combo_points>=cp_max_spend&ticks_remain<2
actions.exsang+=/death_from_above,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)
actions.exsang+=/envenom,if=combo_points>=cp_max_spend-1&(dot.rupture.remains>3|(dot.rupture.remains>2&spell_targets.fan_of_knives>=3))&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6+2*debuff.vendetta.up)

actions.exsang_combo=vanish,if=talent.nightstalker.enabled&combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&gcd.remains=0&energy>=25
actions.exsang_combo+=/rupture,if=combo_points>=cp_max_spend&cooldown.exsanguinate.remains<1&(!talent.nightstalker.enabled|buff.vanish.up|cooldown.vanish.remains>15)
actions.exsang_combo+=/exsanguinate,if=prev_gcd.rupture&dot.rupture.remains>22+4*talent.deeper_stratagem.enabled&cooldown.vanish.remains>10
actions.exsang_combo+=/call_action_list,name=garrote,if=spell_targets.fan_of_knives<=8-artifact.bag_of_tricks.enabled
actions.exsang_combo+=/hemorrhage,if=spell_targets.fan_of_knives>=2&!ticking
actions.exsang_combo+=/call_action_list,name=build_ex

actions.finish_ex=rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend-1&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_ex+=/rupture,if=combo_points>=cp_max_spend-1&refreshable&!exsanguinated
actions.finish_ex+=/death_from_above,if=combo_points>=cp_max_spend-1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend-1&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&energy.deficit<40&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_ex+=/envenom,if=combo_points>=cp_max_spend&!dot.rupture.refreshable&buff.elaborate_planning.remains<2&cooldown.garrote.remains<1&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)

actions.finish_noex=variable,name=envenom_condition,value=!(dot.rupture.refreshable&dot.rupture.pmultiplier<1.5)&(!talent.nightstalker.enabled|cooldown.vanish.remains>=6)&dot.rupture.remains>=6&buff.elaborate_planning.remains<1.5&(artifact.bag_of_tricks.enabled|spell_targets.fan_of_knives<=6)
actions.finish_noex+=/rupture,cycle_targets=1,max_cycle_targets=14-2*artifact.bag_of_tricks.enabled,if=!ticking&combo_points>=cp_max_spend&spell_targets.fan_of_knives>1&target.time_to_die-remains>6
actions.finish_noex+=/rupture,if=combo_points>=cp_max_spend&((dot.rupture.refreshable|dot.rupture.ticks_remain<=1)|(talent.nightstalker.enabled&buff.vanish.up))
actions.finish_noex+=/death_from_above,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)
actions.finish_noex+=/envenom,if=variable.envenom_condition&(combo_points>=cp_max_spend-2*talent.elaborate_planning.enabled)&(refreshable|(talent.elaborate_planning.enabled&!buff.elaborate_planning.up)|cooldown.garrote.remains<1)

actions.garrote=pool_resource,for_next=1
actions.garrote+=/garrote,cycle_targets=1,if=talent.subterfuge.enabled&!ticking&combo_points.deficit>=1&spell_targets.fan_of_knives>=2
actions.garrote+=/pool_resource,for_next=1
actions.garrote+=/garrote,if=combo_points.deficit>=1&!exsanguinated&refreshable

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=soultrappers_pendant,id=141506,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=grove_keepers_robe,id=139207,bonus_id=1806
wrists=zoldyck_family_training_shackles,id=137098
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=dingy_suramar_mercantile_signet,id=141492,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=spontaneous_appendages,id=139325,bonus_id=1806
main_hand=the_kingslayers,id=128870,bonus_id=741,gem_id=137549/137543/136718,relic_id=1517:1727/1517:1727/1517:1727
off_hand=the_kingslayers,id=128869

# Gear Summary
# gear_ilvl=880.19
# gear_agility=15875
# gear_stamina=24916
# gear_crit_rating=8859
# gear_haste_rating=1839
# gear_mastery_rating=5677
# gear_versatility_rating=2696
# gear_armor=2244

Rogue_Outlaw_T19M : 473446 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
473446.3 473446.3 869.2 / 0.184% 151469.0 / 32.0% 15089.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
31.3 31.3 Energy 9.93% 65.0 100.0% 100%
Talents
  • 15: Quick Draw (Outlaw Rogue)
  • 30: Hit and Run (Outlaw Rogue)
  • 45: Deeper Stratagem
  • 90: Alacrity
  • 100: Marked for Death
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Outlaw_T19M 473446
Ambush 3232 0.7% 5.4 52.22sec 179707 178914 Direct 5.4 124031 248061 179706 44.9% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 5.40 0.00 0.00 1.0045 0.0000 970429.13 1426622.75 31.98 178913.93 178913.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.98 55.11% 124030.61 124031 124031 119614.53 0 124031 369115 542634 30.84
crit 2.42 44.89% 248061.22 248061 248061 233374.04 0 248061 601314 883989 30.08
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=2} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
auto_attack_mh 25471 5.4% 204.3 1.47sec 37464 26039 Direct 204.3 29364 58728 37464 46.5% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 204.27 204.27 0.00 0.00 1.4388 0.0000 7652781.53 11250313.75 31.98 26038.99 26038.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.45 34.49% 29364.14 29364 29364 29364.14 29364 29364 2068560 3040979 31.98
crit 95.09 46.55% 58728.27 58728 58728 58728.27 58728 58728 5584221 8209334 31.98
miss 38.74 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 12482 2.6% 200.3 1.50sec 18721 12724 Direct 200.3 14682 29364 18721 46.5% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.31 200.31 0.00 0.00 1.4713 0.0000 3750086.70 5512982.66 31.98 12724.32 12724.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.09 34.49% 14682.07 14682 14682 14682.07 14682 14682 1014327 1491157 31.98
crit 93.17 46.51% 29364.14 29364 29364 29364.14 29364 29364 2735759 4021825 31.98
miss 38.06 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Between the Eyes 40242 8.5% 25.1 12.01sec 482398 528301 Direct 25.1 204317 817533 482386 45.3% 0.0%  

Stats details: between_the_eyes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.05 25.05 0.00 0.00 0.9132 0.0000 12085939.56 17767475.97 31.98 528300.89 528300.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.69 54.65% 204316.55 173946 208735 204152.72 173946 208735 2797608 4112749 31.98
crit 11.36 45.35% 817532.92 695785 834942 816897.87 695785 834942 9288331 13654727 31.98
 
 

Action details: between_the_eyes

Static Values
  • id:199804
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.greenskins_waterlogged_wristcuffs&!buff.greenskins_waterlogged_wristcuffs.up
Spelldata
  • id:199804
  • name:Between the Eyes
  • school:physical
  • tooltip:Stunned.
  • description:Finishing move that deals damage with your pistol and stuns the target. Critical strikes with this ability deal four times normal damage: 1 point : ${$m1*1} damage, 1 sec 2 points: ${$m1*2} damage, 2 sec 3 points: ${$m1*3} damage, 3 sec 4 points: ${$m1*4} damage, 4 sec 5 points: ${$m1*5} damage, 5 sec{$?s193531=false}[ 6 points: ${$m1*6} damage, 6 sec][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.850000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Greed 11050 (16580) 2.3% (3.5%) 23.4 12.59sec 212519 0 Direct 23.4 96468 192937 141642 46.8% 0.0%  

Stats details: greed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.44 23.44 0.00 0.00 0.0000 0.0000 3319696.56 4880268.39 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.46 53.17% 96468.25 96468 96468 96468.25 96468 96468 1202180 1767319 31.98
crit 10.98 46.83% 192936.51 192937 192937 192936.51 192937 192937 2117516 3112949 31.98
 
 

Action details: greed

Static Values
  • id:202822
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202822
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
    Greed (_oh) 5530 1.2% 23.4 12.59sec 70884 0 Direct 23.4 48234 96468 70883 47.0% 0.0%  

Stats details: greed_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.43 23.43 0.00 0.00 0.0000 0.0000 1661147.56 2442044.26 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.43 53.04% 48234.13 48234 48234 48234.13 48234 48234 599572 881428 31.98
crit 11.00 46.96% 96468.25 96468 96468 96468.25 96468 96468 1061575 1560616 31.98
 
 

Action details: greed_oh

Static Values
  • id:202823
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202823
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Main Gauche 37666 8.0% 205.2 1.47sec 55126 0 Direct 205.2 37625 75249 55126 46.5% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 205.25 205.25 0.00 0.00 0.0000 0.0000 11314617.83 16633559.96 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.78 53.48% 37624.66 37625 37625 37624.66 37625 37625 4130269 6071886 31.98
crit 95.47 46.52% 75249.33 75249 75249 75249.33 75249 75249 7184349 10561673 31.98
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Mark of the Hidden Satyr 5448 1.2% 20.5 14.61sec 79947 0 Direct 20.5 54501 109001 79947 46.7% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.47 20.47 0.00 0.00 0.0000 0.0000 1636134.09 1636134.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.91 53.31% 54500.74 54501 54501 54500.74 54501 54501 594595 594595 0.00
crit 9.56 46.69% 109001.47 109001 109001 109001.48 109001 109001 1041539 1041539 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Pistol Shot 34950 (100716) 7.4% (21.3%) 28.4 9.89sec 1066339 683328 Direct 28.4 231823 447575 370631 64.3% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.37 28.37 0.00 0.00 1.5605 0.0000 10515608.03 15458939.87 31.98 683328.10 683328.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.12 35.67% 231823.44 78039 390197 232155.36 0 390197 2345888 3448677 31.97
crit 18.25 64.33% 447574.64 156079 780395 452332.32 156079 780395 8169720 12010262 31.98
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&(energy.time_to_max>2-talent.quick_draw.enabled|(buff.blunderbuss.up&buff.greenskins_waterlogged_wristcuffs.up))
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$s1=0} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
    Blunderbuss 65766 13.9% 18.7 15.31sec 1052968 0 Direct 75.0 162626 318401 263262 64.6% 0.0%  

Stats details: blunderbuss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.75 74.97 0.00 0.00 0.0000 0.0000 19738060.35 29016818.36 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.54 35.40% 162626.14 28614 286145 162724.23 45783 286145 4315672 6344447 31.98
crit 48.43 64.60% 318401.31 57229 572289 319107.76 118035 531412 15422388 22672371 31.98
 
 

Action details: blunderbuss

Static Values
  • id:202895
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202895
  • name:Blunderbuss
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draws a concealed blunderbuss and fires a quick shot at the target, dealing ${$m1*7} damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Potion of the Old War 17688 3.7% 28.0 4.17sec 187121 0 Direct 28.0 127246 254493 187122 47.1% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.96 27.96 0.00 0.00 0.0000 0.0000 5231488.47 7690783.59 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.80 52.95% 127246.32 127246 127246 127246.32 127246 127246 1883548 2768993 31.98
crit 13.16 47.05% 254492.65 254493 254493 254492.65 254493 254493 3347941 4921790 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Run Through 121932 25.8% 67.0 4.45sec 546809 596567 Direct 67.0 372174 744609 546815 46.9% 0.0%  

Stats details: run_through

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.99 66.99 0.00 0.00 0.9166 0.0000 36629193.51 53848384.08 31.98 596566.67 596566.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.58 53.11% 372173.86 320135 384162 372479.32 352149 384162 13240801 19465232 31.98
crit 31.41 46.89% 744608.69 640271 768325 745335.85 698477 768325 23388393 34383153 31.98
 
 

Action details: run_through

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Run Through
  • school:physical
  • tooltip:Rooted.
  • description:Lunging finishing move that causes damage per combo point and has increased range: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
 
Saber Slash 91990 19.4% 197.0 1.53sec 140243 218903 Direct 197.0 95724 191448 140243 46.5% 0.0%  

Stats details: saber_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 197.03 197.03 0.00 0.00 0.6407 0.0000 27632318.32 40622125.33 31.98 218902.79 218902.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.40 53.49% 95724.07 95724 95724 95724.07 95724 95724 10089143 14831996 31.98
crit 91.63 46.51% 191448.14 191448 191448 191448.14 191448 191448 17543175 25790129 31.98
 
 

Action details: saber_slash

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.ss_useable
Spelldata
  • id:193315
  • name:Saber Slash
  • school:physical
  • tooltip:
  • description:Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.02
 
Simple Action Stats Execute Interval
Rogue_Outlaw_T19M
Adrenaline Rush 6.5 46.63sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:155.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.adrenaline_rush.up&energy.deficit>0
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:false
  • if_expr:
 
Curse of the Dreadblades 3.9 86.97sec

Stats details: curse_of_the_dreadblades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: curse_of_the_dreadblades

Static Values
  • id:202665
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
Spelldata
  • id:202665
  • name:Curse of the Dreadblades
  • school:shadow
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Outlaw_T19M
  • harmful:false
  • if_expr:
 
Marked for Death 15.1 18.83sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:raid_event.adds.in>40
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=5} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 12.3 24.87sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.30 0.00 0.00 0.00 0.8711 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.slice_and_dice.enabled
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Shadowmeld 2.4 138.55sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.40 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.stealth_condition
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Vanish 5.4 52.22sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:variable.stealth_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 6.5 0.0 46.9sec 46.9sec 31.83% 30.37% 0.0(0.0) 6.2

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:31.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 103.3 0.0sec 2.9sec 100.00% 100.00% 87.2(101.1) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_alacrity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • alacrity_1:0.34%
  • alacrity_2:0.44%
  • alacrity_3:0.46%
  • alacrity_4:0.45%
  • alacrity_5:0.42%
  • alacrity_6:0.41%
  • alacrity_7:0.43%
  • alacrity_8:0.45%
  • alacrity_9:0.48%
  • alacrity_10:0.59%
  • alacrity_11:0.75%
  • alacrity_12:0.90%
  • alacrity_13:0.97%
  • alacrity_14:0.96%
  • alacrity_15:0.92%
  • alacrity_16:0.93%
  • alacrity_17:0.95%
  • alacrity_18:0.99%
  • alacrity_19:0.98%
  • alacrity_20:87.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=1}% for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blood Frenzy 10.6 6.6 28.5sec 17.1sec 44.92% 44.92% 6.6(6.6) 10.2

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:44.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 21.14% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blunderbuss 19.0 1.0 15.2sec 14.5sec 10.04% 39.85% 1.0(1.0) 0.2

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_blunderbuss
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:33.00%
  • default_value:-0.00

Stack Uptimes

  • blunderbuss_1:10.04%

Trigger Attempt Success

  • trigger_pct:33.07%

Spelldata details

  • id:202848
  • name:Blunderbuss
  • tooltip:
  • description:{$@spelldesc202897=When Saber Slash strikes an additional time, there is a {$s2=33}% chance that your next Pistol Shot will be replaced with Blunderbuss. |Tinterface\icons\inv_weapon_rifle_07.blp:24|t |cFFFFFFFFBlunderbuss|r {$@spelldesc202895=Draws a concealed blunderbuss and fires a quick shot at the target, dealing ${$m1*7} damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r}}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Blurred Time 6.5 0.0 46.9sec 46.9sec 31.83% 34.36% 0.0(0.0) 6.2

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_blurred_time
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • blurred_time_1:31.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202776
  • name:Blurred Time
  • tooltip:Ability cooldowns are recovering {$s1=15}% faster.
  • description:{$@spelldesc202769=During Adrenaline Rush, your ability cooldowns recover {$202776s1=15}% faster.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Broadsides 3.1 0.0 66.8sec 65.6sec 28.04% 25.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_broadsides
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • broadsides_1:28.04%

Trigger Attempt Success

  • trigger_pct:96.25%

Spelldata details

  • id:193356
  • name:Broadsides
  • tooltip:Your attacks generate {$s1=1} additional combo point.
  • description:Your combo-generating abilities generate {$s1=1} additional combo point for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 3.1 0.0 67.0sec 65.6sec 28.31% 26.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • buried_treasure_1:28.31%

Trigger Attempt Success

  • trigger_pct:96.37%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by {$s1=25}%.
  • description:Your base Energy regeneration is increased by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Curse of the Dreadblades 3.9 0.0 86.7sec 87.0sec 15.42% 13.57% 0.0(0.0) 3.8

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_curse_of_the_dreadblades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • curse_of_the_dreadblades_1:15.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202665
  • name:Curse of the Dreadblades
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:101.00%
Grand Melee 3.1 0.0 67.4sec 65.9sec 28.49% 27.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.67

Stack Uptimes

  • grand_melee_1:28.49%

Trigger Attempt Success

  • trigger_pct:96.39%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=50}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=50}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Greenskin's Waterlogged Wristcuffs 25.1 0.0 12.0sec 12.0sec 37.68% 51.01% 0.0(0.0) 0.9

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_greenskins_waterlogged_wristcuffs
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • greenskins_waterlogged_wristcuffs_1:37.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209423
  • name:Greenskin's Waterlogged Wristcuffs
  • tooltip:Your next Pistol Shot is free and deals$s2% increased damage.
  • description:{$@spelldesc209420=Between the Eyes has a {$s1=20}% chance per Combo Point to increase the damage of your next Pistol Shot by {$209423s1=400}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Hidden Blade 5.4 0.0 52.5sec 52.5sec 2.82% 4.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_hidden_blade
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hidden_blade_1:2.82%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:202754
  • name:Hidden Blade
  • tooltip:Your next Saber Slash has 100% chance to strike a second time.
  • description:{$@spelldesc202753=Successfully using Ambush guarantees your next Saber Slash will strike an additional time.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Jolly Roger 3.1 0.0 66.4sec 64.8sec 28.15% 27.07% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_jolly_roger
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • jolly_roger_1:28.15%

Trigger Attempt Success

  • trigger_pct:96.61%

Spelldata details

  • id:199603
  • name:Jolly Roger
  • tooltip:Saber Slash has an additional {$s1=25}% chance of striking an additional time.
  • description:Causes Saber Slash to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Opportunity 47.5 9.5 6.3sec 5.2sec 34.54% 100.00% 9.5(9.5) 0.1

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • opportunity_1:34.54%

Trigger Attempt Success

  • trigger_pct:41.85%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot is free.
  • description:{$@spelldesc193315=Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 86.5sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Roll the Bones 2.1 10.2 124.2sec 24.8sec 99.63% 99.63% 10.2(10.2) 1.1

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roll_the_bones_1:99.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 2.4 0.0 138.7sec 138.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Shark Infested Waters 3.1 0.0 69.1sec 67.1sec 30.74% 45.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_shark_infested_waters
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shark_infested_waters_1:30.74%

Trigger Attempt Success

  • trigger_pct:96.69%

Spelldata details

  • id:193357
  • name:Shark Infested Waters
  • tooltip:Critical Strike chance increased by {$s1=25}%.
  • description:Increases Critical Strike chance by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Stealth 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
True Bearing 3.1 0.0 76.4sec 75.9sec 43.74% 46.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • true_bearing_1:43.74%

Trigger Attempt Success

  • trigger_pct:98.17%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishers reduce the remaining cooldown on many of your abilities by {$s1=2} sec per combo point.
  • description:For the duration of Roll the Bones, each time you use a finishing move, you reduce the remaining cooldown on Adrenaline Rush, Sprint, Between the Eyes, Vanish, Blind, Cloak of Shadows, Riposte, Grappling Hook, Cannonball Barrage, Killing Spree, Marked for Death, and Death from Above by {$s1=2} sec per combo point spent.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 5.4 0.0 52.5sec 52.5sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Outlaw_T19M
ambush Energy 5.4 324.0 60.0 60.0 2995.3
between_the_eyes Energy 25.1 576.2 23.0 23.0 20975.6
between_the_eyes Combo Points 25.1 147.2 5.9 5.9 82133.4
roll_the_bones Energy 12.3 146.9 11.9 11.9 0.0
roll_the_bones Combo Points 12.3 68.7 5.6 5.6 0.0
run_through Energy 67.0 1540.7 23.0 23.0 23774.2
run_through Combo Points 67.0 389.4 5.8 5.8 94054.6
saber_slash Energy 197.0 6831.7 34.7 34.7 4044.7
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 15.08 72.78 (11.96%) 4.83 2.60 3.45%
pistol_shot Combo Points 28.37 28.37 (4.66%) 1.00 0.00 0.00%
blunderbuss Combo Points 18.75 18.75 (3.08%) 1.00 0.00 0.00%
saber_slash Combo Points 197.03 179.59 (29.52%) 0.91 17.44 8.85%
adrenaline_rush Energy 310.46 1466.02 (15.66%) 4.72 282.85 16.17%
ambush Combo Points 5.40 10.80 (1.77%) 2.00 0.00 0.00%
energy_regen Energy 1030.15 5241.42 (55.99%) 5.09 249.38 4.54%
combat_potency Energy 152.00 2654.49 (28.35%) 17.46 81.47 2.98%
Quick Draw Combo Points 47.12 40.31 (6.63%) 0.86 6.80 14.44%
Broadsides Combo Points 62.73 53.69 (8.82%) 0.86 9.04 14.41%
Ruthlessness Combo Points 104.34 121.05 (19.90%) 1.16 0.00 0.00%
Curse of the Dreadblades Combo Points 24.99 83.10 (13.66%) 3.33 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 31.14 31.33
Combo Points 2.02 2.01
Combat End Resource Mean Min Max
Energy 42.32 0.03 100.00
Combo Points 3.17 1.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 2.4%

Procs

Count Interval
Roll the Bones: 1 buff 7.3 35.4sec
Roll the Bones: 2 buffs 4.4 62.4sec
Roll the Bones: 3 buffs 0.5 113.0sec
Roll the Bones: 6 buffs 0.2 107.8sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Outlaw_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Rogue_Outlaw_T19M Damage Per Second
Count 7499
Mean 473446.25
Minimum 361731.06
Maximum 668324.21
Spread ( max - min ) 306593.15
Range [ ( max - min ) / 2 * 100% ] 32.38%
Standard Deviation 38402.8896
5th Percentile 417349.55
95th Percentile 542299.62
( 95th Percentile - 5th Percentile ) 124950.07
Mean Distribution
Standard Deviation 443.4679
95.00% Confidence Intervall ( 472577.07 - 474315.44 )
Normalized 95.00% Confidence Intervall ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 252
0.1% Error 25274
0.1 Scale Factor Error with Delta=300 12589586
0.05 Scale Factor Error with Delta=300 50358347
0.01 Scale Factor Error with Delta=300 1258958679
Priority Target DPS
Sample Data Rogue_Outlaw_T19M Priority Target Damage Per Second
Count 7499
Mean 473446.25
Minimum 361731.06
Maximum 668324.21
Spread ( max - min ) 306593.15
Range [ ( max - min ) / 2 * 100% ] 32.38%
Standard Deviation 38402.8896
5th Percentile 417349.55
95th Percentile 542299.62
( 95th Percentile - 5th Percentile ) 124950.07
Mean Distribution
Standard Deviation 443.4679
95.00% Confidence Intervall ( 472577.07 - 474315.44 )
Normalized 95.00% Confidence Intervall ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 252
0.1% Error 25274
0.1 Scale Factor Error with Delta=300 12589586
0.05 Scale Factor Error with Delta=300 50358347
0.01 Scale Factor Error with Delta=300 1258958679
DPS(e)
Sample Data Rogue_Outlaw_T19M Damage Per Second (Effective)
Count 7499
Mean 473446.25
Minimum 361731.06
Maximum 668324.21
Spread ( max - min ) 306593.15
Range [ ( max - min ) / 2 * 100% ] 32.38%
Damage
Sample Data Rogue_Outlaw_T19M Damage
Count 7499
Mean 142137501.64
Minimum 90091776.74
Maximum 217432726.12
Spread ( max - min ) 127340949.38
Range [ ( max - min ) / 2 * 100% ] 44.79%
DTPS
Sample Data Rogue_Outlaw_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Outlaw_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Outlaw_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Outlaw_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Outlaw_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Outlaw_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Outlaw_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Outlaw_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 roll_the_bones,if=!talent.slice_and_dice.enabled
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
0.00 variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
0.00 variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
8 0.00 call_action_list,name=bf
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
0.00 death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
0.00 slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
B 11.30 roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
0.00 killing_spree,if=energy.time_to_max>5|energy<15
C 0.00 call_action_list,name=build
D 0.00 call_action_list,name=finish,if=!variable.ss_useable
0.00 gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1
actions.build
# count action,conditions
0.00 ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
E 47.12 pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&(energy.time_to_max>2-talent.quick_draw.enabled|(buff.blunderbuss.up&buff.greenskins_waterlogged_wristcuffs.up))
F 136.63 saber_slash,if=variable.ss_useable
actions.cds
# count action,conditions
G 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=energy.deficit>40
0.00 cannonball_barrage,if=spell_targets.cannonball_barrage>=1
H 6.48 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
I 14.08 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
0.00 sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
J 3.95 curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
actions.finish
# count action,conditions
K 25.05 between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&!buff.greenskins_waterlogged_wristcuffs.up
L 66.99 run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5
actions.stealth
# count action,conditions
0.00 variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
M 5.40 ambush
N 5.40 vanish,if=variable.stealth_condition
O 2.40 shadowmeld,if=variable.stealth_condition

Sample Sequence

0124567JFHBFBFKFLFLELFLFLNMFELOFFEBFFEKFEFLIKFFFFFLEFFKEFFLIKEFNMLHFFGFFKFFFFFLILFEFBFKEFLFFLJFLFLFLFKFLEFLFFLFFBIKEFLFLEFLFFLFLEFLEFKEFLELFLFELFLEFLFBEFKFFLHFFLNMFLFOFLFFLILJFLFKELFLFLELFLFFBFFFFFKFFELFFFFFLFFFELFFFEKFEFLFFFBFEBIBFFFBFFFBEFBFFBFEBFEKFELFELFFFFLJELFKELFLELFLFELFELFELFIKFEBNMF

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Outlaw_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Outlaw_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Outlaw_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
Pre marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points stealth, potion_of_the_old_war
Pre roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:00.000 curse_of_the_dreadblades Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points stealth, alacrity, roll_the_bones, potion_of_the_old_war
0:00.000 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, alacrity, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:01.004 adrenaline_rush Fluffy_Pillow 69.0/100: 69% energy | 6.0/6: 100% combo_points bloodlust, alacrity, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:01.004 roll_the_bones Fluffy_Pillow 69.0/100: 69% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:01.809 saber_slash Fluffy_Pillow 87.2/100: 87% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, alacrity(3), broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:02.613 roll_the_bones Fluffy_Pillow 68.3/100: 68% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity(3), broadsides, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:03.417 saber_slash Fluffy_Pillow 86.7/100: 87% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, alacrity(4), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:04.222 between_the_eyes Fluffy_Pillow 86.2/100: 86% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity(4), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:05.027 saber_slash Fluffy_Pillow 94.9/100: 95% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(5), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:05.830 run_through Fluffy_Pillow 76.6/100: 77% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(5), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:06.633 saber_slash Fluffy_Pillow 85.6/100: 86% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(6), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:07.436 run_through Fluffy_Pillow 67.6/100: 68% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, greenskins_waterlogged_wristcuffs, alacrity(6), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, blood_frenzy, potion_of_the_old_war
0:08.242 pistol_shot Fluffy_Pillow 77.0/100: 77% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, greenskins_waterlogged_wristcuffs, alacrity(7), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss, blood_frenzy, potion_of_the_old_war
0:09.047 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity(7), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:09.851 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, alacrity(8), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, blood_frenzy, potion_of_the_old_war
0:10.654 run_through Fluffy_Pillow 80.5/100: 81% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war
0:11.459 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blurred_time, potion_of_the_old_war
0:12.263 run_through Fluffy_Pillow 80.3/100: 80% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
0:13.068 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
0:13.068 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, vanish, alacrity(10), shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
0:14.073 saber_slash Fluffy_Pillow 96.3/100: 96% energy | 3.0/6: 50% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), shark_infested_waters, roll_the_bones, hidden_blade, blurred_time, potion_of_the_old_war
0:14.876 pistol_shot Fluffy_Pillow 76.9/100: 77% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
0:15.679 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, alacrity(10), shark_infested_waters, roll_the_bones, blurred_time, potion_of_the_old_war
0:16.484 shadowmeld Fluffy_Pillow 98.7/100: 99% energy | 1.0/6: 17% combo_points bloodlust, alacrity(11), shark_infested_waters, roll_the_bones, potion_of_the_old_war
0:16.484 saber_slash Fluffy_Pillow 98.7/100: 99% energy | 1.0/6: 17% combo_points bloodlust, shadowmeld, alacrity(11), shark_infested_waters, roll_the_bones, potion_of_the_old_war
0:17.490 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, alacrity(11), shark_infested_waters, roll_the_bones, potion_of_the_old_war
0:18.495 pistol_shot Fluffy_Pillow 69.3/100: 69% energy | 4.0/6: 67% combo_points bloodlust, opportunity, alacrity(11), shark_infested_waters, roll_the_bones, blunderbuss, potion_of_the_old_war
0:19.498 roll_the_bones Fluffy_Pillow 88.6/100: 89% energy | 6.0/6: 100% combo_points bloodlust, alacrity(11), shark_infested_waters, roll_the_bones, potion_of_the_old_war
0:20.503 saber_slash Fluffy_Pillow 95.1/100: 95% energy | 1.0/6: 17% combo_points bloodlust, alacrity(12), true_bearing, roll_the_bones, potion_of_the_old_war
0:21.508 saber_slash Fluffy_Pillow 82.6/100: 83% energy | 2.0/6: 33% combo_points bloodlust, alacrity(12), true_bearing, roll_the_bones, potion_of_the_old_war
0:22.513 pistol_shot Fluffy_Pillow 70.0/100: 70% energy | 4.0/6: 67% combo_points bloodlust, opportunity, alacrity(12), true_bearing, roll_the_bones, potion_of_the_old_war
0:23.517 between_the_eyes Fluffy_Pillow 89.5/100: 90% energy | 6.0/6: 100% combo_points bloodlust, alacrity(12), true_bearing, roll_the_bones
0:24.522 saber_slash Fluffy_Pillow 86.2/100: 86% energy | 1.0/6: 17% combo_points bloodlust, greenskins_waterlogged_wristcuffs, alacrity(13), true_bearing, roll_the_bones
0:25.525 pistol_shot Fluffy_Pillow 73.8/100: 74% energy | 3.0/6: 50% combo_points bloodlust, opportunity, greenskins_waterlogged_wristcuffs, alacrity(13), true_bearing, roll_the_bones
0:26.529 saber_slash Fluffy_Pillow 93.4/100: 93% energy | 5.0/6: 83% combo_points bloodlust, alacrity(13), true_bearing, roll_the_bones
0:27.534 run_through Fluffy_Pillow 82.8/100: 83% energy | 6.0/6: 100% combo_points bloodlust, alacrity(13), true_bearing, roll_the_bones, blood_frenzy
0:28.542 marked_for_death Fluffy_Pillow 81.6/100: 82% energy | 1.0/6: 17% combo_points bloodlust, alacrity(15), true_bearing, roll_the_bones, blood_frenzy
0:28.542 between_the_eyes Fluffy_Pillow 81.6/100: 82% energy | 6.0/6: 100% combo_points bloodlust, alacrity(15), true_bearing, roll_the_bones, blood_frenzy
0:29.546 saber_slash Fluffy_Pillow 80.6/100: 81% energy | 1.0/6: 17% combo_points bloodlust, greenskins_waterlogged_wristcuffs, alacrity(17), true_bearing, roll_the_bones, blood_frenzy
0:30.550 saber_slash Fluffy_Pillow 70.7/100: 71% energy | 2.0/6: 33% combo_points bloodlust, greenskins_waterlogged_wristcuffs, alacrity(17), true_bearing, roll_the_bones, blood_frenzy
0:31.554 Waiting 0.400 sec 42.8/100: 43% energy | 3.0/6: 50% combo_points bloodlust, greenskins_waterlogged_wristcuffs, alacrity(17), true_bearing, roll_the_bones, blood_frenzy
0:31.954 saber_slash Fluffy_Pillow 51.5/100: 52% energy | 3.0/6: 50% combo_points bloodlust, greenskins_waterlogged_wristcuffs, alacrity(17), true_bearing, roll_the_bones, blood_frenzy
0:32.961 Waiting 1.200 sec 23.7/100: 24% energy | 4.0/6: 67% combo_points bloodlust, greenskins_waterlogged_wristcuffs, alacrity(17), true_bearing, roll_the_bones, blood_frenzy
0:34.161 saber_slash Fluffy_Pillow 50.1/100: 50% energy | 4.0/6: 67% combo_points bloodlust, greenskins_waterlogged_wristcuffs, alacrity(17), true_bearing, roll_the_bones, blood_frenzy
0:35.164 Waiting 0.531 sec 22.1/100: 22% energy | 5.0/6: 83% combo_points bloodlust, greenskins_waterlogged_wristcuffs, alacrity(17), true_bearing, roll_the_bones, blood_frenzy
0:35.695 saber_slash Fluffy_Pillow 51.8/100: 52% energy | 5.0/6: 83% combo_points bloodlust, greenskins_waterlogged_wristcuffs, alacrity(17), true_bearing, roll_the_bones, blood_frenzy
0:36.699 run_through Fluffy_Pillow 23.6/100: 24% energy | 6.0/6: 100% combo_points bloodlust, opportunity, greenskins_waterlogged_wristcuffs, alacrity(17), true_bearing, roll_the_bones, blunderbuss
0:37.702 pistol_shot Fluffy_Pillow 39.0/100: 39% energy | 2.0/6: 33% combo_points bloodlust, opportunity, greenskins_waterlogged_wristcuffs, alacrity(18), true_bearing, roll_the_bones, blunderbuss
0:38.707 saber_slash Fluffy_Pillow 59.6/100: 60% energy | 4.0/6: 67% combo_points bloodlust, alacrity(18), true_bearing, roll_the_bones
0:39.713 Waiting 1.200 sec 30.1/100: 30% energy | 5.0/6: 83% combo_points bloodlust, alacrity(18), true_bearing, roll_the_bones
0:40.913 saber_slash Fluffy_Pillow 50.1/100: 50% energy | 5.0/6: 83% combo_points alacrity(18), true_bearing, roll_the_bones
0:41.918 between_the_eyes Fluffy_Pillow 51.9/100: 52% energy | 6.0/6: 100% combo_points opportunity, alacrity(18), true_bearing, roll_the_bones
0:42.921 pistol_shot Fluffy_Pillow 44.8/100: 45% energy | 1.0/6: 17% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(19), true_bearing, roll_the_bones
0:43.925 saber_slash Fluffy_Pillow 60.7/100: 61% energy | 3.0/6: 50% combo_points alacrity(19), true_bearing, roll_the_bones
0:44.928 Waiting 1.000 sec 26.6/100: 27% energy | 4.0/6: 67% combo_points alacrity(19), true_bearing, roll_the_bones
0:45.928 saber_slash Fluffy_Pillow 60.4/100: 60% energy | 4.0/6: 67% combo_points alacrity(19), true_bearing, roll_the_bones
0:46.932 run_through Fluffy_Pillow 26.3/100: 26% energy | 6.0/6: 100% combo_points opportunity, alacrity(19), true_bearing, roll_the_bones, blunderbuss
0:47.936 marked_for_death Fluffy_Pillow 37.4/100: 37% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blunderbuss
0:47.936 between_the_eyes Fluffy_Pillow 37.4/100: 37% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blunderbuss
0:48.941 pistol_shot Fluffy_Pillow 30.4/100: 30% energy | 1.0/6: 17% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blunderbuss
0:49.945 Waiting 0.300 sec 46.5/100: 46% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
0:50.245 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
0:51.248 Waiting 0.500 sec 35.3/100: 35% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
0:51.748 vanish Fluffy_Pillow 61.3/100: 61% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
0:51.748 ambush Fluffy_Pillow 61.3/100: 61% energy | 4.0/6: 67% combo_points vanish, alacrity(20), true_bearing, roll_the_bones
0:52.753 Waiting 0.477 sec 17.4/100: 17% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, hidden_blade
0:53.230 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, hidden_blade
0:54.235 adrenaline_rush Fluffy_Pillow 18.1/100: 18% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, hidden_blade
0:54.235 Waiting 0.534 sec 18.1/100: 18% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blurred_time
0:54.769 saber_slash Fluffy_Pillow 53.1/100: 53% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blurred_time
0:55.572 Waiting 0.700 sec 28.8/100: 29% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss
0:56.272 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss
0:57.076 Waiting 0.700 sec 26.9/100: 27% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss
0:57.776 potion Fluffy_Pillow 49.2/100: 49% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss
0:58.000 saber_slash Fluffy_Pillow 56.4/100: 56% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
0:58.806 Waiting 0.600 sec 32.1/100: 32% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
0:59.406 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:00.209 between_the_eyes Fluffy_Pillow 45.0/100: 45% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:01.013 Waiting 0.100 sec 47.7/100: 48% energy | 1.0/6: 17% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:01.113 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 1.0/6: 17% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:01.918 Waiting 0.800 sec 26.6/100: 27% energy | 2.0/6: 33% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:02.718 saber_slash Fluffy_Pillow 52.2/100: 52% energy | 2.0/6: 33% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:03.521 Waiting 0.700 sec 27.8/100: 28% energy | 3.0/6: 50% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:04.221 saber_slash Fluffy_Pillow 50.2/100: 50% energy | 3.0/6: 50% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:05.025 Waiting 0.800 sec 25.9/100: 26% energy | 4.0/6: 67% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, blunderbuss, potion_of_the_old_war
1:05.825 saber_slash Fluffy_Pillow 51.5/100: 51% energy | 4.0/6: 67% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, potion_of_the_old_war
1:06.631 Waiting 0.800 sec 27.2/100: 27% energy | 5.0/6: 83% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, potion_of_the_old_war
1:07.431 saber_slash Fluffy_Pillow 52.8/100: 53% energy | 5.0/6: 83% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, potion_of_the_old_war
1:08.236 run_through Fluffy_Pillow 28.5/100: 29% energy | 6.0/6: 100% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, potion_of_the_old_war
1:09.041 marked_for_death Fluffy_Pillow 31.3/100: 31% energy | 2.0/6: 33% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, potion_of_the_old_war
1:09.041 run_through Fluffy_Pillow 31.3/100: 31% energy | 6.0/6: 100% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blurred_time, potion_of_the_old_war
1:09.846 Waiting 0.400 sec 43.6/100: 44% energy | 1.0/6: 17% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:10.246 saber_slash Fluffy_Pillow 50.5/100: 51% energy | 1.0/6: 17% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:11.250 pistol_shot Fluffy_Pillow 35.9/100: 36% energy | 3.0/6: 50% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:12.254 saber_slash Fluffy_Pillow 71.4/100: 71% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:13.259 roll_the_bones Fluffy_Pillow 56.8/100: 57% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:14.263 saber_slash Fluffy_Pillow 61.2/100: 61% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:15.268 between_the_eyes Fluffy_Pillow 28.6/100: 29% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:16.272 pistol_shot Fluffy_Pillow 23.0/100: 23% energy | 1.0/6: 17% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:17.277 Waiting 0.600 sec 40.5/100: 40% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:17.877 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:18.881 run_through Fluffy_Pillow 36.3/100: 36% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:19.885 Waiting 0.300 sec 29.5/100: 30% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, potion_of_the_old_war
1:20.185 saber_slash Fluffy_Pillow 52.3/100: 52% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, potion_of_the_old_war
1:21.190 Waiting 0.913 sec 18.4/100: 18% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, potion_of_the_old_war
1:22.103 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, potion_of_the_old_war
1:23.108 Waiting 0.497 sec 17.0/100: 17% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:23.605 run_through Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:24.611 curse_of_the_dreadblades Fluffy_Pillow 18.1/100: 18% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:24.704 Waiting 1.240 sec 19.6/100: 20% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
1:25.944 saber_slash Fluffy_Pillow 57.4/100: 57% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
1:26.948 run_through Fluffy_Pillow 59.4/100: 59% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
1:27.952 saber_slash Fluffy_Pillow 70.5/100: 70% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
1:28.957 run_through Fluffy_Pillow 36.5/100: 37% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
1:29.960 Waiting 1.300 sec 29.5/100: 30% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
1:31.260 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
1:32.264 Waiting 0.540 sec 16.4/100: 16% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
1:32.804 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
1:33.809 Waiting 1.821 sec 19.4/100: 19% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:35.630 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:36.635 Waiting 0.378 sec 18.4/100: 18% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:37.013 between_the_eyes Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:38.017 Waiting 1.823 sec 19.4/100: 19% energy | 1.0/6: 17% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:39.840 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 1.0/6: 17% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:40.845 run_through Fluffy_Pillow 36.4/100: 36% energy | 5.0/6: 83% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:41.849 pistol_shot Fluffy_Pillow 48.8/100: 49% energy | 1.0/6: 17% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:42.853 saber_slash Fluffy_Pillow 66.3/100: 66% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:43.860 run_through Fluffy_Pillow 33.7/100: 34% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:44.866 Waiting 1.400 sec 28.2/100: 28% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
1:46.266 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:47.271 Waiting 2.073 sec 17.4/100: 17% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:49.344 saber_slash Fluffy_Pillow 50.6/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:50.348 run_through Fluffy_Pillow 34.6/100: 35% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:51.353 Waiting 1.400 sec 27.7/100: 28% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:52.753 saber_slash Fluffy_Pillow 50.0/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:53.758 Waiting 1.057 sec 16.1/100: 16% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:54.815 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
1:55.820 roll_the_bones Fluffy_Pillow 17.1/100: 17% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blunderbuss
1:56.825 marked_for_death Fluffy_Pillow 20.1/100: 20% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
1:56.825 Waiting 0.305 sec 20.1/100: 20% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
1:57.130 between_the_eyes Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
1:58.134 pistol_shot Fluffy_Pillow 36.0/100: 36% energy | 1.0/6: 17% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
1:59.137 saber_slash Fluffy_Pillow 52.1/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:00.141 run_through Fluffy_Pillow 36.1/100: 36% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:01.145 Waiting 0.200 sec 47.1/100: 47% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:01.345 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:02.351 run_through Fluffy_Pillow 35.8/100: 36% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss, blood_frenzy
2:03.355 pistol_shot Fluffy_Pillow 48.2/100: 48% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss, blood_frenzy
2:04.359 saber_slash Fluffy_Pillow 83.6/100: 84% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:05.360 run_through Fluffy_Pillow 51.0/100: 51% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:06.365 saber_slash Fluffy_Pillow 63.4/100: 63% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:07.367 Waiting 0.900 sec 30.8/100: 31% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:08.267 saber_slash Fluffy_Pillow 64.4/100: 64% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:09.271 run_through Fluffy_Pillow 49.8/100: 50% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:10.275 Waiting 0.400 sec 44.2/100: 44% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:10.675 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:11.679 Waiting 0.432 sec 18.1/100: 18% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
2:12.111 run_through Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
2:13.117 pistol_shot Fluffy_Pillow 18.1/100: 18% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
2:14.122 Waiting 0.700 sec 34.1/100: 34% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:14.822 saber_slash Fluffy_Pillow 63.3/100: 63% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:15.825 run_through Fluffy_Pillow 29.4/100: 29% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones
2:16.830 pistol_shot Fluffy_Pillow 22.4/100: 22% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones
2:17.834 Waiting 0.700 sec 38.7/100: 39% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:18.534 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:19.539 between_the_eyes Fluffy_Pillow 54.2/100: 54% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:20.543 pistol_shot Fluffy_Pillow 66.6/100: 67% energy | 1.0/6: 17% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:21.547 saber_slash Fluffy_Pillow 84.0/100: 84% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:22.550 run_through Fluffy_Pillow 69.4/100: 69% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:23.554 pistol_shot Fluffy_Pillow 63.8/100: 64% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:24.558 run_through Fluffy_Pillow 99.3/100: 99% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:25.561 saber_slash Fluffy_Pillow 93.6/100: 94% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones, blood_frenzy
2:26.566 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss, blood_frenzy
2:27.569 saber_slash Fluffy_Pillow 94.4/100: 94% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss, blood_frenzy
2:28.574 pistol_shot Fluffy_Pillow 60.6/100: 61% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
2:29.577 run_through Fluffy_Pillow 94.6/100: 95% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:30.581 saber_slash Fluffy_Pillow 87.7/100: 88% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:31.586 run_through Fluffy_Pillow 71.8/100: 72% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
2:32.591 pistol_shot Fluffy_Pillow 64.8/100: 65% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones, blunderbuss
2:33.596 saber_slash Fluffy_Pillow 80.9/100: 81% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:34.600 run_through Fluffy_Pillow 64.9/100: 65% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:35.605 saber_slash Fluffy_Pillow 58.0/100: 58% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, broadsides, roll_the_bones
2:36.611 roll_the_bones Fluffy_Pillow 24.1/100: 24% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, broadsides, roll_the_bones
2:37.617 pistol_shot Fluffy_Pillow 31.2/100: 31% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:38.620 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones
2:39.624 between_the_eyes Fluffy_Pillow 57.2/100: 57% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones
2:40.627 saber_slash Fluffy_Pillow 54.3/100: 54% energy | 1.0/6: 17% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:41.631 Waiting 0.400 sec 42.3/100: 42% energy | 3.0/6: 50% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:42.031 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 3.0/6: 50% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:43.034 Waiting 0.232 sec 20.4/100: 20% energy | 5.0/6: 83% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:43.266 run_through Fluffy_Pillow 43.0/100: 43% energy | 5.0/6: 83% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:44.271 adrenaline_rush Fluffy_Pillow 40.3/100: 40% energy | 1.0/6: 17% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:44.271 Waiting 0.300 sec 40.3/100: 40% energy | 1.0/6: 17% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blood_frenzy
2:44.571 saber_slash Fluffy_Pillow 53.3/100: 53% energy | 1.0/6: 17% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blood_frenzy
2:45.375 saber_slash Fluffy_Pillow 56.1/100: 56% energy | 3.0/6: 50% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blood_frenzy
2:46.180 run_through Fluffy_Pillow 41.0/100: 41% energy | 5.0/6: 83% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blood_frenzy
2:46.984 vanish Fluffy_Pillow 70.9/100: 71% energy | 1.0/6: 17% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blood_frenzy
2:46.984 ambush Fluffy_Pillow 70.9/100: 71% energy | 1.0/6: 17% combo_points adrenaline_rush, vanish, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blood_frenzy
2:47.989 saber_slash Fluffy_Pillow 54.4/100: 54% energy | 4.0/6: 67% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, hidden_blade, blurred_time, blood_frenzy
2:48.794 run_through Fluffy_Pillow 39.3/100: 39% energy | 6.0/6: 100% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
2:49.599 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 1.0/6: 17% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
2:50.402 Waiting 0.400 sec 36.0/100: 36% energy | 3.0/6: 50% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
2:50.802 shadowmeld Fluffy_Pillow 71.4/100: 71% energy | 3.0/6: 50% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
2:50.802 saber_slash Fluffy_Pillow 71.4/100: 71% energy | 3.0/6: 50% combo_points shadowmeld, adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
2:51.606 run_through Fluffy_Pillow 92.2/100: 92% energy | 5.0/6: 83% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
2:52.411 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
2:53.216 saber_slash Fluffy_Pillow 84.9/100: 85% energy | 3.0/6: 50% combo_points adrenaline_rush, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
2:54.021 run_through Fluffy_Pillow 69.8/100: 70% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss, blood_frenzy
2:54.826 marked_for_death Fluffy_Pillow 97.5/100: 97% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss
2:54.941 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss
2:55.745 curse_of_the_dreadblades Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blurred_time, blunderbuss
2:55.745 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
2:56.549 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
2:57.353 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
2:58.157 between_the_eyes Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
2:58.961 pistol_shot Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blurred_time, blunderbuss
2:59.765 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:00.769 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:01.773 run_through Fluffy_Pillow 88.1/100: 88% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:02.778 saber_slash Fluffy_Pillow 85.1/100: 85% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:03.782 run_through Fluffy_Pillow 55.2/100: 55% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:04.787 pistol_shot Fluffy_Pillow 52.3/100: 52% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:05.790 run_through Fluffy_Pillow 72.3/100: 72% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:06.795 saber_slash Fluffy_Pillow 69.4/100: 69% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:07.799 run_through Fluffy_Pillow 39.4/100: 39% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones
3:08.805 Waiting 0.500 sec 36.5/100: 37% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones
3:09.305 saber_slash Fluffy_Pillow 64.6/100: 65% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
3:10.309 saber_slash Fluffy_Pillow 54.4/100: 54% energy | 3.0/6: 50% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
3:11.314 roll_the_bones Fluffy_Pillow 26.2/100: 26% energy | 5.0/6: 83% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
3:12.317 Waiting 0.700 sec 34.9/100: 35% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:13.017 saber_slash Fluffy_Pillow 50.1/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:14.021 Waiting 0.500 sec 39.8/100: 40% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:14.521 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:15.526 Waiting 0.517 sec 22.5/100: 22% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:16.043 saber_slash Fluffy_Pillow 51.7/100: 52% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:17.047 Waiting 0.400 sec 41.4/100: 41% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:17.447 saber_slash Fluffy_Pillow 50.1/100: 50% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:18.451 Waiting 0.500 sec 39.9/100: 40% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:18.951 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:19.956 between_the_eyes Fluffy_Pillow 39.3/100: 39% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:20.961 Waiting 0.700 sec 36.4/100: 36% energy | 2.0/6: 33% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:21.661 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 2.0/6: 33% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:22.665 Waiting 1.530 sec 20.4/100: 20% energy | 3.0/6: 50% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:24.195 saber_slash Fluffy_Pillow 69.0/100: 69% energy | 3.0/6: 50% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:25.200 pistol_shot Fluffy_Pillow 57.0/100: 57% energy | 5.0/6: 83% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:26.205 run_through Fluffy_Pillow 95.1/100: 95% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:27.209 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:28.213 saber_slash Fluffy_Pillow 88.4/100: 88% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:29.218 saber_slash Fluffy_Pillow 96.2/100: 96% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:30.221 saber_slash Fluffy_Pillow 85.9/100: 86% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:31.225 saber_slash Fluffy_Pillow 75.7/100: 76% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:32.231 run_through Fluffy_Pillow 83.5/100: 83% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:33.236 saber_slash Fluffy_Pillow 82.3/100: 82% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:34.240 saber_slash Fluffy_Pillow 90.0/100: 90% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:35.244 saber_slash Fluffy_Pillow 79.8/100: 80% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:36.248 pistol_shot Fluffy_Pillow 51.6/100: 52% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:37.254 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:38.257 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:39.261 saber_slash Fluffy_Pillow 88.1/100: 88% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:40.267 saber_slash Fluffy_Pillow 58.2/100: 58% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:41.272 pistol_shot Fluffy_Pillow 65.9/100: 66% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:42.277 between_the_eyes Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:43.280 saber_slash Fluffy_Pillow 98.7/100: 99% energy | 1.0/6: 17% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:44.283 pistol_shot Fluffy_Pillow 70.5/100: 70% energy | 3.0/6: 50% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:45.288 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:46.291 run_through Fluffy_Pillow 71.7/100: 72% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:47.294 saber_slash Fluffy_Pillow 88.5/100: 88% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:48.298 saber_slash Fluffy_Pillow 96.2/100: 96% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:49.304 saber_slash Fluffy_Pillow 86.1/100: 86% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blunderbuss, blood_frenzy
3:50.308 roll_the_bones Fluffy_Pillow 73.6/100: 74% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), blunderbuss
3:51.313 saber_slash Fluffy_Pillow 94.6/100: 95% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), broadsides, roll_the_bones, blunderbuss
3:52.318 pistol_shot Fluffy_Pillow 78.7/100: 79% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), broadsides, roll_the_bones, blunderbuss
3:53.324 roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, roll_the_bones
3:54.328 marked_for_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones
3:54.328 roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points alacrity(20), buried_treasure, roll_the_bones
3:55.332 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, roll_the_bones, blood_frenzy
3:56.337 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, roll_the_bones, blood_frenzy
3:57.342 saber_slash Fluffy_Pillow 85.4/100: 85% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), grand_melee, roll_the_bones, blood_frenzy
3:58.347 roll_the_bones Fluffy_Pillow 88.9/100: 89% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, roll_the_bones, blood_frenzy
3:59.351 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, blood_frenzy
4:00.357 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, blood_frenzy
4:01.361 saber_slash Fluffy_Pillow 85.4/100: 85% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, blunderbuss, blood_frenzy
4:02.365 roll_the_bones Fluffy_Pillow 70.8/100: 71% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, blunderbuss, blood_frenzy
4:03.368 pistol_shot Fluffy_Pillow 75.2/100: 75% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, blunderbuss, blood_frenzy
4:04.372 saber_slash Fluffy_Pillow 92.6/100: 93% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, roll_the_bones, blood_frenzy
4:05.377 roll_the_bones Fluffy_Pillow 96.1/100: 96% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), shark_infested_waters, roll_the_bones, blood_frenzy
4:06.381 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), broadsides, roll_the_bones, blood_frenzy
4:07.385 saber_slash Fluffy_Pillow 85.4/100: 85% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), broadsides, roll_the_bones, blood_frenzy
4:08.389 roll_the_bones Fluffy_Pillow 52.8/100: 53% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), broadsides, roll_the_bones, blood_frenzy
4:09.394 saber_slash Fluffy_Pillow 79.6/100: 80% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
4:10.399 pistol_shot Fluffy_Pillow 51.4/100: 51% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
4:11.402 roll_the_bones Fluffy_Pillow 73.1/100: 73% energy | 5.0/6: 83% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
4:12.407 saber_slash Fluffy_Pillow 77.6/100: 78% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
4:13.412 pistol_shot Fluffy_Pillow 63.0/100: 63% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
4:14.416 between_the_eyes Fluffy_Pillow 80.4/100: 80% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
4:15.420 saber_slash Fluffy_Pillow 74.8/100: 75% energy | 1.0/6: 17% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
4:16.426 pistol_shot Fluffy_Pillow 42.3/100: 42% energy | 3.0/6: 50% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
4:17.429 run_through Fluffy_Pillow 59.6/100: 60% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
4:18.433 saber_slash Fluffy_Pillow 72.1/100: 72% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
4:19.439 pistol_shot Fluffy_Pillow 38.4/100: 38% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:20.442 run_through Fluffy_Pillow 54.4/100: 54% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:21.448 saber_slash Fluffy_Pillow 65.5/100: 65% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:22.453 Waiting 1.200 sec 31.5/100: 32% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:23.653 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:24.660 Waiting 2.113 sec 16.8/100: 17% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:26.773 saber_slash Fluffy_Pillow 50.6/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:27.778 Waiting 1.524 sec 16.6/100: 17% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:29.302 saber_slash Fluffy_Pillow 59.0/100: 59% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:30.308 run_through Fluffy_Pillow 43.1/100: 43% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:31.312 curse_of_the_dreadblades Fluffy_Pillow 54.1/100: 54% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:31.312 pistol_shot Fluffy_Pillow 54.1/100: 54% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:32.317 run_through Fluffy_Pillow 88.2/100: 88% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:33.320 saber_slash Fluffy_Pillow 81.2/100: 81% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:34.326 between_the_eyes Fluffy_Pillow 65.3/100: 65% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:35.421 pistol_shot Fluffy_Pillow 77.8/100: 78% energy | 1.0/6: 17% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:36.424 run_through Fluffy_Pillow 93.8/100: 94% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:37.429 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:38.434 run_through Fluffy_Pillow 66.1/100: 66% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blunderbuss
4:39.439 pistol_shot Fluffy_Pillow 59.1/100: 59% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blunderbuss
4:40.445 run_through Fluffy_Pillow 75.2/100: 75% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:41.449 saber_slash Fluffy_Pillow 68.2/100: 68% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:42.453 run_through Fluffy_Pillow 34.3/100: 34% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:43.458 Waiting 1.500 sec 27.3/100: 27% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:44.958 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:45.965 pistol_shot Fluffy_Pillow 35.4/100: 35% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:46.969 run_through Fluffy_Pillow 69.5/100: 69% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:47.974 saber_slash Fluffy_Pillow 62.5/100: 63% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:48.977 pistol_shot Fluffy_Pillow 64.5/100: 65% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:49.982 run_through Fluffy_Pillow 80.6/100: 81% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:50.986 saber_slash Fluffy_Pillow 91.7/100: 92% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:51.990 pistol_shot Fluffy_Pillow 57.7/100: 58% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blunderbuss
4:52.994 run_through Fluffy_Pillow 73.7/100: 74% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:53.998 saber_slash Fluffy_Pillow 66.8/100: 67% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:55.004 marked_for_death Fluffy_Pillow 68.9/100: 69% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:55.004 between_the_eyes Fluffy_Pillow 68.9/100: 69% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:56.009 saber_slash Fluffy_Pillow 61.9/100: 62% energy | 1.0/6: 17% combo_points greenskins_waterlogged_wristcuffs, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:57.013 pistol_shot Fluffy_Pillow 28.0/100: 28% energy | 3.0/6: 50% combo_points opportunity, greenskins_waterlogged_wristcuffs, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:58.017 roll_the_bones Fluffy_Pillow 62.0/100: 62% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
4:59.022 vanish Fluffy_Pillow 65.1/100: 65% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
4:59.022 ambush Fluffy_Pillow 65.1/100: 65% energy | 1.0/6: 17% combo_points vanish, alacrity(20), true_bearing, roll_the_bones
5:00.026 Waiting 0.700 sec 39.1/100: 39% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, hidden_blade
5:00.726 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, hidden_blade

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8802 8477 0
Agility 28067 26361 16073 (11258)
Stamina 41233 41233 25459
Intellect 5325 5000 0
Spirit 0 0 0
Health 2473980 2473980 0
Energy 100 100 0
Combo Points 6 6 0
Crit 38.93% 38.93% 8024
Haste 10.98% 10.98% 3568
Damage / Heal Versatility 10.10% 9.16% 3666
Attack Power 42101 39542 0
Mastery 56.61% 56.61% 6207
Armor 2244 2244 2244
Run Speed 9 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Scarred Ragefang Chestpiece
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +918 Mastery, +542 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Stained Maggot Squishers
ilevel: 880, stats: { 250 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Haste }
Local Wrists Greenskin's Waterlogged Wristcuffs
ilevel: 895, stats: { 167 Armor, +1665 Sta, +1110 Agi, +496 Crit, +372 Haste }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Deep Sea Pearls
ilevel: 860, stats: { +1201 Sta, +1198 Mastery, +708 Vers }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand The Dreadblades
ilevel: 906, weapon: { 5552 - 10313, 2.6 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand The Dreadblades
ilevel: 906, weapon: { 5552 - 10313, 2.6 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }

Talents

Level
15 Ghostly Strike (Outlaw Rogue) Swordmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue)
30 Grappling Hook (Outlaw Rogue) Acrobatic Strikes (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Deeper Stratagem Anticipation Vigor
60 Iron Stomach (Outlaw Rogue) Elusiveness Cheat Death
75 Parley (Outlaw Rogue) Prey on the Weak Dirty Tricks (Outlaw Rogue)
90 Cannonball Barrage (Outlaw Rogue) Alacrity Killing Spree (Outlaw Rogue)
100 Slice and Dice (Outlaw Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Outlaw_T19M"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3310022
artifact=44:0:0:0:0:1052:1:1053:1:1054:1:1055:1:1056:1:1057:1:1058:1:1059:3:1060:3:1061:3:1062:3:1063:3:1064:3:1065:3:1066:3:1067:3:1348:1
spec=outlaw

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,if=!talent.slice_and_dice.enabled

# Executed every time the actor is available.
actions=variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
actions+=/variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
actions+=/variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
actions+=/call_action_list,name=bf
actions+=/call_action_list,name=cds
actions+=/call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
actions+=/death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
actions+=/slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions+=/roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
actions+=/killing_spree,if=energy.time_to_max>5|energy<15
actions+=/call_action_list,name=build
actions+=/call_action_list,name=finish,if=!variable.ss_useable
actions+=/gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1

actions.bf=cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
actions.bf+=/blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up

actions.build=ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
actions.build+=/pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&(energy.time_to_max>2-talent.quick_draw.enabled|(buff.blunderbuss.up&buff.greenskins_waterlogged_wristcuffs.up))
actions.build+=/saber_slash,if=variable.ss_useable

actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/arcane_torrent,if=energy.deficit>40
actions.cds+=/cannonball_barrage,if=spell_targets.cannonball_barrage>=1
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.cds+=/sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
actions.cds+=/curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)

actions.finish=between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&!buff.greenskins_waterlogged_wristcuffs.up
actions.finish+=/run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5

actions.stealth=variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
actions.stealth+=/ambush
actions.stealth+=/vanish,if=variable.stealth_condition
actions.stealth+=/shadowmeld,if=variable.stealth_condition

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1806
wrists=greenskins_waterlogged_wristcuffs,id=137099
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=stained_maggot_squishers,id=139200,bonus_id=1806
finger1=ring_of_deep_sea_pearls,id=141545,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=unstable_arcanocrystal,id=141482
main_hand=the_dreadblades,id=128872,bonus_id=742,gem_id=139260/139261/139262,relic_id=1806/1806/1806
off_hand=the_dreadblades,id=134552

# Gear Summary
# gear_ilvl=881.69
# gear_agility=16073
# gear_stamina=25459
# gear_crit_rating=8024
# gear_haste_rating=3568
# gear_mastery_rating=6207
# gear_versatility_rating=3666
# gear_armor=2244

Rogue_Subtlety_T19M : 479580 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
479580.2 479580.2 392.6 / 0.082% 68364.2 / 14.3% 14749.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
32.4 32.4 Energy 14.70% 61.5 100.0% 100%
Talents
  • 15: Weaponmaster (Subtlety Rogue)
  • 30: Subterfuge
  • 45: Deeper Stratagem
  • 90: Premeditation (Subtlety Rogue)
  • 100: Master of Shadows (Subtlety Rogue)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Rogue_Subtlety_T19M 479580
auto_attack_mh 11094 2.3% 159.1 1.90sec 21026 13759 Direct 159.1 18559 37119 21026 32.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.07 159.07 0.00 0.00 1.5282 0.0000 3344697.78 4917022.56 31.98 13759.15 13759.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.62 48.80% 18559.18 15467 18561 18559.21 18340 18561 1440640 2117877 31.98
crit 51.30 32.25% 37118.62 30935 37122 37118.60 36680 37122 1904058 2799146 31.98
miss 30.15 18.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 5451 1.1% 156.4 1.93sec 10509 6761 Direct 156.4 9280 18559 10509 32.3% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.37 156.37 0.00 0.00 1.5543 0.0000 1643279.78 2415776.93 31.98 6761.24 6761.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.15 48.70% 9279.61 7734 9280 9279.62 9188 9280 706685 1038893 31.98
crit 50.46 32.27% 18559.35 15467 18561 18559.34 18280 18561 936595 1376883 31.98
miss 29.75 19.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Backstab 23068 4.8% 52.7 5.07sec 131953 131364 Direct 55.8 94248 188496 124729 32.3% 0.0%  

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.72 55.78 0.00 0.00 1.0045 0.0000 6957149.21 10227668.34 31.98 131363.63 131363.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.74 67.66% 94247.90 78547 94257 94248.03 92353 94257 3556737 5228740 31.98
crit 18.04 32.34% 188495.68 157095 188514 188496.37 183050 188514 3400413 4998929 31.98
 
 

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:
  • description:Stab the target, causing ${$sw2*$<mult>} Physical damage. Damage increased by {$s4=30}% when you are behind your target. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.70
 
Eviscerate 152105 31.7% 61.3 4.86sec 743990 740662 Direct 64.8 477526 955724 703839 47.3% 0.0%  

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.32 64.81 0.00 0.00 1.0045 0.0000 45618104.50 67062934.68 31.98 740661.86 740661.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.14 52.67% 477526.26 327055 583990 477702.57 443487 520724 16302798 23966657 31.98
crit 30.67 47.33% 955723.67 654111 1167980 956046.97 873518 1039643 29315307 43096278 31.98
 
 

Action details: eviscerate

Static Values
  • id:196819
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:196819
  • name:Eviscerate
  • school:physical
  • tooltip:
  • description:Finishing move that disembowels the target, causing damage per combo point. 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:0.00
 
Goremaw's Bite 0 (7497) 0.0% (1.6%) 4.6 64.19sec 494619 492489

Stats details: goremaws_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.56 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 492489.41 492489.41
 
 

Action details: goremaws_bite

Static Values
  • id:209782
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.shadow_dance.up&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
Spelldata
  • id:209782
  • name:Goremaw's Bite
  • school:physical
  • tooltip:
  • description:Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r
 
    Goremaw's Bite (_mh) 5071 1.1% 4.6 64.19sec 334450 0 Direct 4.8 242553 466663 315959 32.8% 0.0%  

Stats details: goremaws_bite_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.56 4.83 0.00 0.00 0.0000 0.0000 1525518.07 1525518.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.25 67.24% 242552.56 109121 2095129 224149.84 0 2095129 787352 787352 0.00
crit 1.58 32.76% 466663.40 218243 4190257 374443.02 0 4190257 738166 738166 0.00
 
 

Action details: goremaws_bite_mh

Static Values
  • id:209783
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209783
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
    Goremaw's Bite (_oh) 2426 0.5% 4.6 64.19sec 160169 0 Direct 4.8 115681 229109 152106 32.1% 0.0%  

Stats details: goremaws_bite_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.56 4.81 0.00 0.00 0.0000 0.0000 730575.92 730575.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.26 67.89% 115680.84 54563 1047619 106645.52 0 1047619 377304 377304 0.00
crit 1.54 32.11% 229109.14 109127 2095238 183491.72 0 2095238 353272 353272 0.00
 
 

Action details: goremaws_bite_oh

Static Values
  • id:209784
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209784
  • name:Goremaw's Bite
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Horrific Slam 14054 2.9% 116.6 2.22sec 36225 0 Direct 116.6 27371 54743 36225 32.3% 0.0%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.57 116.57 0.00 0.00 0.0000 0.0000 4222966.18 4222966.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.87 67.65% 27371.46 22811 27374 27371.47 26904 27374 2158681 2158681 0.00
crit 37.71 32.35% 54743.06 45623 54747 54742.93 53444 54747 2064285 2064285 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Mark of the Hidden Satyr 4741 1.0% 16.6 18.04sec 86010 0 Direct 16.6 65087 130173 86011 32.1% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.56 16.56 0.00 0.00 0.0000 0.0000 1423934.26 1423934.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.23 67.85% 65087.37 54243 65092 65087.53 62922 65092 731150 731150 0.00
crit 5.32 32.15% 130172.60 108487 130184 129566.18 0 130184 692784 692784 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Nightblade 89640 (94878) 18.7% (19.8%) 17.4 17.15sec 1637003 1629763 Periodic 145.4 140044 280006 185316 32.3% 0.0% 96.7%

Stats details: nightblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.42 0.00 145.43 145.43 1.0045 2.0000 26950497.52 26950497.52 0.00 92502.62 1629762.84
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.4 67.65% 140044.33 103690 154295 140045.99 136139 144294 13778585 13778585 0.00
crit 47.0 32.35% 280006.45 207380 308589 280018.95 266147 298383 13171913 13171913 0.00
 
 

Action details: nightblade

Static Values
  • id:195452
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
Spelldata
  • id:195452
  • name:Nightblade
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec and snared by attacks.
  • description:Finishing move that infects the target with shadowy energy, dealing Shadow damage over time and causing attacks against the target to reduce movement speed by {$206760s1=50}% for {$206760d=8 seconds}. Lasts longer per combo point. 1 point : ${$m1*8/2} over 8 sec 2 points: ${$m1*10/2} over 10 sec 3 points: ${$m1*12/2} over 12 sec 4 points: ${$m1*14/2} over 14 sec 5 points: ${$m1*16/2} over 16 sec{$?s193531=false}[ 6 points: ${$m1*18/2} over 18 sec][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.380000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Weaponmaster 5238 1.1% 8.5 30.92sec 184955 0 Direct 8.5 184954 0 184954 0.0% 0.0%  

Stats details: weaponmaster

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.51 8.51 0.00 0.00 0.0000 0.0000 1573611.73 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.51 100.00% 184954.35 103690 308589 184858.68 124428 308585 1573612 0 0.00
 
 

Action details: weaponmaster

Static Values
  • id:193536
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193536
  • name:Weaponmaster
  • school:shadow
  • tooltip:
  • description:Deals Shadow damage to an enemy.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:298634.56
  • base_dd_max:298634.56
 
Potion of the Old War 16691 3.4% 23.6 9.50sec 209171 0 Direct 23.6 158050 316100 209172 32.3% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.59 23.59 0.00 0.00 0.0000 0.0000 4934797.19 7254619.31 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.96 67.66% 158050.32 131711 158053 158050.53 153894 158053 2522714 3708629 31.98
crit 7.63 32.34% 316100.36 263422 316107 316055.91 0 316107 2412083 3545991 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Blades 0 (6704) 0.0% (1.4%) 2.0 181.09sec 976201 0

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(stealthed|buff.shadowmeld.up)
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
 
    Shadow Blade (_mh) 4462 0.9% 34.6 6.20sec 38115 28538 Direct 36.6 27286 54572 36051 32.1% 0.0%  

Stats details: shadow_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.63 36.61 0.00 0.00 1.3356 0.0000 1319804.84 1319804.84 0.00 28537.55 28537.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.85 67.88% 27285.99 22739 27286 27286.02 26846 27286 678038 678038 0.00
crit 11.76 32.12% 54571.53 45477 54573 54564.41 0 54573 641767 641767 0.00
 
 

Action details: shadow_blade_mh

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Shadow Blade Off-hand 2241 0.5% 34.8 6.16sec 19052 14262 Direct 36.8 13643 27286 18039 32.2% 0.0%  

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.80 36.76 0.00 0.00 1.3359 0.0000 663058.66 663058.66 0.00 14262.09 14262.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.91 67.78% 13642.89 11369 13643 13642.90 13416 13643 339901 339901 0.00
crit 11.84 32.22% 27285.82 22739 27286 27285.81 26528 27286 323158 323158 0.00
 
 

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:
  • description:Strike with dark energy, dealing Shadow damage equal to {$s1=1}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Shadow Nova 8603 1.8% 31.9 9.43sec 80853 0 Direct 33.7 57678 115357 76442 32.5% 0.0%  

Stats details: shadow_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.90 33.74 0.00 0.00 0.0000 0.0000 2578941.44 2578941.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.76 67.47% 57678.32 48066 57679 57678.36 57198 57679 1312834 1312834 0.00
crit 10.98 32.53% 115356.62 96131 115358 115356.65 113221 115358 1266108 1266108 0.00
 
 

Action details: shadow_nova

Static Values
  • id:197800
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197800
  • name:Shadow Nova
  • school:shadow
  • tooltip:
  • description:Deals {$s1=0} Shadow damage to enemies with $A1 yards.
 
Shadowstrike 108200 (134695) 22.6% (28.1%) 119.5 2.52sec 338004 336491 Direct 126.5 181696 363394 256581 41.2% 0.0%  

Stats details: shadowstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.51 126.46 0.00 0.00 1.0045 0.0000 32445813.88 47698419.75 31.98 336490.55 336490.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.34 58.79% 181696.15 151416 181699 181696.35 180534 181699 13507154 19856796 31.98
crit 52.12 41.21% 363394.24 302832 363398 363394.19 360581 363398 18938660 27841624 31.98
 
 

Action details: shadowstrike

Static Values
  • id:185438
  • school:physical
  • resource:energy
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:185438
  • name:Shadowstrike
  • school:physical
  • tooltip:
  • description:Strike through the shadows, $?a231718[appearing behind your target and ][]dealing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.50
 
    Soul Rip 26495 5.5% 125.0 2.51sec 63596 0 Direct 125.0 48067 96134 63596 32.3% 0.0%  

Stats details: soul_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.98 124.98 0.00 0.00 0.0000 0.0000 7947858.07 7947858.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.60 67.69% 48066.79 48067 48067 48066.79 48067 48067 4066441 4066441 0.00
crit 40.38 32.31% 96133.57 96134 96134 96133.57 96134 96134 3881417 3881417 0.00
 
 

Action details: soul_rip

Static Values
  • id:220893
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:220893
  • name:Soul Rip
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209835=After you use Cheap Shot or Shadowstrike, Akaari's Soul appears $m1 sec later and Soul Rips the target, dealing {$220893s1=1} Shadow damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Rogue_Subtlety_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T19M
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadow Dance 28.5 10.58sec

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadow_dance

Static Values
  • id:185313
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:charges_fractional>=2.65
Spelldata
  • id:185313
  • name:Shadow Dance
  • school:physical
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=50}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for $31666d after deal {$31223s1=10}% more damage. ][]
 
Shadowmeld 2.6 122.73sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.61 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=40-variable.ssw_er&energy.deficit>10
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Symbols of Death 16.7 18.75sec

Stats details: symbols_of_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: symbols_of_death

Static Values
  • id:212283
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:212283
  • name:Symbols of Death
  • school:physical
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
 
Vanish 2.9 122.27sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 10.7 6.5 28.3sec 17.1sec 45.11% 45.11% 6.5(6.5) 10.3

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:45.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.32% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death 16.7 0.0 18.3sec 18.7sec 0.77% 13.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_death
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • death_1:0.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227151
  • name:Death
  • tooltip:Your next Shadowstrike will critically strike.
  • description:{$@spelldesc212283=Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Finality: Eviscerate 32.7 0.0 9.2sec 9.2sec 49.22% 49.56% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_finality_eviscerate
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_eviscerate_5:26.22%
  • finality_eviscerate_6:23.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197496
  • name:Finality: Eviscerate
  • tooltip:Your next Eviscerate will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Finality: Nightblade 8.9 0.0 34.5sec 34.5sec 42.48% 40.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_finality_nightblade
  • max_stacks:6
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • finality_nightblade_5:23.12%
  • finality_nightblade_6:19.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197498
  • name:Finality: Nightblade
  • tooltip:Your next Nightblade will do $w1% increased damage.
  • description:
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Goremaw's Bite 4.6 0.0 64.2sec 64.2sec 9.01% 9.01% 27.0(27.0) 4.5

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_goremaws_bite
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • goremaws_bite_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:220901
  • name:Goremaw's Bite
  • tooltip:Generating {$s2=5} Energy every $t2 sec.
  • description:{$@spelldesc209782=Lashes out at the target, inflicting ${$209783sw2+$209784sw2} Shadow damage and reducing movement speed by {$209786s1=60}% for {$209786d=8 seconds}. Grants $220901o2 Energy over {$220901d=6 seconds}. |cFFFFFFFFAwards {$220901s1=3} combo $lpoint:points;.|r}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Horrific Appendages 6.2 2.1 47.6sec 34.3sec 29.71% 29.71% 118.6(118.6) 5.8

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:29.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 184.1sec 0.0sec 16.23% 16.23% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Shadow Blades 2.0 0.0 181.1sec 181.1sec 16.94% 18.09% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_blades_1:16.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:121471
  • name:Shadow Blades
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate {$s2=1} additional combo point.
  • description:Draws upon surrounding shadows to empower your weapons, causing auto attacks to deal Shadow damage and abilities that generate combo points to generate 1 additional combo point. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Shadow Dance 28.5 0.0 10.6sec 10.6sec 47.11% 47.11% 0.0(0.0) 28.1

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:5.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadow_dance_1:47.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185313
  • name:Shadow Dance
  • tooltip:
  • description:Allows use of all Stealth abilities and grants all the combat benefits of Stealth for {$d=3 seconds}. Effect not broken from taking damage or attacking. {$?s14062=false}[Movement speed while active is increased by {$1784s3=0}% and damage dealt is increased by {$1784s4=0}%. ]?s108209[Abilities cost {$112942s1=50}% less while active. ][]{$?s31223=false}[Attacks from Shadow Dance and for $31666d after deal {$31223s1=10}% more damage. ][]
  • max_stacks:0
  • duration:3.00
  • cooldown:1.00
  • default_chance:0.00%
Shadowmeld 2.6 0.0 122.7sec 122.7sec 0.03% 0.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowmeld_1:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Stealth 3.8 0.0 83.4sec 122.3sec 1.04% 1.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:150.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:1.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
Subterfuge 3.9 0.0 82.7sec 122.3sec 3.87% 3.87% 0.0(0.0) 3.8

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_subterfuge
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • subterfuge_1:3.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115192
  • name:Subterfuge
  • tooltip:Temporarily concealed in the shadows.
  • description:{$@spelldesc108208=Your abilities requiring Stealth can still be used for {$115192d=3 seconds} after Stealth breaks.$?c3[ Also increases the duration of Shadow Dance by ${$m2/1000} sec.][ Also causes Garrote to deal {$115192s2=100}% increased damage and have no cooldown when used from Stealth or {$115192d=3 seconds} after Stealth breaks.]}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Symbols of Death 1.1 15.6 181.4sec 18.7sec 99.95% 99.28% 15.6(15.6) 0.1

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_symbols_of_death
  • max_stacks:1
  • duration:35.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:1.20

Stack Uptimes

  • symbols_of_death_1:99.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212283
  • name:Symbols of Death
  • tooltip:All damage done increased by {$s1=20}%.
  • description:Invoke ancient symbols of power, increasing all damage you deal by {$s1=20}% for {$d=35 seconds}, and causing your next Shadowstrike to critically strike. Unaffected by the global cooldown.
  • max_stacks:0
  • duration:35.00
  • cooldown:10.00
  • default_chance:0.00%
Vanish 2.9 0.0 122.3sec 122.3sec 2.86% 2.86% 0.0(0.0) 2.8

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:2.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Rogue_Subtlety_T19M
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Subtlety_T19M
backstab Energy 52.7 1845.4 35.0 35.0 3770.1
eviscerate Energy 61.3 2146.0 35.0 35.0 21257.1
eviscerate Combo Points 61.3 336.5 5.5 5.5 135570.7
nightblade Energy 17.4 435.6 25.0 25.0 65479.6
nightblade Combo Points 17.4 95.3 5.5 5.5 299399.6
shadowstrike Energy 119.5 4780.2 40.0 40.0 8450.1
symbols_of_death Energy 16.7 547.8 32.9 32.9 0.0
Resource Gains Type Count Total Average Overflow
backstab Combo Points 55.78 55.72 (12.82%) 1.00 0.06 0.10%
goremaws_bite Combo Points 4.56 13.51 (3.11%) 2.96 0.17 1.27%
shadowstrike Combo Points 126.45 249.62 (57.44%) 1.97 3.29 1.30%
energy_regen Energy 1313.78 3223.40 (33.22%) 2.45 223.97 6.50%
Shadow Techniques Combo Points 93.63 91.80 (21.12%) 0.98 15.90 14.76%
Master of Shadows Energy 31.31 601.37 (6.20%) 19.21 337.81 35.97%
Shadow Blades Combo Points 32.40 23.89 (5.50%) 0.74 8.51 26.25%
Energetic Stabbing Energy 31.59 787.32 (8.11%) 24.92 2.54 0.32%
Goremaw's Bite Energy 27.02 127.10 (1.31%) 4.70 8.01 5.93%
Relentless Strikes Energy 82.24 3453.75 (35.59%) 42.00 153.66 4.26%
Shadow Satyr's Walk Energy 126.45 1510.52 (15.57%) 11.95 6.94 0.46%
Resource RPS-Gain RPS-Loss
Energy 32.28 32.45
Combo Points 1.45 1.44
Combat End Resource Mean Min Max
Energy 48.59 11.02 100.00
Combo Points 2.78 0.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 4.5%

Procs

Count Interval
Weaponmaster 28.3 10.3sec

Statistics & Data Analysis

Fight Length
Sample Data Rogue_Subtlety_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Rogue_Subtlety_T19M Damage Per Second
Count 7499
Mean 479580.22
Minimum 426493.44
Maximum 553484.70
Spread ( max - min ) 126991.26
Range [ ( max - min ) / 2 * 100% ] 13.24%
Standard Deviation 17344.3291
5th Percentile 452735.76
95th Percentile 509643.67
( 95th Percentile - 5th Percentile ) 56907.91
Mean Distribution
Standard Deviation 200.2884
95.00% Confidence Intervall ( 479187.66 - 479972.77 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5024
0.1 Scale Factor Error with Delta=300 2568021
0.05 Scale Factor Error with Delta=300 10272086
0.01 Scale Factor Error with Delta=300 256802164
Priority Target DPS
Sample Data Rogue_Subtlety_T19M Priority Target Damage Per Second
Count 7499
Mean 479580.22
Minimum 426493.44
Maximum 553484.70
Spread ( max - min ) 126991.26
Range [ ( max - min ) / 2 * 100% ] 13.24%
Standard Deviation 17344.3291
5th Percentile 452735.76
95th Percentile 509643.67
( 95th Percentile - 5th Percentile ) 56907.91
Mean Distribution
Standard Deviation 200.2884
95.00% Confidence Intervall ( 479187.66 - 479972.77 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5024
0.1 Scale Factor Error with Delta=300 2568021
0.05 Scale Factor Error with Delta=300 10272086
0.01 Scale Factor Error with Delta=300 256802164
DPS(e)
Sample Data Rogue_Subtlety_T19M Damage Per Second (Effective)
Count 7499
Mean 479580.22
Minimum 426493.44
Maximum 553484.70
Spread ( max - min ) 126991.26
Range [ ( max - min ) / 2 * 100% ] 13.24%
Damage
Sample Data Rogue_Subtlety_T19M Damage
Count 7499
Mean 143880609.02
Minimum 104534822.07
Maximum 193136461.05
Spread ( max - min ) 88601638.98
Range [ ( max - min ) / 2 * 100% ] 30.79%
DTPS
Sample Data Rogue_Subtlety_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rogue_Subtlety_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rogue_Subtlety_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rogue_Subtlety_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rogue_Subtlety_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rogue_Subtlety_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Rogue_Subtlety_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rogue_Subtlety_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 symbols_of_death
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=ssw_er,value=equipped.shadow_satyrs_walk*(10-floor(target.distance*0.5))
0.00 variable,name=ed_threshold,value=energy.deficit<=(20+talent.vigor.enabled*35+talent.master_of_shadows.enabled*25+variable.ssw_er)
8 0.00 call_action_list,name=cds
9 0.00 run_action_list,name=stealthed,if=stealthed|buff.shadowmeld.up
A 0.00 call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
B 0.00 call_action_list,name=stealth_cds,if=combo_points.deficit>=2+talent.premeditation.enabled&(variable.ed_threshold|(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)|target.time_to_die<12)
C 0.00 call_action_list,name=build,if=variable.ed_threshold
actions.build
# count action,conditions
0.00 shuriken_storm,if=spell_targets.shuriken_storm>=2
0.00 gloomblade
D 52.72 backstab
actions.cds
# count action,conditions
E 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
0.00 blood_fury,if=stealthed
0.00 berserking,if=stealthed
0.00 arcane_torrent,if=stealthed&energy.deficit>70
F 2.03 shadow_blades,if=!(stealthed|buff.shadowmeld.up)
G 4.56 goremaws_bite,if=!buff.shadow_dance.up&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
0.00 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.finish
# count action,conditions
0.00 enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
0.00 death_from_above,if=spell_targets.death_from_above>=6
H 17.42 nightblade,target_if=max:target.time_to_die,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
0.00 death_from_above
I 61.31 eviscerate
actions.stealth_cds
# count action,conditions
J 1.93 shadow_dance,if=charges_fractional>=2.65
K 2.86 vanish
L 3.74 shadow_dance,if=charges>=2&combo_points<=1
0.00 pool_resource,for_next=1,extra_amount=40-variable.ssw_er
M 2.61 shadowmeld,if=energy>=40-variable.ssw_er&energy.deficit>10
N 22.80 shadow_dance,if=combo_points<=1
actions.stealthed
# count action,conditions
O 15.65 symbols_of_death,if=buff.shadowmeld.down&((buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|(equipped.shadow_satyrs_walk&energy.time_to_max<0.25))
P 0.00 call_action_list,name=finish,if=combo_points>=5
0.00 shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
Q 119.51 shadowstrike

Sample Sequence

012457QQHFJQQIQIKQQOIJQQHQQILQQIOQQILQQIQILQQIQOQIMQDDHGDILQQOIQQILQQIQQHNOQQIQQINQQIQQIDDDINQQQHQDDIDDINOQQHQQDINQQQOIQDDIGDINQQOIQQHDDDINQQIQQHDDDIKQQINOQQIQQHNQQIQQDIDDHMQDINQQIQQIGDDINQQOQHQDIDDFEDINQQHOQQINQQIQQIDDINQQIQQIDDDHNQQQIOQDIDGHNQQQIQDDINQQIQQIDDDHDDINQQQOIKQQINQQQHOQDIDDIMQDDHNQQQIQDIGDINOQQQIQDI

Sample Sequence Table

time name target resources buffs
Pre flask Rogue_Subtlety_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Rogue_Subtlety_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Rogue_Subtlety_T19M 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
Pre symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, symbols_of_death, death, potion_of_the_old_war
0:00.000 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, stealth, symbols_of_death, death, potion_of_the_old_war
0:01.004 shadowstrike Fluffy_Pillow 87.1/100: 87% energy | 2.0/6: 33% combo_points bloodlust, stealth, subterfuge, symbols_of_death, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:02.009 nightblade Fluffy_Pillow 74.2/100: 74% energy | 5.0/6: 83% combo_points bloodlust, stealth, subterfuge, symbols_of_death, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:03.014 shadow_blades Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:03.014 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:03.014 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:04.020 shadowstrike Fluffy_Pillow 87.1/100: 87% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:05.026 eviscerate Fluffy_Pillow 74.2/100: 74% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:06.030 shadowstrike Fluffy_Pillow 94.3/100: 94% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:07.034 eviscerate Fluffy_Pillow 93.4/100: 93% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:08.038 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:08.038 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, vanish, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:09.041 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:10.046 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, vanish, subterfuge, symbols_of_death, shadow_blades, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:10.046 eviscerate Fluffy_Pillow 65.0/100: 65% energy | 6.0/6: 100% combo_points bloodlust, vanish, subterfuge, symbols_of_death, shadow_blades, death, finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:11.050 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:11.050 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:12.055 shadowstrike Fluffy_Pillow 87.1/100: 87% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:13.058 nightblade Fluffy_Pillow 99.2/100: 99% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), finality_nightblade(5), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:14.062 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:15.068 shadowstrike Fluffy_Pillow 87.1/100: 87% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:16.074 eviscerate Fluffy_Pillow 86.2/100: 86% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, blood_frenzy, potion_of_the_old_war
0:17.078 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, shadow_blades, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:17.078 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, horrific_appendages, blood_frenzy, potion_of_the_old_war
0:18.083 shadowstrike Fluffy_Pillow 86.7/100: 87% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
0:19.088 eviscerate Fluffy_Pillow 72.6/100: 73% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, horrific_appendages, potion_of_the_old_war
0:20.092 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, potion_of_the_old_war
0:20.092 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, death, finality_eviscerate(6), horrific_appendages, potion_of_the_old_war
0:21.096 shadowstrike Fluffy_Pillow 75.8/100: 76% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, potion_of_the_old_war
0:22.099 eviscerate Fluffy_Pillow 61.7/100: 62% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
0:23.105 shadow_dance Fluffy_Pillow 80.6/100: 81% energy | 1.0/6: 17% combo_points bloodlust, symbols_of_death, shadow_blades
0:23.105 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades
0:24.110 shadowstrike Fluffy_Pillow 87.1/100: 87% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, blood_frenzy
0:25.113 eviscerate Fluffy_Pillow 74.2/100: 74% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, blood_frenzy
0:26.117 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy
0:27.122 eviscerate Fluffy_Pillow 87.1/100: 87% energy | 6.0/6: 100% combo_points bloodlust, shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), horrific_appendages, blood_frenzy
0:28.126 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, horrific_appendages, blood_frenzy
0:28.126 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
0:29.131 shadowstrike Fluffy_Pillow 87.1/100: 87% energy | 3.0/6: 50% combo_points bloodlust, shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
0:30.137 eviscerate Fluffy_Pillow 74.2/100: 74% energy | 5.0/6: 83% combo_points bloodlust, shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
0:31.142 shadowstrike Fluffy_Pillow 94.3/100: 94% energy | 0.0/6: 0% combo_points bloodlust, shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
0:32.144 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
0:32.144 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 4.0/6: 67% combo_points bloodlust, shadow_dance, symbols_of_death, death, finality_eviscerate(5), horrific_appendages, blood_frenzy
0:33.147 eviscerate Fluffy_Pillow 52.1/100: 52% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
0:34.152 shadowmeld Fluffy_Pillow 72.2/100: 72% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, horrific_appendages, blood_frenzy
0:34.152 shadowstrike Fluffy_Pillow 72.2/100: 72% energy | 0.0/6: 0% combo_points bloodlust, shadowmeld, symbols_of_death, horrific_appendages, blood_frenzy
0:35.157 backstab Fluffy_Pillow 59.3/100: 59% energy | 3.0/6: 50% combo_points bloodlust, symbols_of_death, horrific_appendages, blood_frenzy
0:36.162 Waiting 0.500 sec 39.3/100: 39% energy | 4.0/6: 67% combo_points bloodlust, symbols_of_death, horrific_appendages, blood_frenzy
0:36.662 backstab Fluffy_Pillow 46.9/100: 47% energy | 4.0/6: 67% combo_points bloodlust, symbols_of_death, horrific_appendages, blood_frenzy
0:37.665 nightblade Fluffy_Pillow 26.2/100: 26% energy | 6.0/6: 100% combo_points bloodlust, symbols_of_death, horrific_appendages
0:38.670 goremaws_bite Fluffy_Pillow 55.1/100: 55% energy | 0.0/6: 0% combo_points bloodlust, symbols_of_death, finality_nightblade(6)
0:39.673 backstab Fluffy_Pillow 73.9/100: 74% energy | 3.0/6: 50% combo_points bloodlust, symbols_of_death, goremaws_bite, finality_nightblade(6)
0:40.679 eviscerate Fluffy_Pillow 54.9/100: 55% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6)
0:41.683 shadow_dance Fluffy_Pillow 75.5/100: 76% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
0:41.683 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
0:42.686 shadowstrike Fluffy_Pillow 87.6/100: 88% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
0:43.690 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5), finality_nightblade(6)
0:43.690 eviscerate Fluffy_Pillow 65.0/100: 65% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(5), finality_nightblade(6)
0:44.695 shadowstrike Fluffy_Pillow 85.7/100: 86% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death, finality_nightblade(6)
0:45.698 shadowstrike Fluffy_Pillow 68.3/100: 68% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_nightblade(6)
0:46.702 eviscerate Fluffy_Pillow 51.0/100: 51% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6)
0:47.706 shadow_dance Fluffy_Pillow 66.6/100: 67% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
0:47.706 shadowstrike Fluffy_Pillow 96.6/100: 97% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
0:48.712 shadowstrike Fluffy_Pillow 91.3/100: 91% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
0:49.717 eviscerate Fluffy_Pillow 73.9/100: 74% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
0:50.721 shadowstrike Fluffy_Pillow 89.6/100: 90% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(6)
0:51.727 shadowstrike Fluffy_Pillow 72.3/100: 72% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_nightblade(6)
0:52.733 nightblade Fluffy_Pillow 54.9/100: 55% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6)
0:53.736 shadow_dance Fluffy_Pillow 80.6/100: 81% energy | 0.0/6: 0% combo_points symbols_of_death
0:53.736 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death
0:53.736 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death
0:54.739 shadowstrike Fluffy_Pillow 72.6/100: 73% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death
0:55.743 eviscerate Fluffy_Pillow 80.3/100: 80% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death
0:56.749 shadowstrike Fluffy_Pillow 96.0/100: 96% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
0:57.753 shadowstrike Fluffy_Pillow 78.6/100: 79% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
0:58.756 eviscerate Fluffy_Pillow 61.3/100: 61% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
0:59.760 shadow_dance Fluffy_Pillow 76.9/100: 77% energy | 0.0/6: 0% combo_points symbols_of_death
0:59.760 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death
1:00.764 shadowstrike Fluffy_Pillow 82.7/100: 83% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death
1:01.769 eviscerate Fluffy_Pillow 90.3/100: 90% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death
1:02.773 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
1:03.777 shadowstrike Fluffy_Pillow 82.7/100: 83% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
1:04.783 eviscerate Fluffy_Pillow 90.3/100: 90% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
1:05.789 backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points symbols_of_death
1:06.792 backstab Fluffy_Pillow 75.6/100: 76% energy | 2.0/6: 33% combo_points symbols_of_death
1:07.797 backstab Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death
1:08.800 Waiting 0.800 sec 26.9/100: 27% energy | 4.0/6: 67% combo_points symbols_of_death
1:09.600 eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death
1:10.605 shadow_dance Fluffy_Pillow 51.1/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6)
1:10.605 shadowstrike Fluffy_Pillow 81.1/100: 81% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6)
1:11.610 shadowstrike Fluffy_Pillow 63.7/100: 64% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6)
1:12.617 shadowstrike Fluffy_Pillow 46.4/100: 46% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6)
1:13.622 nightblade Fluffy_Pillow 29.1/100: 29% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6)
1:14.626 shadowstrike Fluffy_Pillow 94.9/100: 95% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
1:15.631 backstab Fluffy_Pillow 78.5/100: 79% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
1:16.636 backstab Fluffy_Pillow 55.1/100: 55% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
1:17.640 Waiting 0.300 sec 31.7/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
1:17.940 eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), blood_frenzy
1:18.944 backstab Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
1:19.947 Waiting 1.600 sec 28.4/100: 28% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
1:21.547 backstab Fluffy_Pillow 46.9/100: 47% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages, blood_frenzy
1:22.551 Waiting 1.333 sec 23.5/100: 23% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages, blood_frenzy
1:23.884 eviscerate Fluffy_Pillow 38.9/100: 39% energy | 6.0/6: 100% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages, blood_frenzy
1:24.888 shadow_dance Fluffy_Pillow 95.0/100: 95% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:24.888 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:24.888 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:25.893 shadowstrike Fluffy_Pillow 47.7/100: 48% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:26.897 Waiting 0.300 sec 30.3/100: 30% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:27.197 nightblade Fluffy_Pillow 33.5/100: 33% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages
1:28.203 shadowstrike Fluffy_Pillow 59.2/100: 59% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), horrific_appendages
1:29.207 shadowstrike Fluffy_Pillow 66.8/100: 67% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), horrific_appendages
1:30.211 backstab Fluffy_Pillow 49.5/100: 49% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages
1:31.214 Waiting 1.000 sec 25.1/100: 25% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages
1:32.214 eviscerate Fluffy_Pillow 35.7/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6), horrific_appendages
1:33.218 shadow_dance Fluffy_Pillow 91.5/100: 92% energy | 0.0/6: 0% combo_points symbols_of_death, horrific_appendages, blood_frenzy
1:33.218 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
1:34.224 shadowstrike Fluffy_Pillow 83.6/100: 84% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, blood_frenzy
1:35.227 shadowstrike Fluffy_Pillow 92.2/100: 92% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, blood_frenzy
1:36.231 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, blood_frenzy
1:36.231 eviscerate Fluffy_Pillow 65.0/100: 65% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, death, blood_frenzy
1:37.235 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(6), blood_frenzy
1:38.237 backstab Fluffy_Pillow 83.6/100: 84% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:39.241 backstab Fluffy_Pillow 60.2/100: 60% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:40.246 eviscerate Fluffy_Pillow 36.8/100: 37% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
1:41.249 goremaws_bite Fluffy_Pillow 53.4/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, blood_frenzy
1:42.255 backstab Fluffy_Pillow 70.0/100: 70% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, blood_frenzy
1:43.260 eviscerate Fluffy_Pillow 51.4/100: 51% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite
1:44.264 shadow_dance Fluffy_Pillow 72.1/100: 72% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:44.264 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:45.268 shadowstrike Fluffy_Pillow 87.7/100: 88% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:46.273 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_eviscerate(5)
1:46.273 eviscerate Fluffy_Pillow 65.0/100: 65% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, goremaws_bite, death, finality_eviscerate(5)
1:47.277 shadowstrike Fluffy_Pillow 85.7/100: 86% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death
1:48.282 shadowstrike Fluffy_Pillow 68.3/100: 68% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death
1:49.288 nightblade Fluffy_Pillow 51.0/100: 51% energy | 5.0/6: 83% combo_points symbols_of_death
1:50.291 backstab Fluffy_Pillow 76.6/100: 77% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
1:51.295 backstab Fluffy_Pillow 52.3/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(5)
1:52.298 Waiting 1.800 sec 27.9/100: 28% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
1:54.098 backstab Fluffy_Pillow 47.0/100: 47% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
1:55.101 Waiting 1.221 sec 22.6/100: 23% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
1:56.322 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
1:57.326 shadow_dance Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5), horrific_appendages
1:57.326 shadowstrike Fluffy_Pillow 81.3/100: 81% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), horrific_appendages
1:58.329 shadowstrike Fluffy_Pillow 64.8/100: 65% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), horrific_appendages, blood_frenzy
1:59.333 eviscerate Fluffy_Pillow 48.4/100: 48% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5), horrific_appendages, blood_frenzy
2:00.337 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
2:01.341 shadowstrike Fluffy_Pillow 48.6/100: 49% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
2:02.345 nightblade Fluffy_Pillow 32.2/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
2:03.350 backstab Fluffy_Pillow 58.8/100: 59% energy | 1.0/6: 17% combo_points symbols_of_death, horrific_appendages, blood_frenzy
2:04.355 Waiting 1.000 sec 35.5/100: 35% energy | 2.0/6: 33% combo_points symbols_of_death, blood_frenzy
2:05.355 backstab Fluffy_Pillow 47.0/100: 47% energy | 2.0/6: 33% combo_points symbols_of_death, blood_frenzy
2:06.359 Waiting 2.120 sec 23.6/100: 24% energy | 3.0/6: 50% combo_points symbols_of_death, blood_frenzy
2:08.479 backstab Fluffy_Pillow 47.0/100: 47% energy | 4.0/6: 67% combo_points symbols_of_death
2:09.484 Waiting 1.219 sec 22.7/100: 23% energy | 6.0/6: 100% combo_points symbols_of_death
2:10.703 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death
2:11.708 vanish Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6)
2:11.708 shadowstrike Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points vanish, symbols_of_death, finality_eviscerate(6)
2:12.713 Waiting 0.500 sec 34.9/100: 35% energy | 3.0/6: 50% combo_points vanish, subterfuge, symbols_of_death, finality_eviscerate(6), blood_frenzy
2:13.213 shadowstrike Fluffy_Pillow 40.6/100: 41% energy | 3.0/6: 50% combo_points vanish, subterfuge, symbols_of_death, finality_eviscerate(6), blood_frenzy
2:14.217 Waiting 0.500 sec 24.2/100: 24% energy | 5.0/6: 83% combo_points vanish, subterfuge, symbols_of_death, finality_eviscerate(6), blood_frenzy
2:14.717 eviscerate Fluffy_Pillow 60.0/100: 60% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
2:15.726 shadow_dance Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
2:15.726 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
2:15.726 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(5), blood_frenzy
2:16.732 shadowstrike Fluffy_Pillow 48.6/100: 49% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
2:17.735 eviscerate Fluffy_Pillow 57.2/100: 57% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
2:18.740 shadowstrike Fluffy_Pillow 73.8/100: 74% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, blood_frenzy
2:19.743 shadowstrike Fluffy_Pillow 82.4/100: 82% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, blood_frenzy
2:20.748 nightblade Fluffy_Pillow 66.0/100: 66% energy | 5.0/6: 83% combo_points symbols_of_death, blood_frenzy
2:21.753 shadow_dance Fluffy_Pillow 92.6/100: 93% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
2:21.753 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
2:22.757 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
2:23.763 eviscerate Fluffy_Pillow 82.7/100: 83% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_nightblade(5)
2:24.770 shadowstrike Fluffy_Pillow 98.4/100: 98% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:25.774 shadowstrike Fluffy_Pillow 81.0/100: 81% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:26.779 backstab Fluffy_Pillow 63.7/100: 64% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:27.784 eviscerate Fluffy_Pillow 39.3/100: 39% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(5)
2:28.788 backstab Fluffy_Pillow 55.0/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5)
2:29.793 Waiting 1.500 sec 30.6/100: 31% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(5)
2:31.293 backstab Fluffy_Pillow 46.7/100: 47% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
2:32.298 Waiting 1.249 sec 23.3/100: 23% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
2:33.547 nightblade Fluffy_Pillow 37.7/100: 38% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
2:34.552 shadowmeld Fluffy_Pillow 64.3/100: 64% energy | 0.0/6: 0% combo_points symbols_of_death, blood_frenzy
2:34.552 shadowstrike Fluffy_Pillow 64.3/100: 64% energy | 0.0/6: 0% combo_points shadowmeld, symbols_of_death, blood_frenzy
2:35.557 backstab Fluffy_Pillow 47.9/100: 48% energy | 2.0/6: 33% combo_points symbols_of_death, blood_frenzy
2:36.561 Waiting 1.000 sec 24.5/100: 25% energy | 5.0/6: 83% combo_points symbols_of_death, blood_frenzy
2:37.561 eviscerate Fluffy_Pillow 36.1/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, horrific_appendages, blood_frenzy
2:38.565 shadow_dance Fluffy_Pillow 52.7/100: 53% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:38.565 shadowstrike Fluffy_Pillow 82.7/100: 83% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:39.571 shadowstrike Fluffy_Pillow 66.3/100: 66% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:40.576 eviscerate Fluffy_Pillow 49.9/100: 50% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:41.580 shadowstrike Fluffy_Pillow 66.5/100: 67% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
2:42.584 shadowstrike Fluffy_Pillow 50.1/100: 50% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, horrific_appendages, blood_frenzy
2:43.587 Waiting 0.400 sec 33.7/100: 34% energy | 4.0/6: 67% combo_points symbols_of_death, horrific_appendages, blood_frenzy
2:43.987 eviscerate Fluffy_Pillow 38.3/100: 38% energy | 5.0/6: 83% combo_points symbols_of_death, horrific_appendages, blood_frenzy
2:44.992 goremaws_bite Fluffy_Pillow 54.9/100: 55% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages, blood_frenzy
2:45.996 backstab Fluffy_Pillow 71.1/100: 71% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages
2:46.999 backstab Fluffy_Pillow 51.7/100: 52% energy | 4.0/6: 67% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages
2:48.005 Waiting 0.300 sec 32.4/100: 32% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages
2:48.305 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(5), horrific_appendages
2:49.310 shadow_dance Fluffy_Pillow 57.2/100: 57% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, blood_frenzy
2:49.310 shadowstrike Fluffy_Pillow 87.2/100: 87% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, blood_frenzy
2:50.314 shadowstrike Fluffy_Pillow 75.8/100: 76% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, goremaws_bite, blood_frenzy
2:51.318 symbols_of_death Fluffy_Pillow 89.4/100: 89% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, blood_frenzy
2:51.318 shadowstrike Fluffy_Pillow 54.4/100: 54% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, death, blood_frenzy
2:52.321 nightblade Fluffy_Pillow 38.0/100: 38% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, blood_frenzy
2:53.324 shadowstrike Fluffy_Pillow 64.6/100: 65% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), blood_frenzy
2:54.329 backstab Fluffy_Pillow 48.2/100: 48% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
2:55.333 Waiting 0.900 sec 24.8/100: 25% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
2:56.233 eviscerate Fluffy_Pillow 35.2/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
2:57.239 backstab Fluffy_Pillow 51.8/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
2:58.243 Waiting 1.700 sec 28.4/100: 28% energy | 1.0/6: 17% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
2:59.943 backstab Fluffy_Pillow 46.5/100: 47% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:00.947 Waiting 1.868 sec 22.2/100: 22% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:02.815 shadow_blades Fluffy_Pillow 42.0/100: 42% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
3:03.014 potion Fluffy_Pillow 44.1/100: 44% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6)
3:03.014 Waiting 0.200 sec 44.1/100: 44% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
3:03.214 backstab Fluffy_Pillow 46.2/100: 46% energy | 4.0/6: 67% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
3:04.217 Waiting 1.297 sec 21.8/100: 22% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
3:05.514 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(5), finality_nightblade(6), potion_of_the_old_war
3:06.519 shadow_dance Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:06.519 shadowstrike Fluffy_Pillow 81.3/100: 81% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:07.524 shadowstrike Fluffy_Pillow 88.9/100: 89% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:08.528 nightblade Fluffy_Pillow 96.6/100: 97% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_nightblade(6), potion_of_the_old_war
3:09.532 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, potion_of_the_old_war
3:09.532 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, death, potion_of_the_old_war
3:10.536 shadowstrike Fluffy_Pillow 48.6/100: 49% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:11.540 Waiting 0.300 sec 32.2/100: 32% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:11.840 eviscerate Fluffy_Pillow 35.7/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:12.845 shadow_dance Fluffy_Pillow 52.3/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:12.845 shadowstrike Fluffy_Pillow 82.3/100: 82% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:13.850 shadowstrike Fluffy_Pillow 65.9/100: 66% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:14.854 eviscerate Fluffy_Pillow 49.5/100: 49% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:15.858 shadowstrike Fluffy_Pillow 66.1/100: 66% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:16.861 shadowstrike Fluffy_Pillow 74.7/100: 75% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:17.865 eviscerate Fluffy_Pillow 58.3/100: 58% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:18.869 backstab Fluffy_Pillow 74.9/100: 75% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:19.874 backstab Fluffy_Pillow 51.5/100: 51% energy | 3.0/6: 50% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:20.881 Waiting 0.600 sec 28.1/100: 28% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:21.481 eviscerate Fluffy_Pillow 35.0/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:22.486 shadow_dance Fluffy_Pillow 51.7/100: 52% energy | 1.0/6: 17% combo_points symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:22.486 shadowstrike Fluffy_Pillow 81.7/100: 82% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:23.493 shadowstrike Fluffy_Pillow 65.3/100: 65% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:24.498 eviscerate Fluffy_Pillow 60.9/100: 61% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, shadow_blades, blood_frenzy, potion_of_the_old_war
3:25.502 shadowstrike Fluffy_Pillow 77.5/100: 77% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:26.508 shadowstrike Fluffy_Pillow 60.5/100: 61% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, shadow_blades, finality_eviscerate(6), potion_of_the_old_war
3:27.513 eviscerate Fluffy_Pillow 68.2/100: 68% energy | 6.0/6: 100% combo_points symbols_of_death, shadow_blades, finality_eviscerate(6), blood_frenzy, potion_of_the_old_war
3:28.518 backstab Fluffy_Pillow 84.8/100: 85% energy | 0.0/6: 0% combo_points symbols_of_death, blood_frenzy
3:29.522 backstab Fluffy_Pillow 61.4/100: 61% energy | 1.0/6: 17% combo_points symbols_of_death, blood_frenzy
3:30.527 Waiting 0.700 sec 38.0/100: 38% energy | 3.0/6: 50% combo_points symbols_of_death, blood_frenzy
3:31.227 backstab Fluffy_Pillow 46.1/100: 46% energy | 3.0/6: 50% combo_points symbols_of_death, blood_frenzy
3:32.233 Waiting 1.297 sec 22.7/100: 23% energy | 4.0/6: 67% combo_points symbols_of_death, horrific_appendages, blood_frenzy
3:33.530 nightblade Fluffy_Pillow 37.7/100: 38% energy | 5.0/6: 83% combo_points symbols_of_death, horrific_appendages, blood_frenzy
3:34.534 shadow_dance Fluffy_Pillow 64.3/100: 64% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
3:34.534 shadowstrike Fluffy_Pillow 94.3/100: 94% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
3:35.540 shadowstrike Fluffy_Pillow 77.9/100: 78% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
3:36.544 shadowstrike Fluffy_Pillow 61.5/100: 62% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages, blood_frenzy
3:37.547 eviscerate Fluffy_Pillow 45.1/100: 45% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_nightblade(5), horrific_appendages
3:38.550 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages
3:38.550 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages
3:39.555 backstab Fluffy_Pillow 47.7/100: 48% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages
3:40.558 Waiting 1.160 sec 23.3/100: 23% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages
3:41.718 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(5), horrific_appendages
3:42.723 backstab Fluffy_Pillow 51.3/100: 51% energy | 1.0/6: 17% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
3:43.727 Waiting 1.100 sec 26.9/100: 27% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(5), horrific_appendages
3:44.827 goremaws_bite Fluffy_Pillow 39.2/100: 39% energy | 2.0/6: 33% combo_points symbols_of_death, finality_nightblade(5), blood_frenzy
3:45.996 nightblade Fluffy_Pillow 57.8/100: 58% energy | 6.0/6: 100% combo_points symbols_of_death, goremaws_bite, finality_nightblade(5), blood_frenzy
3:47.000 shadow_dance Fluffy_Pillow 89.4/100: 89% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, blood_frenzy
3:47.000 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, blood_frenzy
3:48.005 shadowstrike Fluffy_Pillow 88.6/100: 89% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, goremaws_bite, blood_frenzy
3:49.010 shadowstrike Fluffy_Pillow 77.2/100: 77% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, goremaws_bite, blood_frenzy
3:50.014 eviscerate Fluffy_Pillow 65.8/100: 66% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, goremaws_bite, blood_frenzy
3:51.019 shadowstrike Fluffy_Pillow 87.4/100: 87% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(6), blood_frenzy
3:52.024 backstab Fluffy_Pillow 71.0/100: 71% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
3:53.028 backstab Fluffy_Pillow 47.6/100: 48% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
3:54.032 Waiting 1.100 sec 24.2/100: 24% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(6), blood_frenzy
3:55.132 eviscerate Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(6)
3:56.138 shadow_dance Fluffy_Pillow 51.7/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death
3:56.138 shadowstrike Fluffy_Pillow 81.7/100: 82% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death
3:57.143 shadowstrike Fluffy_Pillow 64.3/100: 64% energy | 3.0/6: 50% combo_points shadow_dance, symbols_of_death
3:58.147 eviscerate Fluffy_Pillow 72.0/100: 72% energy | 5.0/6: 83% combo_points shadow_dance, symbols_of_death
3:59.152 shadowstrike Fluffy_Pillow 87.6/100: 88% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
4:00.157 shadowstrike Fluffy_Pillow 95.3/100: 95% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5)
4:01.160 eviscerate Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
4:02.163 backstab Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points symbols_of_death, blood_frenzy
4:03.168 backstab Fluffy_Pillow 76.6/100: 77% energy | 3.0/6: 50% combo_points symbols_of_death, blood_frenzy
4:04.173 backstab Fluffy_Pillow 53.2/100: 53% energy | 4.0/6: 67% combo_points symbols_of_death, blood_frenzy
4:05.178 Waiting 0.400 sec 29.8/100: 30% energy | 6.0/6: 100% combo_points symbols_of_death, blood_frenzy
4:05.578 nightblade Fluffy_Pillow 34.5/100: 34% energy | 6.0/6: 100% combo_points symbols_of_death, blood_frenzy
4:06.581 backstab Fluffy_Pillow 61.0/100: 61% energy | 0.0/6: 0% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:07.586 Waiting 0.800 sec 37.6/100: 38% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:08.386 backstab Fluffy_Pillow 46.9/100: 47% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:09.390 Waiting 1.030 sec 23.5/100: 23% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:10.420 eviscerate Fluffy_Pillow 35.4/100: 35% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:11.426 shadow_dance Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:11.426 shadowstrike Fluffy_Pillow 82.0/100: 82% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:12.431 shadowstrike Fluffy_Pillow 65.6/100: 66% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:13.436 shadowstrike Fluffy_Pillow 74.2/100: 74% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:14.440 symbols_of_death Fluffy_Pillow 57.6/100: 58% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6)
4:14.440 Waiting 1.229 sec 22.6/100: 23% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(6)
4:15.669 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(5), finality_nightblade(6)
4:16.674 vanish Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, death, finality_nightblade(6)
4:16.674 shadowstrike Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points vanish, symbols_of_death, death, finality_nightblade(6)
4:17.680 Waiting 0.600 sec 34.1/100: 34% energy | 2.0/6: 33% combo_points vanish, subterfuge, symbols_of_death, finality_nightblade(6), blood_frenzy
4:18.280 shadowstrike Fluffy_Pillow 41.0/100: 41% energy | 2.0/6: 33% combo_points vanish, subterfuge, symbols_of_death, finality_nightblade(6), blood_frenzy
4:19.284 Waiting 0.400 sec 24.6/100: 25% energy | 5.0/6: 83% combo_points vanish, subterfuge, symbols_of_death, finality_nightblade(6), blood_frenzy
4:19.684 eviscerate Fluffy_Pillow 59.2/100: 59% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:20.688 shadow_dance Fluffy_Pillow 75.8/100: 76% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:20.688 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:21.694 shadowstrike Fluffy_Pillow 83.6/100: 84% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:22.699 shadowstrike Fluffy_Pillow 67.2/100: 67% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:23.703 nightblade Fluffy_Pillow 75.8/100: 76% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:24.708 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), blood_frenzy
4:24.708 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 1.0/6: 17% combo_points shadow_dance, symbols_of_death, death, finality_eviscerate(5), blood_frenzy
4:25.713 backstab Fluffy_Pillow 48.6/100: 49% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
4:26.719 Waiting 0.900 sec 25.2/100: 25% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), blood_frenzy
4:27.619 eviscerate Fluffy_Pillow 35.5/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5)
4:28.625 backstab Fluffy_Pillow 51.2/100: 51% energy | 2.0/6: 33% combo_points symbols_of_death
4:29.630 Waiting 1.900 sec 26.9/100: 27% energy | 3.0/6: 50% combo_points symbols_of_death
4:31.530 backstab Fluffy_Pillow 47.0/100: 47% energy | 3.0/6: 50% combo_points symbols_of_death
4:32.536 Waiting 1.217 sec 22.7/100: 23% energy | 4.0/6: 67% combo_points symbols_of_death
4:33.753 eviscerate Fluffy_Pillow 35.6/100: 36% energy | 5.0/6: 83% combo_points symbols_of_death, horrific_appendages
4:34.757 shadowmeld Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
4:34.757 shadowstrike Fluffy_Pillow 51.3/100: 51% energy | 0.0/6: 0% combo_points shadowmeld, symbols_of_death, finality_eviscerate(5), horrific_appendages
4:35.761 Waiting 1.200 sec 33.9/100: 34% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
4:36.961 backstab Fluffy_Pillow 46.6/100: 47% energy | 2.0/6: 33% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
4:37.965 Waiting 2.255 sec 22.3/100: 22% energy | 3.0/6: 50% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
4:40.220 backstab Fluffy_Pillow 46.2/100: 46% energy | 4.0/6: 67% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
4:41.226 Waiting 0.394 sec 21.9/100: 22% energy | 5.0/6: 83% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
4:41.620 nightblade Fluffy_Pillow 26.1/100: 26% energy | 6.0/6: 100% combo_points symbols_of_death, finality_eviscerate(5), horrific_appendages
4:42.625 shadow_dance Fluffy_Pillow 51.9/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy
4:42.625 shadowstrike Fluffy_Pillow 81.9/100: 82% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy
4:43.629 shadowstrike Fluffy_Pillow 65.5/100: 66% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy
4:44.634 shadowstrike Fluffy_Pillow 49.2/100: 49% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), horrific_appendages, blood_frenzy
4:45.639 Waiting 0.200 sec 32.8/100: 33% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:45.839 eviscerate Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_eviscerate(5), finality_nightblade(6), blood_frenzy
4:46.842 shadowstrike Fluffy_Pillow 51.7/100: 52% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), blood_frenzy
4:47.846 Waiting 1.000 sec 35.3/100: 35% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:48.846 backstab Fluffy_Pillow 46.8/100: 47% energy | 3.0/6: 50% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:49.849 Waiting 1.038 sec 23.4/100: 23% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:50.887 eviscerate Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points symbols_of_death, finality_nightblade(6), blood_frenzy
4:51.893 goremaws_bite Fluffy_Pillow 52.0/100: 52% energy | 0.0/6: 0% combo_points symbols_of_death, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy
4:52.899 backstab Fluffy_Pillow 68.6/100: 69% energy | 3.0/6: 50% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy
4:53.902 eviscerate Fluffy_Pillow 50.2/100: 50% energy | 5.0/6: 83% combo_points symbols_of_death, goremaws_bite, finality_eviscerate(6), finality_nightblade(6), horrific_appendages, blood_frenzy
4:54.906 shadow_dance Fluffy_Pillow 71.8/100: 72% energy | 0.0/6: 0% combo_points symbols_of_death, goremaws_bite, finality_nightblade(6), horrific_appendages, blood_frenzy
4:54.906 symbols_of_death Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(6), horrific_appendages, blood_frenzy
4:54.906 shadowstrike Fluffy_Pillow 65.0/100: 65% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, goremaws_bite, death, finality_nightblade(6), horrific_appendages, blood_frenzy
4:55.911 shadowstrike Fluffy_Pillow 53.6/100: 54% energy | 2.0/6: 33% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(6), horrific_appendages, blood_frenzy
4:56.915 shadowstrike Fluffy_Pillow 42.2/100: 42% energy | 4.0/6: 67% combo_points shadow_dance, symbols_of_death, goremaws_bite, finality_nightblade(6), horrific_appendages, blood_frenzy
4:57.920 eviscerate Fluffy_Pillow 55.5/100: 56% energy | 6.0/6: 100% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), horrific_appendages
4:58.924 shadowstrike Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points shadow_dance, symbols_of_death, finality_nightblade(6), horrific_appendages
4:59.929 backstab Fluffy_Pillow 82.7/100: 83% energy | 4.0/6: 67% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages
5:00.932 eviscerate Fluffy_Pillow 58.3/100: 58% energy | 5.0/6: 83% combo_points symbols_of_death, finality_nightblade(6), horrific_appendages

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8802 8477 0
Agility 28117 26411 16120 (10936)
Stamina 41004 41004 25283
Intellect 5325 5000 0
Spirit 0 0 0
Health 2460240 2460240 0
Energy 100 100 0
Combo Points 6 6 0
Crit 32.27% 32.27% 5694
Haste 6.08% 6.08% 1976
Damage / Heal Versatility 9.58% 8.65% 3458
Attack Power 28117 26411 0
Mastery 85.34% 85.34% 8021
Armor 2249 2249 2249
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 882.00
Local Head Mask of Multitudinous Eyes
ilevel: 880, stats: { 295 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Vers }
Local Neck Krakentooth Necklace
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Otherworldy Leather Mantle
ilevel: 880, stats: { 273 Armor, +1930 Sta, +1287 AgiInt, +665 Crit, +430 Mastery }
Local Chest Scarred Ragefang Chestpiece
ilevel: 880, stats: { 364 Armor, +2573 Sta, +1715 AgiInt, +918 Mastery, +542 Haste }
Local Waist Lifeless Buckled Girdle
ilevel: 880, stats: { 205 Armor, +1930 Sta, +1287 AgiInt, +641 Mastery, +454 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 880, stats: { 318 Armor, +2573 Sta, +1715 AgiInt, +1043 Crit, +417 Mastery }
Local Feet Shadow Satyr's Walk
ilevel: 895, stats: { 263 Armor, +2219 Sta, +1479 Agi, +745 Haste, +413 Mastery }
Local Wrists Wristwraps of Broken Trust
ilevel: 880, stats: { 159 Armor, +1447 Sta, +965 AgiInt, +499 Mastery, +323 Crit }
Local Hands Dreamsculptor's Gloves
ilevel: 880, stats: { 227 Armor, +1930 Sta, +1287 AgiInt, +689 Haste, +406 Crit }
Local Finger1 Ring of Deep Sea Pearls
ilevel: 860, stats: { +1201 Sta, +1198 Mastery, +708 Vers }, enchant: { +200 Vers }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Vers }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Back Gossamer-Spun Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +481 Mastery, +340 Crit }, enchant: { +200 Agi }
Local Main Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Fangs of the Devourer
ilevel: 906, weapon: { 3844 - 7140, 1.8 }, stats: { +937 Agi, +1405 Sta, +350 Crit, +337 Mastery }

Talents

Level
15 Master of Subtlety (Subtlety Rogue) Weaponmaster (Subtlety Rogue) Gloomblade (Subtlety Rogue)
30 Nightstalker Subterfuge Shadow Focus
45 Deeper Stratagem Anticipation Vigor
60 Soothing Darkness (Subtlety Rogue) Elusiveness Cheat Death
75 Strike from the Shadows (Subtlety Rogue) Prey on the Weak Tangled Shadow (Subtlety Rogue)
90 Premeditation (Subtlety Rogue) Alacrity Enveloping Shadows (Subtlety Rogue)
100 Master of Shadows (Subtlety Rogue) Marked for Death Death from Above

Profile

rogue="Rogue_Subtlety_T19M"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=2210011
artifact=17:0:0:0:0:851:1:852:3:853:3:854:3:855:3:856:3:857:3:858:3:859:3:860:3:861:1:862:1:863:1:864:1:865:1:866:1:1349:1
spec=subtlety

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/symbols_of_death

# Executed every time the actor is available.
actions=variable,name=ssw_er,value=equipped.shadow_satyrs_walk*(10-floor(target.distance*0.5))
actions+=/variable,name=ed_threshold,value=energy.deficit<=(20+talent.vigor.enabled*35+talent.master_of_shadows.enabled*25+variable.ssw_er)
actions+=/call_action_list,name=cds
actions+=/run_action_list,name=stealthed,if=stealthed|buff.shadowmeld.up
actions+=/call_action_list,name=finish,if=combo_points>=5|(combo_points>=4&spell_targets.shuriken_storm>=3&spell_targets.shuriken_storm<=4)
actions+=/call_action_list,name=stealth_cds,if=combo_points.deficit>=2+talent.premeditation.enabled&(variable.ed_threshold|(cooldown.shadowmeld.up&!cooldown.vanish.up&cooldown.shadow_dance.charges<=1)|target.time_to_die<12)
actions+=/call_action_list,name=build,if=variable.ed_threshold

actions.build=shuriken_storm,if=spell_targets.shuriken_storm>=2
actions.build+=/gloomblade
actions.build+=/backstab

actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.shadow_blades.up
actions.cds+=/blood_fury,if=stealthed
actions.cds+=/berserking,if=stealthed
actions.cds+=/arcane_torrent,if=stealthed&energy.deficit>70
actions.cds+=/shadow_blades,if=!(stealthed|buff.shadowmeld.up)
actions.cds+=/goremaws_bite,if=!buff.shadow_dance.up&((combo_points.deficit>=4-(time<10)*2&energy.deficit>50+talent.vigor.enabled*25-(time>=10)*15)|target.time_to_die<8)
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|(raid_event.adds.in>40&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)

actions.finish=enveloping_shadows,if=buff.enveloping_shadows.remains<target.time_to_die&buff.enveloping_shadows.remains<=combo_points*1.8
actions.finish+=/death_from_above,if=spell_targets.death_from_above>=6
actions.finish+=/nightblade,target_if=max:target.time_to_die,if=target.time_to_die>8&((refreshable&(!finality|buff.finality_nightblade.up))|remains<tick_time)
actions.finish+=/death_from_above
actions.finish+=/eviscerate

actions.stealth_cds=shadow_dance,if=charges_fractional>=2.65
actions.stealth_cds+=/vanish
actions.stealth_cds+=/shadow_dance,if=charges>=2&combo_points<=1
actions.stealth_cds+=/pool_resource,for_next=1,extra_amount=40-variable.ssw_er
actions.stealth_cds+=/shadowmeld,if=energy>=40-variable.ssw_er&energy.deficit>10
actions.stealth_cds+=/shadow_dance,if=combo_points<=1

actions.stealthed=symbols_of_death,if=buff.shadowmeld.down&((buff.symbols_of_death.remains<target.time_to_die-4&buff.symbols_of_death.remains<=buff.symbols_of_death.duration*0.3)|(equipped.shadow_satyrs_walk&energy.time_to_max<0.25))
actions.stealthed+=/call_action_list,name=finish,if=combo_points>=5
actions.stealthed+=/shuriken_storm,if=buff.shadowmeld.down&((combo_points.deficit>=3&spell_targets.shuriken_storm>=2+talent.premeditation.enabled+equipped.shadow_satyrs_walk)|buff.the_dreadlords_deceit.stack>=29)
actions.stealthed+=/shadowstrike

head=mask_of_multitudinous_eyes,id=139204,bonus_id=1806
neck=krakentooth_necklace,id=141473,enchant=mark_of_the_hidden_satyr
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1806
back=gossamerspun_greatcloak,id=138221,bonus_id=1806,enchant=binding_of_agility
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1806
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1806
hands=dreamsculptors_gloves,id=139202,bonus_id=1806
waist=lifeless_buckled_girdle,id=139197,bonus_id=1806
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1806
feet=shadow_satyrs_walk,id=137032
finger1=ring_of_deep_sea_pearls,id=141545,enchant=binding_of_versatility
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant=binding_of_versatility
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=spontaneous_appendages,id=139325,bonus_id=1806
main_hand=fangs_of_the_devourer,id=128476,bonus_id=743,gem_id=139267/138226/139267,relic_id=1806/1806/1806
off_hand=fangs_of_the_devourer,id=128479

# Gear Summary
# gear_ilvl=881.69
# gear_agility=16120
# gear_stamina=25283
# gear_crit_rating=5694
# gear_haste_rating=1976
# gear_mastery_rating=8021
# gear_versatility_rating=3458
# gear_armor=2249

Shaman_Elemental_T19M : 414539 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
414538.6 414538.6 329.4 / 0.079% 57140.8 / 13.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 48.7 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Elemental Mastery (Elemental Shaman)
  • 100: Lightning Rod (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Shaman_Elemental_T19M 414539
Deadly Grace 12375 2.9% 34.6 8.87sec 105625 0 Direct 34.0 80915 161830 107367 32.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.61 34.05 0.00 0.00 0.0000 0.0000 3655678.93 3655678.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.92 67.31% 80914.81 80915 80915 80914.81 80915 80915 1854318 1854318 0.00
crit 11.13 32.69% 161829.61 161830 161830 161829.61 161830 161830 1801361 1801361 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Earth Shock 54339 13.1% 25.8 11.58sec 632962 596098 Direct 25.8 424724 1061822 632973 32.7%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.79 25.79 0.00 0.00 1.0619 0.0000 16322964.11 16322964.11 0.00 596098.46 596098.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.36 67.31% 424724.41 365157 467061 424739.43 395728 451408 7372807 7372807 0.00
crit 8.43 32.69% 1061821.73 912893 1167654 1061817.81 0 1167654 8950157 8950157 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:90.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (26161) 0.0% (6.3%) 12.0 23.91sec 656337 617233

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.98 0.00 0.00 0.00 1.0634 0.0000 0.00 0.00 0.00 617233.25 617233.25
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing ${$SPN*0.3*10*(1+{$170374m3=0}/100)} Physical damage over {$d=10 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 26161 6.3% 177.0 1.54sec 44405 0 Direct 177.0 29785 74459 44405 32.7%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 177.03 177.03 0.00 0.00 0.0000 0.0000 7861082.70 7861082.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.09 67.27% 29784.92 27607 30368 29785.66 27607 30368 3547172 3547172 0.00
crit 57.94 32.73% 74458.81 69018 75920 74461.17 69018 75920 4313911 4313911 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing ${$SPN*0.3*10*(1+{$170374m3=0}/100)} Physical damage over {$d=10 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.300000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Flame Shock 33471 8.1% 20.5 15.01sec 491589 460656 Direct 20.5 48866 122184 72845 32.7%  
Periodic 215.7 26655 66637 39700 32.6% 98.6%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.45 20.45 215.73 215.73 1.0672 1.3747 10054278.84 10054278.84 0.00 31579.20 460656.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.76 67.30% 48866.14 44810 49290 48861.13 47299 49290 672593 672593 0.00
crit 6.69 32.70% 122184.39 112024 123226 122145.12 0 123226 817246 817246 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 145.3 67.37% 26655.18 196 27111 26653.56 25775 27071 3874275 3874275 0.00
crit 70.4 32.63% 66637.40 490 67777 66631.76 62888 67777 4690164 4690164 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning=3&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 38790 (51743) 9.4% (12.5%) 41.2 7.30sec 377327 305483 Direct 41.1 0 283557 283557 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.21 41.11 0.00 0.00 1.2352 0.0000 11656115.25 11656115.25 0.00 305482.54 305482.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 41.11 100.00% 283556.81 264191 290611 283540.20 275640 289982 11656115 11656115 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lava_surge.up&spell_targets.chain_lightning=3
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 12953 3.1% 16.8 17.39sec 232087 0 Direct 16.7 0 232865 232865 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.77 16.72 0.00 0.00 0.0000 0.0000 3892640.66 3892640.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 16.72 100.00% 232864.72 216952 238648 232850.21 220897 238648 3892641 3892641 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.200000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lightning Bolt 65891 (102020) 15.9% (24.6%) 129.4 2.30sec 236727 171109 Direct 129.4 102623 256391 152876 32.7%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.41 129.41 0.00 0.00 1.3835 0.0000 19783891.77 19783891.77 0.00 171109.43 171109.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 87.12 67.32% 102623.42 75823 250215 102649.93 88593 116483 8940533 8940533 0.00
crit 42.29 32.68% 256390.69 189557 625539 256377.39 204366 338170 10843359 10843359 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 36129 8.7% 83.5 3.98sec 129978 0 Direct 83.5 87322 217987 129978 32.6%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.49 83.49 0.00 0.00 0.0000 0.0000 10851369.42 10851369.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.23 67.35% 87321.60 63691 210181 87299.22 68437 117440 4910163 4910163 0.00
crit 27.25 32.65% 217987.08 159228 525453 217956.77 169531 325280 5941206 5941206 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.600000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lightning Rod 31933 7.7% 170.7 1.79sec 56192 0 Direct 170.7 56191 0 56191 0.0%  

Stats details: lightning_rod

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 170.67 170.67 0.00 0.00 0.0000 0.0000 9590274.73 9590274.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 170.67 100.00% 56191.24 25476 250215 56157.75 43980 73333 9590275 9590275 0.00
 
 

Action details: lightning_rod

Static Values
  • id:197568
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:197568
  • name:Lightning Rod
  • school:nature
  • tooltip:
  • description:{$@spelldesc210689=Your Lightning Bolt and Chain Lightning have a {$s1=30}% chance to make the primary target a Lightning Rod for {$197209d=10 seconds}. Lightning Rods take {$s2=40}% of all damage you deal with Lightning Bolt and Chain Lightning.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:70060.34
  • base_dd_max:70060.34
 
Mark of the Hidden Satyr 8350 2.0% 20.8 14.42sec 120218 0 Direct 20.8 90596 181192 120218 32.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.85 20.85 0.00 0.00 0.0000 0.0000 2506020.01 2506020.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.03 67.30% 90596.21 90596 90596 90596.21 90596 90596 1271041 1271041 0.00
crit 6.82 32.70% 181192.42 181192 181192 181071.61 0 181192 1234979 1234979 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Pepper Breath 4655 1.1% 16.6 18.01sec 84039 0 Periodic 82.3 16970 0 16970 0.0% 6.9%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.63 0.00 82.81 82.35 0.0000 0.2497 1397479.47 1397479.47 0.00 67582.91 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.3 100.00% 16970.41 68 16990 16971.33 16377 16990 1397479 1397479 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Plague Swarm 14309 3.5% 16.7 17.84sec 257434 0 Periodic 71.8 45088 90183 59826 32.7% 46.8%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.69 0.00 71.83 71.83 0.0000 1.9590 4297210.91 4297210.91 0.00 30539.05 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.4 67.32% 45088.28 23 46002 45106.97 42272 46002 2180251 2180251 0.00
crit 23.5 32.68% 90183.11 46 92005 90226.92 77361 92005 2116960 2116960 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:43701.01
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Tormenting Cyclone 5952 1.4% 12.5 23.74sec 143275 0 Direct 85.8 15689 31377 20834 32.8%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.47 85.79 0.00 0.00 0.0000 0.0000 1787221.38 1787221.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.65 67.21% 15688.72 15689 15689 15688.72 15689 15689 904523 904523 0.00
crit 28.13 32.79% 31377.44 31377 31377 31377.44 31377 31377 882698 882698 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Volcanic Inferno 3239 0.8% 30.5 8.55sec 31853 0 Direct 30.5 24009 48019 31853 32.7%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.53 30.53 0.00 0.00 0.0000 0.0000 972623.93 972623.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.56 67.33% 24009.44 24009 24009 24009.44 24009 24009 493607 493607 0.00
crit 9.98 32.67% 48018.87 48019 48019 47974.05 0 48019 479017 479017 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
pet - primal_fire_elemental 145566 / 50850
Fire Blast 126236 10.7% 51.5 5.38sec 257892 139281 Direct 51.5 194435 388870 257889 32.6%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.55 51.55 0.00 0.00 1.8516 0.0000 13293404.34 13293404.34 0.00 139281.08 139281.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.72 67.36% 194435.05 194435 194435 194435.05 194435 194435 6751426 6751426 0.00
crit 16.82 32.64% 388870.10 388870 388870 388870.10 388870 388870 6541978 6541978 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 19330 1.6% 5.4 60.27sec 377471 277339 Direct 5.4 57610 115221 76034 32.0%  
Periodic 60.2 20373 40743 27016 32.6% 35.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.40 5.40 60.22 60.22 1.3612 1.7920 2037055.45 2037055.45 0.00 17674.95 277339.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.67 68.02% 57610.39 57610 57610 57441.37 0 57610 211474 211474 0.00
crit 1.73 31.98% 115220.77 115221 115221 99932.78 0 115221 198851 198851 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.6 67.39% 20373.17 520 21604 20383.32 18787 21604 826768 826768 0.00
crit 19.6 32.61% 40742.56 1040 43208 40765.88 32567 43208 799963 799963 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 107968 / 15141
Lightning Blast 107968 3.6% 42.8 6.57sec 106167 113156 Direct 42.8 80014 160029 106167 32.7%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.75 42.75 0.00 0.00 0.9382 0.0000 4539151.37 4539151.37 0.00 113156.29 113156.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.78 67.31% 80014.42 80014 80014 80014.42 80014 80014 2302845 2302845 0.00
crit 13.97 32.69% 160028.85 160029 160029 160028.85 160029 160029 2236307 2236307 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Shaman_Elemental_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shaman_Elemental_T19M
  • harmful:false
  • if_expr:
 
Berserking 2.1 180.47sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.05 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.ascendance.enabled|buff.ascendance.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Elemental Mastery 3.0 120.47sec

Stats details: elemental_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: elemental_mastery

Static Values
  • id:16166
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:16166
  • name:Elemental Mastery
  • school:nature
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
 
Fire Elemental 2.0 0.00sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.98 0.00 0.00 0.00 1.0102 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Shaman_Elemental_T19M
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.3 62.01sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 0.00 0.00 0.8358 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.2 111.62sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.23 0.00 0.00 0.00 0.5288 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.1 0.0 180.5sec 180.5sec 6.83% 6.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 21.10% 0.0(0.0) 1.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Echoes of the Great Sundering 12.0 0.0 23.9sec 23.9sec 5.58% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_echoes_of_the_great_sundering
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • echoes_of_the_great_sundering_1:5.58%

Trigger Attempt Success

  • trigger_pct:46.72%

Spelldata details

  • id:208723
  • name:Echoes of the Great Sundering
  • tooltip:Your next Earthquake Totem is free and deals {$s2=100}% increased damage.
  • description:{$@spelldesc208722=Earth Shock has up to a {$s1=50}% chance, based on Maelstrom spent, to cause your next Earthquake Totem to be free and deal {$208723s2=100}% increased damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Elemental Focus 64.3 81.2 4.7sec 2.1sec 82.56% 79.04% 81.2(111.1) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.97%
  • elemental_focus_2:62.59%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Elemental Mastery 3.0 0.0 120.5sec 120.5sec 19.32% 26.75% 0.0(0.0) 2.8

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_elemental_mastery
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.83

Stack Uptimes

  • elemental_mastery_1:19.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:16166
  • name:Elemental Mastery
  • tooltip:Haste increased by {$s1=20}%.
  • description:Elemental forces empower you with {$s1=20}% haste for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:101.00%
Ember Totem 1.0 2.2 0.0sec 111.6sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.7 0.8 14.0sec 13.5sec 8.85% 54.01% 0.8(0.8) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.85%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 273.7sec 0.0sec 18.53% 18.53% 0.0(0.0) 1.1

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power of the Maelstrom 5.8 0.3 44.1sec 41.3sec 13.28% 13.59% 0.3(0.6) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:3.88%
  • power_of_the_maelstrom_2:3.79%
  • power_of_the_maelstrom_3:5.61%

Trigger Attempt Success

  • trigger_pct:14.97%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.2 0.0sec 111.6sec 100.00% 100.00% 301.4(301.4) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.2 0.0sec 111.6sec 100.00% 100.00% 2.2(2.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.3 0.0 62.1sec 62.0sec 9.70% 12.22% 0.0(0.0) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.13%
  • stormkeeper_2:2.96%
  • stormkeeper_3:3.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal {$s1=200}% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.2 0.0sec 111.6sec 100.00% 95.96% 2.2(2.2) 0.0

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper1.2610.0017.9874.7750.00017.425
Fire Elemental0.4840.0011.1490.0950.0001.149
Elemental Mastery0.5880.0012.4170.9550.0003.477
Lava Burst0.9360.0016.13235.79615.27965.578

Resources

Resource Usage Type Count Total Average RPE APR
Shaman_Elemental_T19M
earth_shock Maelstrom 25.8 2416.4 93.7 93.7 6755.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 41.21 487.20 (19.84%) 11.82 7.28 1.47%
Lava Burst Overload Maelstrom 16.77 142.23 (5.79%) 8.48 8.73 5.78%
Lightning Bolt Maelstrom 129.41 1033.02 (42.06%) 7.98 2.28 0.22%
Lightning Bolt Overload Maelstrom 83.49 496.56 (20.22%) 5.95 4.36 0.87%
Resonance Totem Maelstrom 299.13 297.28 (12.10%) 0.99 1.86 0.62%
Resource RPS-Gain RPS-Loss
Maelstrom 8.17 8.04
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 39.60 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Lava Surge 21.6 13.5sec
Lava Surge: Wasted 0.9 87.3sec
Lava Surge: During Lava Burst 2.1 77.7sec

Statistics & Data Analysis

Fight Length
Sample Data Shaman_Elemental_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Shaman_Elemental_T19M Damage Per Second
Count 7499
Mean 414538.57
Minimum 364618.86
Maximum 470459.02
Spread ( max - min ) 105840.16
Range [ ( max - min ) / 2 * 100% ] 12.77%
Standard Deviation 14552.3149
5th Percentile 391288.87
95th Percentile 438861.18
( 95th Percentile - 5th Percentile ) 47572.31
Mean Distribution
Standard Deviation 168.0469
95.00% Confidence Intervall ( 414209.21 - 414867.94 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4734
0.1 Scale Factor Error with Delta=300 1807789
0.05 Scale Factor Error with Delta=300 7231157
0.01 Scale Factor Error with Delta=300 180778939
Priority Target DPS
Sample Data Shaman_Elemental_T19M Priority Target Damage Per Second
Count 7499
Mean 414538.57
Minimum 364618.86
Maximum 470459.02
Spread ( max - min ) 105840.16
Range [ ( max - min ) / 2 * 100% ] 12.77%
Standard Deviation 14552.3149
5th Percentile 391288.87
95th Percentile 438861.18
( 95th Percentile - 5th Percentile ) 47572.31
Mean Distribution
Standard Deviation 168.0469
95.00% Confidence Intervall ( 414209.21 - 414867.94 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4734
0.1 Scale Factor Error with Delta=300 1807789
0.05 Scale Factor Error with Delta=300 7231157
0.01 Scale Factor Error with Delta=300 180778939
DPS(e)
Sample Data Shaman_Elemental_T19M Damage Per Second (Effective)
Count 7499
Mean 414538.57
Minimum 364618.86
Maximum 470459.02
Spread ( max - min ) 105840.16
Range [ ( max - min ) / 2 * 100% ] 12.77%
Damage
Sample Data Shaman_Elemental_T19M Damage
Count 7499
Mean 104628852.10
Minimum 72516198.30
Maximum 139626244.29
Spread ( max - min ) 67110045.99
Range [ ( max - min ) / 2 * 100% ] 32.07%
DTPS
Sample Data Shaman_Elemental_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaman_Elemental_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shaman_Elemental_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaman_Elemental_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaman_Elemental_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaman_Elemental_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Shaman_Elemental_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Shaman_Elemental_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=whispered_pact
1 0.00 food,name=fishbrul_special
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=deadly_grace
5 0.00 stormkeeper
6 0.00 totem_mastery
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
7 1.00 potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
8 0.00 totem_mastery,if=buff.resonance_totem.remains<2
9 1.98 fire_elemental
0.00 storm_elemental
A 3.00 elemental_mastery
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
B 2.05 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
C 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
D 0.00 run_action_list,name=single
actions.single
# count action,conditions
0.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
E 5.06 flame_shock,if=!ticking
0.00 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
F 16.72 earth_shock,if=maelstrom>=92
0.00 icefury,if=raid_event.movement.in<5
G 41.30 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
0.00 elemental_blast
H 11.98 earthquake,if=buff.echoes_of_the_great_sundering.up
I 15.40 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
0.00 frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
0.00 frost_shock,moving=1,if=buff.icefury.up
J 9.07 earth_shock,if=maelstrom>=86
0.00 icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 4.35 stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
L 2.23 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
M 4.52 lightning_bolt,if=buff.power_of_the_maelstrom.up,target_if=!debuff.lightning_rod.up
N 13.14 lightning_bolt,if=buff.power_of_the_maelstrom.up
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
O 24.56 lightning_bolt,target_if=!debuff.lightning_rod.up
P 87.78 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1

Sample Sequence

024569ABEGMMNPPJPPPPGIPPFOOPPPGPJPPPPPIGPFOPPPPPGFGHIGNNMJOGOIOKOJGGOOOIJGHPGPGGNNFHNIGPPPOFGHIOPPPGFLPPGINNANJKGPGOOOGFGHIOPPPPGFHPIPPGPPJPPPGPIJPGOGOOOFOPBEGKNNNFPGIPPPPPFGGNNINPGFHMMMOGILOFHOG9PPPGFHAOEGNKNGNFHPPIPGPPJHPGPPIPPGFH7PPOOGOIGFHOOOGOPIP

Sample Sequence Table

time name target resources buffs
Pre flask Shaman_Elemental_T19M 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre augmentation Shaman_Elemental_T19M 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom potion_of_deadly_grace
Pre stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), potion_of_deadly_grace
Pre totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.000 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.882 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:00.882 berserking Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:00.882 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/100: 0% maelstrom bloodlust, berserking, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:01.639 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, berserking, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:02.493 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom bloodlust, berserking, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:03.347 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom bloodlust, berserking, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:04.202 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom bloodlust, berserking, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:05.056 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom bloodlust, berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:05.910 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom bloodlust, berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:06.764 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom bloodlust, berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:07.518 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom bloodlust, berserking, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:08.371 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom bloodlust, berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:09.224 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom bloodlust, berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:10.079 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom bloodlust, berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:10.933 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:11.912 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:12.665 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:13.646 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:14.626 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/100: 92% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:15.381 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:16.360 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:17.340 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:18.321 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:19.301 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:20.281 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, potion_of_deadly_grace
0:21.262 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/100: 77% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:22.438 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:23.321 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:24.496 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:25.673 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:26.850 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
0:28.026 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:29.200 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:30.083 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:31.260 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/100: 79% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:32.436 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/100: 97% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:33.317 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:34.493 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:35.667 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:36.843 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:38.017 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:39.193 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:40.368 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:41.895 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:43.042 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
0:44.189 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
0:45.333 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:46.480 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:47.626 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:49.153 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:50.680 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:52.208 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:53.355 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:54.884 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/100: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:56.410 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:57.937 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/100: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.082 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/100: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.609 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.756 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.283 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.429 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.957 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.105 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.632 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/100: 55% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.159 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/100: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.686 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/100: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.833 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/100: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.979 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:15.506 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:16.652 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/100: 16% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.181 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.327 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.855 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.003 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/100: 62% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.149 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.677 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/100: 84% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.204 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.349 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:28.496 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.022 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.168 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/100: 31% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.313 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/100: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.842 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:35.369 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:36.897 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:38.426 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:39.573 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:41.101 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
1:42.247 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/100: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:43.393 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:44.921 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/100: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:46.447 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:47.976 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/100: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:49.504 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:50.649 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:51.794 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:52.561 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:54.089 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:55.616 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/100: 26% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:56.763 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/100: 39% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:57.909 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:59.437 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/100: 50% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.964 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:00.964 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/100: 72% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:02.241 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/100: 87% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:03.199 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:04.157 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/100: 14% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:05.113 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:06.387 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/100: 36% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:07.343 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:08.618 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/100: 58% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:09.893 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:11.165 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:12.122 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:13.079 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering
2:14.035 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/100: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering
2:14.993 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/100: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:15.950 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:17.223 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:18.497 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:19.771 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
2:21.044 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.572 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.100 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.246 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/100: 10% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
2:26.392 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.921 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.067 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/100: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.594 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.122 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/100: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.649 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.176 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.702 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/100: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.849 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.377 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.905 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.431 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.959 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/100: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.489 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/100: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.636 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/100: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.785 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.313 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.459 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/100: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.985 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.131 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.658 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/100: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.185 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/100: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.712 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/100: 93% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.861 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.388 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.915 berserking Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.915 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom berserking, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.911 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom berserking, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.907 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/100: 47% maelstrom berserking, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.149 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/100: 48% maelstrom berserking, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.477 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/100: 57% maelstrom berserking, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.806 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/100: 73% maelstrom berserking, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.134 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom berserking, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.132 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom berserking, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.460 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/100: 22% maelstrom berserking, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.787 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/100: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.934 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.463 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/100: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.991 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/100: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.518 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/100: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.047 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/100: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.575 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/100: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.723 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.250 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/100: 15% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.396 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/100: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.922 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/100: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.449 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/100: 53% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.595 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.122 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.649 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.177 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.322 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
3:36.468 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.997 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.525 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.053 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.580 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/100: 64% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.726 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/100: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.873 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.639 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.164 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.312 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
3:49.458 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.985 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/100: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.512 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.658 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/100: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.186 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/100: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.715 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.242 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/100: 76% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.389 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/100: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.536 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
4:01.682 elemental_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.682 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:02.955 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:03.913 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/100: 13% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:04.870 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/100: 25% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:06.143 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/100: 35% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:07.099 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/100: 42% maelstrom lava_surge, elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:08.374 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:09.332 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/100: 85% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:10.606 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/100: 94% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:11.563 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery, echoes_of_the_great_sundering
4:12.520 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:13.794 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:15.067 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/100: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:16.023 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/100: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:17.298 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/100: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:18.572 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:19.844 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/100: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:21.119 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/100: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, elemental_mastery
4:22.154 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/100: 7% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
4:23.301 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/100: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.828 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/100: 17% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.974 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/100: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.500 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/100: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.026 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/100: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.173 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/100: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.700 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/100: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.227 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/100: 91% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.754 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.900 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/100: 11% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering
4:37.048 potion Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.048 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:38.576 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/100: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:40.103 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:41.629 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/100: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:43.156 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/100: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:44.683 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/100: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:46.211 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/100: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:47.358 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/100: 89% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:48.504 earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/100: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:49.649 earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/100: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, echoes_of_the_great_sundering, potion_of_deadly_grace
4:50.795 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/100: 2% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:52.323 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/100: 12% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:53.852 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/100: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:55.378 lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/100: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:56.905 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/100: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:58.432 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/100: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
4:59.959 flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/100: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace
5:01.105 lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/100: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_deadly_grace

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 9357 9032 0
Stamina 42217 42217 26216
Intellect 39146 37440 28334 (14046)
Spirit 1 1 0
Health 2533020 2533020 0
Mana 220000 220000 0
Maelstrom 100 100 0
Spell Power 39146 37440 0
Crit 32.67% 32.67% 9685
Haste 28.70% 28.70% 5524
Damage / Heal Versatility 2.20% 2.20% 880
Attack Power 9357 9032 0
Mastery 40.95% 40.95% 3570
Armor 2774 2774 2774
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 884.00
Local Head Greyed Dragonscale Coif
ilevel: 880, stats: { 369 Armor, +2573 Sta, +1715 AgiInt, +824 Mastery, +636 Crit }
Local Neck Blackened Portalstone Necklace
ilevel: 880, stats: { +1448 Sta, +1350 Crit, +704 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Echoes of the Great Sundering
ilevel: 895, stats: { 357 Armor, +2219 Sta, +1479 AgiInt, +496 Haste, +662 Mastery }
Local Chest Patient Ambusher's Hauberk
ilevel: 880, stats: { 454 Armor, +2573 Sta, +1715 AgiInt, +949 Crit, +511 Mastery }
Local Waist Laughing Sister's Pouch-Chain
ilevel: 880, stats: { 256 Armor, +1930 Sta, +1287 AgiInt, +783 Crit, +312 Haste }
Local Legs Disjointed Linkage Leggings
ilevel: 880, stats: { 398 Armor, +2573 Sta, +1715 AgiInt, +886 Haste, +574 Crit }
Local Feet Scored Ironclaw Sabatons
ilevel: 880, stats: { 312 Armor, +1930 Sta, +1287 AgiInt, +689 Crit, +406 Haste }
Local Wrists Manacles of the Nightmare Colossus
ilevel: 880, stats: { 199 Armor, +1447 Sta, +965 AgiInt, +481 Haste, +340 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 880, stats: { 284 Armor, +1930 Sta, +1287 AgiInt, +641 Crit, +454 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +200 Crit }
Local Finger2 Grubby Silver Ring
ilevel: 880, stats: { +1448 Sta, +1174 Crit, +880 Vers }, enchant: { +200 Crit }
Local Trinket1 Swarming Plaguehive
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Twisting Wind
ilevel: 880, stats: { +1631 AgiInt }
Local Back Evergreen Vinewrap Drape
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +551 Haste, +270 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 906, weapon: { 2776 - 5157, 2.6 }, stats: { +937 Int, +1405 Sta, +350 Crit, +337 Mastery, +11921 Int }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 906, stats: { +1230 Int, +1844 Sta, +460 Crit, +442 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Elemental Blast (Elemental Shaman) Ancestral Swiftness Echo of the Elements
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Icefury (Elemental Shaman)
90 Elemental Mastery (Elemental Shaman) Storm Elemental (Elemental Shaman) Aftershock (Elemental Shaman)
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Liquid Magma Totem (Elemental Shaman)

Profile

shaman="Shaman_Elemental_T19M"
level=110
race=troll
role=spell
position=ranged_back
talents=3112212
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:3:299:3:300:3:301:3:302:3:303:3:304:3:305:3:306:3:1350:1
spec=elemental

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=whispered_pact
actions.precombat+=/food,name=fishbrul_special
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/stormkeeper
actions.precombat+=/totem_mastery

# Executed every time the actor is available.
actions=bloodlust,if=target.health.pct<25|time>0.500
actions+=/potion,name=deadly_grace,if=buff.ascendance.up|target.time_to_die<=30
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning=3&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=buff.lava_surge.up&spell_targets.chain_lightning=3
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=!debuff.lightning_rod.up
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single+=/flame_shock,if=!ticking
actions.single+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
actions.single+=/earth_shock,if=maelstrom>=92
actions.single+=/icefury,if=raid_event.movement.in<5
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single+=/elemental_blast
actions.single+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single+=/frost_shock,if=talent.icefury.enabled&buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack))
actions.single+=/frost_shock,moving=1,if=buff.icefury.up
actions.single+=/earth_shock,if=maelstrom>=86
actions.single+=/icefury,if=maelstrom<=70&raid_event.movement.in>30&((talent.ascendance.enabled&cooldown.ascendance.remains>buff.icefury.duration)|!talent.ascendance.enabled)
actions.single+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single+=/stormkeeper,if=(talent.ascendance.enabled&cooldown.ascendance.remains>10)|!talent.ascendance.enabled
actions.single+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single+=/lightning_bolt,if=buff.power_of_the_maelstrom.up,target_if=!debuff.lightning_rod.up
actions.single+=/lightning_bolt,if=buff.power_of_the_maelstrom.up
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=!debuff.lightning_rod.up
actions.single+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single+=/lightning_bolt,target_if=!debuff.lightning_rod.up
actions.single+=/lightning_bolt
actions.single+=/flame_shock,moving=1,target_if=refreshable
actions.single+=/earth_shock,moving=1

head=greyed_dragonscale_coif,id=139214,bonus_id=1806
neck=blackened_portalstone_necklace,id=139332,bonus_id=1806,enchant=mark_of_the_hidden_satyr
shoulders=echoes_of_the_great_sundering,id=137074
back=evergreen_vinewrap_drape,id=139248,bonus_id=1806,enchant=binding_of_intellect
chest=patient_ambushers_hauberk,id=139221,bonus_id=1806
wrists=manacles_of_the_nightmare_colossus,id=139222,bonus_id=1806
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1806
waist=laughing_sisters_pouchchain,id=139211,bonus_id=1806
legs=disjointed_linkage_leggings,id=139216,bonus_id=1806
feet=scored_ironclaw_sabatons,id=139220,bonus_id=1806
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1806,enchant_id=5427
finger2=grubby_silver_ring,id=139236,bonus_id=1806,enchant_id=5427
trinket1=swarming_plaguehive,id=139321,bonus_id=1806
trinket2=twisting_wind,id=139323,bonus_id=1806
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=139264/139259/139264,relic_id=1806/1806/1806
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=884.19
# gear_stamina=26216
# gear_intellect=28334
# gear_crit_rating=9685
# gear_haste_rating=5524
# gear_mastery_rating=3570
# gear_versatility_rating=880
# gear_armor=2774

Warrior_Arms_T19M : 508564 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
508563.6 508563.6 581.7 / 0.114% 101362.0 / 19.9% 40804.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.4 12.4 Rage 2.23% 91.6 100.0% 100%
Talents
  • 15: Dauntless (Arms Warrior)
  • 30: Double Time
  • 45: Avatar
  • 60: Bounding Stride
  • 75: Focused Rage (Arms Warrior)
  • 90: Deadly Calm (Arms Warrior)
  • 100: Anger Management
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Warrior_Arms_T19M 508564
auto_attack_mh 28641 5.6% 99.3 3.05sec 86612 28802 Direct 99.3 64408 129256 86612 34.2%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.31 99.31 0.00 0.00 3.0072 0.0000 8601439.59 12644930.95 31.98 28801.84 28801.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.31 65.76% 64408.13 33019 77788 64420.52 54501 68891 4206160 6183454 31.98
crit 34.00 34.24% 129255.71 66039 155577 129285.30 108758 141316 4395279 6461477 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bladestorm 0 (2939) 0.0% (0.6%) 2.0 122.12sec 433927 223299

Stats details: bladestorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 6.15 0.00 1.9434 0.5604 0.00 0.00 0.00 223298.76 223298.76
 
 

Action details: bladestorm

Static Values
  • id:227847
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:227847
  • name:Bladestorm
  • school:physical
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Bladestorm (_mh) 2939 0.6% 0.0 0.00sec 0 0 Direct 6.2 121162 242273 143666 18.6%  

Stats details: bladestorm_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 6.15 0.00 0.00 0.0000 0.0000 883593.18 1298965.67 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.01 81.42% 121162.46 73415 172953 119188.02 0 172953 606731 891952 31.31
crit 1.14 18.58% 242273.27 146829 345907 165717.37 0 345907 276862 407014 21.93
 
 

Action details: bladestorm_mh

Static Values
  • id:50622
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50622
  • name:Bladestorm
  • school:physical
  • tooltip:
  • description:You become a whirling storm of destructive force, striking all nearby targets with your main hand weapon for $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.35
 
Colossus Smash 63466 12.5% 54.2 5.61sec 351731 277455 Direct 54.2 275216 541976 351735 28.7%  

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.15 54.15 0.00 0.00 1.2677 0.0000 19047313.45 28001354.99 31.98 277455.40 277455.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.62 71.32% 275215.93 142728 336245 274646.94 228572 297717 10628765 15625291 31.98
crit 15.53 28.68% 541976.49 285457 672490 541043.31 375341 624455 8418548 12376064 31.98
 
 

Action details: colossus_smash

Static Values
  • id:167105
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:167105
  • name:Colossus Smash
  • school:physical
  • tooltip:
  • description:Smashes the enemy's armor, dealing $sw1 Physical damage, and increasing damage you deal to them by {$208086s3=15}% for {$208086d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.52
 
Corrupted Blood of Zakajz 42120 8.3% 0.0 0.00sec 0 0 Periodic 60.8 207974 0 207974 0.0% 40.4%

Stats details: corrupted_blood_of_zakajz

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 60.77 60.77 0.0000 2.0000 12638062.50 12638062.50 0.00 103985.31 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.8 100.00% 207973.80 16205 401145 208301.23 145902 282890 12638063 12638063 0.00
 
 

Action details: corrupted_blood_of_zakajz

Static Values
  • id:209569
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209569
  • name:Corrupted Blood of Zakajz
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t sec.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:50.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Execute 60612 11.9% 26.1 2.12sec 698249 527975 Direct 26.1 427240 913020 698259 55.8%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.08 26.08 0.00 0.00 1.3225 0.0000 18210899.60 26771747.39 31.98 527974.59 527974.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.53 44.21% 427240.42 50502 618666 427646.86 240052 540483 4926166 7241931 31.98
crit 14.55 55.79% 913020.20 101004 1237333 912044.01 538194 1098224 13284733 19529816 31.98
 
 

Action details: execute

Static Values
  • id:163201
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stone_heart.react
Spelldata
  • id:163201
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempts to finish off a foe, causing $sw2 Physical damage, and consuming up to $m4 additional Rage to deal up to ${$sw2*$m4/10} additional damage. Only usable on enemies that have less than 20% health.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.62
 
Horrific Slam 23635 4.7% 119.2 2.18sec 59544 0 Direct 119.2 44448 89110 59544 33.8%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.16 119.16 0.00 0.00 0.0000 0.0000 7095577.06 7095577.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.88 66.20% 44447.54 22636 53327 44453.40 32258 52998 3506203 3506203 0.00
crit 40.28 33.80% 89109.62 45273 106655 89098.75 56565 106655 3589374 3589374 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Mortal Strike 175373 34.5% 64.5 4.60sec 816785 646004 Direct 64.5 493203 1061814 816783 56.9%  

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.47 64.47 0.00 0.00 1.2644 0.0000 52655760.69 77408955.91 31.98 646003.69 646003.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.78 43.09% 493203.28 117230 682151 493482.19 379522 578885 13701137 20141970 31.98
crit 36.69 56.91% 1061813.63 234460 1364302 1062134.83 939048 1166810 38954623 57266986 31.98
 
 

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals ${$sw3*$<mult>} Physical damage and reduces the effectiveness of healing on the target for {$115804d=10 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
Potion of the Old War 29495 5.7% 23.4 13.02sec 373409 0 Direct 23.4 270150 557644 373406 35.9%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.37 23.37 0.00 0.00 0.0000 0.0000 8726896.29 12829364.18 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.98 64.08% 270149.82 130700 307909 269930.02 191576 307909 4046033 5948052 31.98
crit 8.39 35.92% 557643.58 261400 615817 557937.21 350005 615817 4680863 6881312 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Shadow Wave 19621 3.9% 13.1 19.68sec 450799 0 Direct 13.1 331901 672309 450778 34.9%  

Stats details: shadow_wave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.07 13.07 0.00 0.00 0.0000 0.0000 5894176.59 5894176.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.51 65.07% 331901.11 170539 401763 331433.70 0 401763 2823868 2823868 0.00
crit 4.57 34.93% 672309.49 341078 803525 660751.47 0 803525 3070309 3070309 0.00
 
 

Action details: shadow_wave

Static Values
  • id:215047
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215047
  • name:Shadow Wave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc215089=Your melee attacks have a chance to unleash 4 Shadow Waves that deal {$s1=78543} Shadow damage to enemies in their path. The waves travel 15 yards away from you, and then return.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:150798.04
  • base_dd_max:150798.04
 
Slam 56792 11.2% 79.0 3.07sec 216013 171232 Direct 79.0 159021 313448 216012 36.9%  

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.98 78.98 0.00 0.00 1.2615 0.0000 17060191.72 25080097.82 31.98 171232.05 171232.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.83 63.09% 159020.54 81023 190878 159165.92 134505 172983 7924003 11649035 31.98
crit 29.15 36.91% 313447.89 162046 381755 313925.56 251123 354487 9136189 13431063 31.98
 
 

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Warbreaker 5869 1.2% 4.4 70.27sec 403498 321732 Direct 4.4 303761 625121 403532 31.0%  

Stats details: warbreaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.37 4.37 0.00 0.00 1.2543 0.0000 1762446.90 1762446.90 0.00 321731.82 321731.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.01 68.96% 303761.48 160400 377878 302661.68 0 377878 914956 914956 0.00
crit 1.36 31.04% 625121.26 320801 755756 505792.99 0 755756 847491 847491 0.00
 
 

Action details: warbreaker

Static Values
  • id:209577
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:209577
  • name:Warbreaker
  • school:shadow
  • tooltip:
  • description:Stomp the ground, causing a ring of corrupted spikes to erupt upwards, dealing $sw1 Shadow damage and applying the Colossus Smash effect to all nearby enemies.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Simple Action Stats Execute Interval
Warrior_Arms_T19M
Arcane Torrent 3.7 91.25sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:69179
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.down&rage.deficit>40
Spelldata
  • id:69179
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and increase your Rage by {$/10;s2=15}. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T19M
  • harmful:false
  • if_expr:
 
Avatar 3.8 90.02sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 11.3 27.64sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:17.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T19M
  • harmful:false
  • if_expr:
 
Focused Rage 196.7 1.48sec

Stats details: focused_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: focused_rage

Static Values
  • id:207982
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
Spelldata
  • id:207982
  • name:Focused Rage
  • school:physical
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Arms_T19M
  • harmful:false
  • if_expr:
 
Heroic Leap 10.2 30.96sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.18 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 3.8 0.0 90.0sec 90.0sec 24.44% 24.44% 0.0(0.0) 3.6

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:24.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 11.3 0.0 27.6sec 27.6sec 18.69% 18.69% 0.0(0.0) 11.1

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:18.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bladestorm 2.0 0.0 122.3sec 122.3sec 1.15% 1.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_bladestorm
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladestorm_1:1.15%

Trigger Attempt Success

  • trigger_pct:97.99%

Spelldata details

  • id:227847
  • name:Bladestorm
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
  • max_stacks:0
  • duration:6.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupted Blood of Zakajz 11.3 0.0 27.6sec 27.6sec 18.69% 19.87% 0.0(0.0) 11.1

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_corrupted_blood_of_zakajz
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • corrupted_blood_of_zakajz_1:18.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209567
  • name:Corrupted Blood of Zakajz
  • tooltip:An additional {$s1=20}% of all damage dealt will be done to your enemies over {$209569d=6 seconds}.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Rage 63.5 133.2 4.6sec 1.5sec 73.59% 97.46% 30.0(30.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_focused_rage
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • focused_rage_1:32.61%
  • focused_rage_2:21.91%
  • focused_rage_3:19.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207982
  • name:Focused Rage
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
  • max_stacks:3
  • duration:30.00
  • cooldown:1.50
  • default_chance:100.00%
Horrific Appendages 6.2 2.2 47.1sec 33.7sec 30.41% 30.41% 121.3(121.3) 5.9

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:30.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 257.3sec 0.0sec 16.21% 16.21% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Precise Strikes 58.5 0.0 5.2sec 5.2sec 30.20% 30.20% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_precise_strikes
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.60

Stack Uptimes

  • precise_strikes_1:30.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209493
  • name:Precise Strikes
  • tooltip:
  • description:{$@spelldesc209492=Colossus Smash reduces the Rage cost of your next Mortal Strike or Execute by {$s1=15}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Shattered Defenses 58.5 0.0 5.2sec 5.2sec 30.20% 64.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_shattered_defenses
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • shattered_defenses_1:30.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209706
  • name:Shattered Defenses
  • tooltip:Damage and critical strike chance of your next Mortal Strike or Execute increased by {$s1=30}%.
  • description:{$@spelldesc209574=After using Colossus Smash, your next Mortal Strike or Execute gains {$209706s1=30}% increased critical strike chance and deals {$209706s2=30}% additional damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Battle Cry1.4650.0019.2648.4290.00023.910
Avatar0.7480.0022.1460.0340.0003.058
Heroic Leap1.0860.00124.1668.7421.37554.144
Focused Rage3.9770.00139.07243.57416.67585.939
Colossus Smash1.0750.0016.71156.79524.216110.092
Warbreaker10.9740.001113.77634.6820.000144.046
Mortal Strike1.4560.00113.26492.06340.966149.811
Bladestorm33.7800.002225.45534.1650.000225.455

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Arms_T19M
execute Rage 26.1 499.6 19.2 19.2 36450.0
focused_rage Rage 196.7 1852.3 9.4 9.4 0.0
mortal_strike Rage 64.5 409.1 6.3 6.3 128725.7
slam Rage 79.0 978.2 12.4 12.4 17440.0
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 20.00 (0.52%) 20.00 0.00 0.00%
arcane_torrent Rage 3.72 55.84 (1.47%) 15.00 0.00 0.00%
archavons_heavy_hand Rage 64.47 944.84 (24.80%) 14.66 22.17 2.29%
melee_crit Rage 34.00 1181.41 (31.01%) 34.74 73.42 5.85%
melee_main_hand Rage 65.31 1608.08 (42.20%) 24.62 37.63 2.29%
Resource RPS-Gain RPS-Loss
Rage 12.67 12.44
Combat End Resource Mean Min Max
Rage 70.78 0.00 130.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 3.1%

Procs

Count Interval
tactician 61.6 4.9sec

Statistics & Data Analysis

Fight Length
Sample Data Warrior_Arms_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Warrior_Arms_T19M Damage Per Second
Count 7499
Mean 508563.59
Minimum 396293.03
Maximum 597268.58
Spread ( max - min ) 200975.55
Range [ ( max - min ) / 2 * 100% ] 19.76%
Standard Deviation 25699.5958
5th Percentile 465984.86
95th Percentile 551005.58
( 95th Percentile - 5th Percentile ) 85020.72
Mean Distribution
Standard Deviation 296.7732
95.00% Confidence Intervall ( 507981.93 - 509145.26 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 98
0.1% Error 9809
0.1 Scale Factor Error with Delta=300 5638145
0.05 Scale Factor Error with Delta=300 22552580
0.01 Scale Factor Error with Delta=300 563814516
Priority Target DPS
Sample Data Warrior_Arms_T19M Priority Target Damage Per Second
Count 7499
Mean 508563.59
Minimum 396293.03
Maximum 597268.58
Spread ( max - min ) 200975.55
Range [ ( max - min ) / 2 * 100% ] 19.76%
Standard Deviation 25699.5958
5th Percentile 465984.86
95th Percentile 551005.58
( 95th Percentile - 5th Percentile ) 85020.72
Mean Distribution
Standard Deviation 296.7732
95.00% Confidence Intervall ( 507981.93 - 509145.26 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 98
0.1% Error 9809
0.1 Scale Factor Error with Delta=300 5638145
0.05 Scale Factor Error with Delta=300 22552580
0.01 Scale Factor Error with Delta=300 563814516
DPS(e)
Sample Data Warrior_Arms_T19M Damage Per Second (Effective)
Count 7499
Mean 508563.59
Minimum 396293.03
Maximum 597268.58
Spread ( max - min ) 200975.55
Range [ ( max - min ) / 2 * 100% ] 19.76%
Damage
Sample Data Warrior_Arms_T19M Damage
Count 7499
Mean 152576357.58
Minimum 107238846.50
Maximum 198983157.33
Spread ( max - min ) 91744310.83
Range [ ( max - min ) / 2 * 100% ] 30.07%
DTPS
Sample Data Warrior_Arms_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Warrior_Arms_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Warrior_Arms_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Warrior_Arms_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Warrior_Arms_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Warrior_Arms_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Warrior_Arms_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Warrior_Arms_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 charge
6 1.00 auto_attack
7 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
0.00 blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
0.00 berserking,if=buff.battle_cry.up|target.time_to_die<=11
8 3.72 arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
9 11.31 battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
A 3.80 avatar,if=(buff.bloodlust.up|time>=1)
B 10.18 heroic_leap,if=debuff.colossus_smash.up
0.00 rend,if=remains<gcd
C 39.08 focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
D 7.86 colossus_smash,if=debuff.colossus_smash.down
E 0.77 warbreaker,if=debuff.colossus_smash.down
0.00 ravager
0.00 overpower,if=buff.overpower.react
F 0.00 run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
G 0.00 run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
H 0.00 run_action_list,name=execute,if=target.health.pct<=20
I 0.00 run_action_list,name=single,if=target.health.pct>20
actions.execute
# count action,conditions
J 1.85 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
K 4.73 execute,if=buff.battle_cry_deadly_calm.up
L 8.37 colossus_smash,if=buff.shattered_defenses.down
M 0.26 warbreaker,if=buff.shattered_defenses.down&rage<=30
N 9.03 execute,if=buff.shattered_defenses.up&rage>22
O 3.20 mortal_strike,if=equipped.archavons_heavy_hand&rage<60
P 12.32 execute,if=buff.shattered_defenses.down
Q 0.15 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single
# count action,conditions
R 4.52 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
S 37.92 colossus_smash,if=buff.shattered_defenses.down
T 3.33 warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
U 66.81 focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
V 54.90 mortal_strike
0.00 execute,if=buff.stone_heart.react
W 78.98 slam
0.00 execute,if=equipped.archavons_heavy_hand
X 90.81 focused_rage,if=equipped.archavons_heavy_hand
Y 1.89 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

Sample Sequence

0124568ADUX9BVCSCWCWXRXSUWUWXVXSUVXSUVXSUWUWXVXSUVUWXSUVUWXWXTX9VCSCVCWCWCBSXVXSUVUWUWXSXVUWUWUWXSXVUWXWXWSXVX9WCWCWCRUWXDUVXBSUVXSUVUWUWUWXVXSUVUWXSUVUSU9VCSCVCRCSUWUVXASUWUBVXSU8WUWXVUWUWXTXVUWUWXSX9VCWCWCWCVUWXDUVUWXSUVUBWXWXSXVXSXWXVXSXVXSX9VCSCVCWCWXSXVUWUWXSXVUWXSUBVUWXSUVUWUWXWXTX9VCWCWCRCSUVXSUVUWXSUVUWXASUVUWUBWU8WXVXWXWXDX9VCWCWCWCVUWUDUVUWUSUVXSUVUWXSUVUSUBVUWUWXSX9VCSCVCWCSUVUSUVUSUVXSUVUWUWUTXVUWUWXSXBVXSUU9WC7KJCKCPDNPLNPPPOPPDANOPL89BCKCKCJCKLNLNLNPPPOPDNLNO

Sample Sequence Table

time name target resources buffs
Pre flask Warrior_Arms_T19M 0.0/130: 0% rage
Pre food Warrior_Arms_T19M 0.0/130: 0% rage
Pre augmentation Warrior_Arms_T19M 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 charge Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 20.0/130: 15% rage bloodlust, horrific_appendages, potion_of_the_old_war
0:00.000 arcane_torrent Fluffy_Pillow 45.2/130: 35% rage bloodlust, horrific_appendages, potion_of_the_old_war
0:00.000 avatar Fluffy_Pillow 60.2/130: 46% rage bloodlust, horrific_appendages, potion_of_the_old_war
0:00.000 colossus_smash Fluffy_Pillow 60.2/130: 46% rage bloodlust, avatar, horrific_appendages, potion_of_the_old_war
0:00.000 focused_rage Fluffy_Pillow 48.2/130: 37% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:01.014 focused_rage Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:01.020 battle_cry Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:01.020 heroic_leap Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:01.020 mortal_strike Fluffy_Pillow 36.2/130: 28% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:02.028 focused_rage Fluffy_Pillow 51.2/130: 39% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages, potion_of_the_old_war
0:02.037 colossus_smash Fluffy_Pillow 51.2/130: 39% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages, potion_of_the_old_war
0:03.042 focused_rage Fluffy_Pillow 88.1/130: 68% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:03.055 slam Fluffy_Pillow 88.1/130: 68% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:04.056 focused_rage Fluffy_Pillow 88.1/130: 68% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:04.075 slam Fluffy_Pillow 88.1/130: 68% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:05.070 focused_rage Fluffy_Pillow 124.9/130: 96% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:05.095 mortal_strike Fluffy_Pillow 124.9/130: 96% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:06.084 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:06.111 colossus_smash Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:07.098 focused_rage Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:07.131 slam Fluffy_Pillow 106.0/130: 82% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:08.112 focused_rage Fluffy_Pillow 103.2/130: 79% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:08.149 slam Fluffy_Pillow 103.2/130: 79% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:09.126 focused_rage Fluffy_Pillow 75.2/130: 58% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:09.170 mortal_strike Fluffy_Pillow 75.2/130: 58% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:10.140 focused_rage Fluffy_Pillow 97.0/130: 75% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:10.190 colossus_smash Fluffy_Pillow 97.0/130: 75% rage bloodlust, avatar, focused_rage, horrific_appendages, potion_of_the_old_war
0:11.154 focused_rage Fluffy_Pillow 85.0/130: 65% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:11.209 mortal_strike Fluffy_Pillow 85.0/130: 65% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages, potion_of_the_old_war
0:12.168 focused_rage Fluffy_Pillow 81.6/130: 63% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:12.226 colossus_smash Fluffy_Pillow 106.8/130: 82% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:13.182 focused_rage Fluffy_Pillow 94.8/130: 73% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:13.244 mortal_strike Fluffy_Pillow 94.8/130: 73% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:14.196 focused_rage Fluffy_Pillow 91.4/130: 70% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:14.262 colossus_smash Fluffy_Pillow 91.4/130: 70% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:15.210 focused_rage Fluffy_Pillow 104.6/130: 80% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:15.280 slam Fluffy_Pillow 104.6/130: 80% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:16.224 focused_rage Fluffy_Pillow 76.6/130: 59% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:16.297 slam Fluffy_Pillow 76.6/130: 59% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:17.238 focused_rage Fluffy_Pillow 73.8/130: 57% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:17.315 mortal_strike Fluffy_Pillow 73.8/130: 57% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:18.252 focused_rage Fluffy_Pillow 70.4/130: 54% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:18.334 colossus_smash Fluffy_Pillow 70.4/130: 54% rage bloodlust, avatar, focused_rage, potion_of_the_old_war
0:19.266 focused_rage Fluffy_Pillow 58.4/130: 45% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:19.352 mortal_strike Fluffy_Pillow 58.4/130: 45% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
0:20.280 focused_rage Fluffy_Pillow 80.2/130: 62% rage bloodlust, focused_rage, potion_of_the_old_war
0:20.368 slam Fluffy_Pillow 80.2/130: 62% rage bloodlust, focused_rage, potion_of_the_old_war
0:21.294 focused_rage Fluffy_Pillow 52.2/130: 40% rage bloodlust, focused_rage(2), potion_of_the_old_war
0:21.386 colossus_smash Fluffy_Pillow 52.2/130: 40% rage bloodlust, focused_rage(2), potion_of_the_old_war
0:22.308 focused_rage Fluffy_Pillow 65.4/130: 50% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:22.403 mortal_strike Fluffy_Pillow 65.4/130: 50% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses, potion_of_the_old_war
0:23.322 focused_rage Fluffy_Pillow 62.0/130: 48% rage bloodlust, focused_rage
0:23.422 slam Fluffy_Pillow 62.0/130: 48% rage bloodlust, focused_rage
0:24.336 focused_rage Fluffy_Pillow 34.0/130: 26% rage bloodlust, focused_rage(2)
0:24.440 slam Fluffy_Pillow 59.2/130: 46% rage bloodlust, focused_rage(2)
0:25.350 focused_rage Fluffy_Pillow 31.2/130: 24% rage bloodlust, focused_rage(3)
0:25.458 warbreaker Fluffy_Pillow 31.2/130: 24% rage bloodlust, focused_rage(3)
0:26.364 focused_rage Fluffy_Pillow 19.2/130: 15% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:26.477 battle_cry Fluffy_Pillow 19.2/130: 15% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:26.477 mortal_strike Fluffy_Pillow 19.2/130: 15% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:27.378 focused_rage Fluffy_Pillow 72.0/130: 55% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:27.494 colossus_smash Fluffy_Pillow 72.0/130: 55% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:28.392 focused_rage Fluffy_Pillow 72.0/130: 55% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
0:28.513 mortal_strike Fluffy_Pillow 72.0/130: 55% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
0:29.406 focused_rage Fluffy_Pillow 124.4/130: 96% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:29.533 slam Fluffy_Pillow 124.4/130: 96% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry
0:30.420 focused_rage Fluffy_Pillow 124.4/130: 96% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:30.552 slam Fluffy_Pillow 124.4/130: 96% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:31.434 focused_rage Fluffy_Pillow 124.4/130: 96% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:31.571 heroic_leap Fluffy_Pillow 124.4/130: 96% rage bloodlust, focused_rage(3)
0:31.571 colossus_smash Fluffy_Pillow 124.4/130: 96% rage bloodlust, focused_rage(3)
0:32.448 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:32.589 mortal_strike Fluffy_Pillow 118.0/130: 91% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:33.462 focused_rage Fluffy_Pillow 114.6/130: 88% rage bloodlust, focused_rage
0:33.607 colossus_smash Fluffy_Pillow 114.6/130: 88% rage bloodlust, focused_rage
0:34.476 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:34.625 mortal_strike Fluffy_Pillow 118.0/130: 91% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses
0:35.490 focused_rage Fluffy_Pillow 114.6/130: 88% rage bloodlust, focused_rage
0:35.642 slam Fluffy_Pillow 114.6/130: 88% rage bloodlust, focused_rage
0:36.504 focused_rage Fluffy_Pillow 86.6/130: 67% rage bloodlust, focused_rage(2)
0:36.660 slam Fluffy_Pillow 111.8/130: 86% rage bloodlust, focused_rage(2)
0:37.518 focused_rage Fluffy_Pillow 83.8/130: 64% rage bloodlust, focused_rage(3)
0:37.678 colossus_smash Fluffy_Pillow 83.8/130: 64% rage bloodlust, focused_rage(3)
0:38.532 focused_rage Fluffy_Pillow 71.8/130: 55% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:38.697 mortal_strike Fluffy_Pillow 71.8/130: 55% rage bloodlust, focused_rage(3), precise_strikes, shattered_defenses
0:39.546 focused_rage Fluffy_Pillow 105.6/130: 81% rage bloodlust, focused_rage
0:39.714 slam Fluffy_Pillow 105.6/130: 81% rage bloodlust, focused_rage
0:40.728 focused_rage Fluffy_Pillow 77.6/130: 60% rage focused_rage(2)
0:40.952 slam Fluffy_Pillow 77.6/130: 60% rage focused_rage(2)
0:42.046 focused_rage Fluffy_Pillow 74.8/130: 58% rage focused_rage(3)
0:42.274 slam Fluffy_Pillow 74.8/130: 58% rage focused_rage(3)
0:43.364 focused_rage Fluffy_Pillow 46.8/130: 36% rage focused_rage(3)
0:43.596 colossus_smash Fluffy_Pillow 46.8/130: 36% rage focused_rage(3)
0:44.682 focused_rage Fluffy_Pillow 34.8/130: 27% rage focused_rage(3), precise_strikes, shattered_defenses
0:44.918 mortal_strike Fluffy_Pillow 34.8/130: 27% rage focused_rage(3), precise_strikes, shattered_defenses
0:46.000 focused_rage Fluffy_Pillow 56.6/130: 44% rage focused_rage
0:46.241 slam Fluffy_Pillow 56.6/130: 44% rage focused_rage
0:47.318 focused_rage Fluffy_Pillow 28.6/130: 22% rage focused_rage(2)
0:47.564 slam Fluffy_Pillow 28.6/130: 22% rage focused_rage(2)
0:48.636 focused_rage Fluffy_Pillow 25.8/130: 20% rage focused_rage(3)
0:48.884 slam Fluffy_Pillow 25.8/130: 20% rage focused_rage(3)
0:50.208 colossus_smash Fluffy_Pillow 9.8/130: 8% rage focused_rage(3)
0:51.308 focused_rage Fluffy_Pillow 34.2/130: 26% rage focused_rage(3), precise_strikes, shattered_defenses
0:51.530 mortal_strike Fluffy_Pillow 34.2/130: 26% rage focused_rage(3), precise_strikes, shattered_defenses
0:52.626 focused_rage Fluffy_Pillow 30.8/130: 24% rage focused_rage
0:52.852 battle_cry Fluffy_Pillow 30.8/130: 24% rage focused_rage
0:52.852 slam Fluffy_Pillow 30.8/130: 24% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
0:53.944 focused_rage Fluffy_Pillow 30.8/130: 24% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:54.175 slam Fluffy_Pillow 30.8/130: 24% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
0:55.262 focused_rage Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:55.496 slam Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:56.580 focused_rage Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:56.817 mortal_strike Fluffy_Pillow 67.9/130: 52% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
0:57.898 focused_rage Fluffy_Pillow 107.4/130: 83% rage focused_rage
0:58.138 slam Fluffy_Pillow 107.4/130: 83% rage focused_rage
0:59.216 focused_rage Fluffy_Pillow 79.4/130: 61% rage focused_rage(2)
0:59.460 colossus_smash Fluffy_Pillow 79.4/130: 61% rage focused_rage(2)
1:00.534 focused_rage Fluffy_Pillow 67.4/130: 52% rage focused_rage(3), precise_strikes, shattered_defenses
1:00.782 mortal_strike Fluffy_Pillow 92.6/130: 71% rage focused_rage(3), precise_strikes, shattered_defenses
1:01.852 focused_rage Fluffy_Pillow 89.2/130: 69% rage focused_rage
1:02.103 heroic_leap Fluffy_Pillow 89.2/130: 69% rage focused_rage
1:02.103 colossus_smash Fluffy_Pillow 89.2/130: 69% rage focused_rage
1:03.170 focused_rage Fluffy_Pillow 77.2/130: 59% rage focused_rage(2), precise_strikes, shattered_defenses
1:03.426 mortal_strike Fluffy_Pillow 77.2/130: 59% rage focused_rage(2), precise_strikes, shattered_defenses
1:04.488 focused_rage Fluffy_Pillow 99.0/130: 76% rage focused_rage
1:04.749 colossus_smash Fluffy_Pillow 99.0/130: 76% rage focused_rage
1:05.806 focused_rage Fluffy_Pillow 87.0/130: 67% rage focused_rage(2), precise_strikes, shattered_defenses
1:06.073 mortal_strike Fluffy_Pillow 87.0/130: 67% rage focused_rage(2), precise_strikes, shattered_defenses
1:07.124 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage
1:07.396 slam Fluffy_Pillow 118.0/130: 91% rage focused_rage
1:08.442 focused_rage Fluffy_Pillow 90.0/130: 69% rage focused_rage(2)
1:08.718 slam Fluffy_Pillow 90.0/130: 69% rage focused_rage(2)
1:09.760 focused_rage Fluffy_Pillow 62.0/130: 48% rage focused_rage(3)
1:10.039 slam Fluffy_Pillow 62.0/130: 48% rage focused_rage(3)
1:11.078 focused_rage Fluffy_Pillow 59.2/130: 46% rage focused_rage(3)
1:11.361 mortal_strike Fluffy_Pillow 59.2/130: 46% rage focused_rage(3)
1:12.396 focused_rage Fluffy_Pillow 46.2/130: 36% rage focused_rage, horrific_appendages
1:12.684 colossus_smash Fluffy_Pillow 46.2/130: 36% rage focused_rage, horrific_appendages
1:13.714 focused_rage Fluffy_Pillow 59.4/130: 46% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
1:14.005 mortal_strike Fluffy_Pillow 59.4/130: 46% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
1:15.032 focused_rage Fluffy_Pillow 56.0/130: 43% rage focused_rage, horrific_appendages
1:15.326 slam Fluffy_Pillow 56.0/130: 43% rage focused_rage, horrific_appendages
1:16.350 focused_rage Fluffy_Pillow 28.0/130: 22% rage focused_rage(2), horrific_appendages
1:16.648 colossus_smash Fluffy_Pillow 65.3/130: 50% rage focused_rage(2), horrific_appendages
1:17.668 focused_rage Fluffy_Pillow 53.3/130: 41% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:17.971 mortal_strike Fluffy_Pillow 53.3/130: 41% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:18.986 focused_rage Fluffy_Pillow 49.9/130: 38% rage focused_rage, horrific_appendages
1:19.294 colossus_smash Fluffy_Pillow 49.9/130: 38% rage focused_rage, horrific_appendages
1:20.304 focused_rage Fluffy_Pillow 63.1/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
1:20.617 battle_cry Fluffy_Pillow 63.1/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses, horrific_appendages
1:20.617 mortal_strike Fluffy_Pillow 63.1/130: 49% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
1:21.622 focused_rage Fluffy_Pillow 78.1/130: 60% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
1:21.941 colossus_smash Fluffy_Pillow 78.1/130: 60% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
1:22.940 focused_rage Fluffy_Pillow 114.8/130: 88% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
1:23.263 mortal_strike Fluffy_Pillow 114.8/130: 88% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
1:24.258 focused_rage Fluffy_Pillow 129.8/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:24.587 mortal_strike Fluffy_Pillow 129.8/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:25.576 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:25.909 colossus_smash Fluffy_Pillow 130.0/130: 100% rage focused_rage
1:26.894 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
1:27.232 slam Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
1:28.212 focused_rage Fluffy_Pillow 90.0/130: 69% rage focused_rage(3), precise_strikes, shattered_defenses
1:28.554 mortal_strike Fluffy_Pillow 90.0/130: 69% rage focused_rage(3), precise_strikes, shattered_defenses
1:29.530 focused_rage Fluffy_Pillow 111.8/130: 86% rage focused_rage
1:29.878 avatar Fluffy_Pillow 111.8/130: 86% rage focused_rage
1:30.000 colossus_smash Fluffy_Pillow 111.8/130: 86% rage avatar, focused_rage
1:30.848 focused_rage Fluffy_Pillow 99.8/130: 77% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:31.323 slam Fluffy_Pillow 99.8/130: 77% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:32.166 focused_rage Fluffy_Pillow 71.8/130: 55% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:32.645 heroic_leap Fluffy_Pillow 97.0/130: 75% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:32.645 mortal_strike Fluffy_Pillow 97.0/130: 75% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:33.484 focused_rage Fluffy_Pillow 93.6/130: 72% rage avatar, focused_rage
1:33.967 colossus_smash Fluffy_Pillow 93.6/130: 72% rage avatar, focused_rage
1:34.802 focused_rage Fluffy_Pillow 81.6/130: 63% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:35.292 arcane_torrent Fluffy_Pillow 81.6/130: 63% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:35.292 slam Fluffy_Pillow 96.6/130: 74% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:36.120 focused_rage Fluffy_Pillow 93.8/130: 72% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:36.613 slam Fluffy_Pillow 93.8/130: 72% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:37.438 focused_rage Fluffy_Pillow 65.8/130: 51% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:37.935 mortal_strike Fluffy_Pillow 65.8/130: 51% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:38.756 focused_rage Fluffy_Pillow 87.6/130: 67% rage avatar, focused_rage
1:39.259 slam Fluffy_Pillow 87.6/130: 67% rage avatar, focused_rage
1:40.074 focused_rage Fluffy_Pillow 59.6/130: 46% rage avatar, focused_rage(2)
1:40.581 slam Fluffy_Pillow 59.6/130: 46% rage avatar, focused_rage(2)
1:41.392 focused_rage Fluffy_Pillow 31.6/130: 24% rage avatar, focused_rage(3)
1:41.903 warbreaker Fluffy_Pillow 31.6/130: 24% rage avatar, focused_rage(3)
1:42.710 focused_rage Fluffy_Pillow 56.1/130: 43% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:43.226 mortal_strike Fluffy_Pillow 56.1/130: 43% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:44.028 focused_rage Fluffy_Pillow 52.7/130: 41% rage avatar, focused_rage
1:44.548 slam Fluffy_Pillow 52.7/130: 41% rage avatar, focused_rage
1:45.346 focused_rage Fluffy_Pillow 49.9/130: 38% rage avatar, focused_rage(2), horrific_appendages
1:45.871 slam Fluffy_Pillow 49.9/130: 38% rage avatar, focused_rage(2), horrific_appendages
1:46.664 focused_rage Fluffy_Pillow 21.9/130: 17% rage avatar, focused_rage(3), horrific_appendages
1:47.195 colossus_smash Fluffy_Pillow 21.9/130: 17% rage avatar, focused_rage(3), horrific_appendages
1:47.982 focused_rage Fluffy_Pillow 9.9/130: 8% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:48.518 battle_cry Fluffy_Pillow 35.1/130: 27% rage avatar, focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
1:48.518 mortal_strike Fluffy_Pillow 35.1/130: 27% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
1:49.300 focused_rage Fluffy_Pillow 50.1/130: 39% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
1:49.841 slam Fluffy_Pillow 50.1/130: 39% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
1:50.618 focused_rage Fluffy_Pillow 50.1/130: 39% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
1:51.166 slam Fluffy_Pillow 50.1/130: 39% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
1:51.936 focused_rage Fluffy_Pillow 87.6/130: 67% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
1:52.489 slam Fluffy_Pillow 87.6/130: 67% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
1:53.254 focused_rage Fluffy_Pillow 87.6/130: 67% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, horrific_appendages
1:53.811 mortal_strike Fluffy_Pillow 87.6/130: 67% rage focused_rage(3), horrific_appendages
1:54.572 focused_rage Fluffy_Pillow 99.8/130: 77% rage focused_rage, horrific_appendages
1:55.132 slam Fluffy_Pillow 99.8/130: 77% rage focused_rage, horrific_appendages
1:55.890 focused_rage Fluffy_Pillow 71.8/130: 55% rage focused_rage(2), horrific_appendages
1:56.453 colossus_smash Fluffy_Pillow 71.8/130: 55% rage focused_rage(2), horrific_appendages
1:57.208 focused_rage Fluffy_Pillow 59.8/130: 46% rage focused_rage(3), precise_strikes, shattered_defenses
1:57.777 mortal_strike Fluffy_Pillow 85.0/130: 65% rage focused_rage(3), precise_strikes, shattered_defenses
1:58.526 focused_rage Fluffy_Pillow 81.6/130: 63% rage focused_rage
1:59.100 slam Fluffy_Pillow 81.6/130: 63% rage focused_rage
1:59.844 focused_rage Fluffy_Pillow 53.6/130: 41% rage focused_rage(2)
2:00.422 colossus_smash Fluffy_Pillow 53.6/130: 41% rage focused_rage(2)
2:01.162 focused_rage Fluffy_Pillow 66.8/130: 51% rage focused_rage(3), precise_strikes, shattered_defenses
2:01.746 mortal_strike Fluffy_Pillow 66.8/130: 51% rage focused_rage(3), precise_strikes, shattered_defenses
2:02.480 focused_rage Fluffy_Pillow 63.4/130: 49% rage focused_rage
2:03.067 heroic_leap Fluffy_Pillow 63.4/130: 49% rage focused_rage
2:03.067 slam Fluffy_Pillow 63.4/130: 49% rage focused_rage
2:03.798 focused_rage Fluffy_Pillow 35.4/130: 27% rage focused_rage(2)
2:04.390 slam Fluffy_Pillow 72.5/130: 56% rage focused_rage(2)
2:05.116 focused_rage Fluffy_Pillow 44.5/130: 34% rage focused_rage(3)
2:05.714 colossus_smash Fluffy_Pillow 44.5/130: 34% rage focused_rage(3)
2:06.434 focused_rage Fluffy_Pillow 32.5/130: 25% rage focused_rage(3), precise_strikes, shattered_defenses
2:07.036 mortal_strike Fluffy_Pillow 32.5/130: 25% rage focused_rage(3), precise_strikes, shattered_defenses
2:07.752 focused_rage Fluffy_Pillow 54.3/130: 42% rage focused_rage
2:08.358 colossus_smash Fluffy_Pillow 54.3/130: 42% rage focused_rage
2:09.070 focused_rage Fluffy_Pillow 42.3/130: 33% rage focused_rage(2), precise_strikes, shattered_defenses
2:09.682 slam Fluffy_Pillow 42.3/130: 33% rage focused_rage(2), precise_strikes, shattered_defenses
2:10.388 focused_rage Fluffy_Pillow 39.5/130: 30% rage focused_rage(3), precise_strikes, shattered_defenses
2:11.005 mortal_strike Fluffy_Pillow 39.5/130: 30% rage focused_rage(3), precise_strikes, shattered_defenses
2:11.706 focused_rage Fluffy_Pillow 36.1/130: 28% rage focused_rage
2:12.330 colossus_smash Fluffy_Pillow 36.1/130: 28% rage focused_rage
2:13.024 focused_rage Fluffy_Pillow 24.1/130: 19% rage focused_rage(2), precise_strikes, shattered_defenses
2:13.654 mortal_strike Fluffy_Pillow 60.4/130: 46% rage focused_rage(2), precise_strikes, shattered_defenses
2:14.342 focused_rage Fluffy_Pillow 57.0/130: 44% rage focused_rage
2:14.977 colossus_smash Fluffy_Pillow 57.0/130: 44% rage focused_rage
2:15.660 focused_rage Fluffy_Pillow 45.0/130: 35% rage focused_rage(2), precise_strikes, shattered_defenses
2:16.299 battle_cry Fluffy_Pillow 45.0/130: 35% rage focused_rage(2), precise_strikes, shattered_defenses
2:16.299 mortal_strike Fluffy_Pillow 45.0/130: 35% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:16.978 focused_rage Fluffy_Pillow 96.9/130: 75% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:17.622 colossus_smash Fluffy_Pillow 96.9/130: 75% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:18.296 focused_rage Fluffy_Pillow 96.9/130: 75% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:18.946 mortal_strike Fluffy_Pillow 96.9/130: 75% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:19.614 focused_rage Fluffy_Pillow 111.9/130: 86% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:20.268 slam Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:20.932 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:21.590 slam Fluffy_Pillow 130.0/130: 100% rage focused_rage(2)
2:22.250 focused_rage Fluffy_Pillow 102.0/130: 78% rage focused_rage(3)
2:22.913 colossus_smash Fluffy_Pillow 102.0/130: 78% rage focused_rage(3)
2:23.568 focused_rage Fluffy_Pillow 115.2/130: 89% rage focused_rage(3), precise_strikes, shattered_defenses
2:24.237 mortal_strike Fluffy_Pillow 115.2/130: 89% rage focused_rage(3), precise_strikes, shattered_defenses
2:24.886 focused_rage Fluffy_Pillow 111.8/130: 86% rage focused_rage
2:25.560 slam Fluffy_Pillow 111.8/130: 86% rage focused_rage
2:26.204 focused_rage Fluffy_Pillow 109.0/130: 84% rage focused_rage(2)
2:26.884 slam Fluffy_Pillow 109.0/130: 84% rage focused_rage(2)
2:27.522 focused_rage Fluffy_Pillow 81.0/130: 62% rage focused_rage(3), horrific_appendages
2:28.207 colossus_smash Fluffy_Pillow 81.0/130: 62% rage focused_rage(3), horrific_appendages
2:28.840 focused_rage Fluffy_Pillow 69.0/130: 53% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:29.530 mortal_strike Fluffy_Pillow 94.2/130: 72% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:30.158 focused_rage Fluffy_Pillow 90.8/130: 70% rage focused_rage, horrific_appendages
2:30.853 slam Fluffy_Pillow 90.8/130: 70% rage focused_rage, horrific_appendages
2:31.476 focused_rage Fluffy_Pillow 62.8/130: 48% rage focused_rage(2), horrific_appendages
2:32.176 colossus_smash Fluffy_Pillow 62.8/130: 48% rage focused_rage(2), horrific_appendages
2:32.794 focused_rage Fluffy_Pillow 88.0/130: 68% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:33.500 heroic_leap Fluffy_Pillow 88.0/130: 68% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:33.500 mortal_strike Fluffy_Pillow 88.0/130: 68% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:34.112 focused_rage Fluffy_Pillow 84.6/130: 65% rage focused_rage, horrific_appendages
2:34.823 slam Fluffy_Pillow 84.6/130: 65% rage focused_rage, horrific_appendages
2:35.430 focused_rage Fluffy_Pillow 56.6/130: 44% rage focused_rage(2), horrific_appendages
2:36.146 colossus_smash Fluffy_Pillow 81.8/130: 63% rage focused_rage(2), horrific_appendages
2:36.748 focused_rage Fluffy_Pillow 69.8/130: 54% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:37.468 mortal_strike Fluffy_Pillow 69.8/130: 54% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
2:38.066 focused_rage Fluffy_Pillow 66.4/130: 51% rage focused_rage, horrific_appendages
2:38.791 slam Fluffy_Pillow 66.4/130: 51% rage focused_rage, horrific_appendages
2:39.384 focused_rage Fluffy_Pillow 74.9/130: 58% rage focused_rage(2)
2:40.113 slam Fluffy_Pillow 74.9/130: 58% rage focused_rage(2)
2:40.702 focused_rage Fluffy_Pillow 46.9/130: 36% rage focused_rage(3)
2:41.435 slam Fluffy_Pillow 46.9/130: 36% rage focused_rage(3)
2:42.020 focused_rage Fluffy_Pillow 18.9/130: 15% rage focused_rage(3)
2:42.757 warbreaker Fluffy_Pillow 56.5/130: 43% rage focused_rage(3)
2:43.338 focused_rage Fluffy_Pillow 44.5/130: 34% rage focused_rage(3), precise_strikes, shattered_defenses
2:44.080 battle_cry Fluffy_Pillow 44.5/130: 34% rage focused_rage(3), precise_strikes, shattered_defenses
2:44.080 mortal_strike Fluffy_Pillow 44.5/130: 34% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:44.656 focused_rage Fluffy_Pillow 59.5/130: 46% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:45.400 slam Fluffy_Pillow 96.2/130: 74% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:45.974 focused_rage Fluffy_Pillow 96.2/130: 74% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:46.723 slam Fluffy_Pillow 96.2/130: 74% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:47.292 focused_rage Fluffy_Pillow 96.2/130: 74% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
2:48.045 mortal_strike Fluffy_Pillow 96.2/130: 74% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
2:48.610 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:49.369 colossus_smash Fluffy_Pillow 130.0/130: 100% rage focused_rage
2:49.928 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
2:50.691 mortal_strike Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
2:51.246 focused_rage Fluffy_Pillow 114.6/130: 88% rage focused_rage
2:52.013 colossus_smash Fluffy_Pillow 130.0/130: 100% rage focused_rage
2:52.564 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
2:53.337 mortal_strike Fluffy_Pillow 118.0/130: 91% rage focused_rage(2), precise_strikes, shattered_defenses
2:53.882 focused_rage Fluffy_Pillow 114.6/130: 88% rage focused_rage
2:54.659 slam Fluffy_Pillow 114.6/130: 88% rage focused_rage
2:55.200 focused_rage Fluffy_Pillow 111.8/130: 86% rage focused_rage(2)
2:55.981 colossus_smash Fluffy_Pillow 111.8/130: 86% rage focused_rage(2)
2:56.518 focused_rage Fluffy_Pillow 99.8/130: 77% rage focused_rage(3), precise_strikes, shattered_defenses
2:57.301 mortal_strike Fluffy_Pillow 99.8/130: 77% rage focused_rage(3), precise_strikes, shattered_defenses
2:57.836 focused_rage Fluffy_Pillow 96.4/130: 74% rage focused_rage
2:58.624 slam Fluffy_Pillow 121.6/130: 94% rage focused_rage
2:59.154 focused_rage Fluffy_Pillow 93.6/130: 72% rage focused_rage(2)
2:59.946 avatar Fluffy_Pillow 93.6/130: 72% rage focused_rage(2)
3:00.000 colossus_smash Fluffy_Pillow 93.6/130: 72% rage avatar, focused_rage(2)
3:00.472 focused_rage Fluffy_Pillow 81.6/130: 63% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:01.322 mortal_strike Fluffy_Pillow 106.8/130: 82% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:01.790 focused_rage Fluffy_Pillow 103.4/130: 80% rage avatar, focused_rage
3:02.644 slam Fluffy_Pillow 103.4/130: 80% rage avatar, focused_rage
3:03.108 focused_rage Fluffy_Pillow 75.4/130: 58% rage avatar, focused_rage(2)
3:03.967 heroic_leap Fluffy_Pillow 75.4/130: 58% rage avatar, focused_rage(2)
3:03.967 slam Fluffy_Pillow 75.4/130: 58% rage avatar, focused_rage(2)
3:04.426 focused_rage Fluffy_Pillow 72.6/130: 56% rage avatar, focused_rage(3)
3:05.290 arcane_torrent Fluffy_Pillow 72.6/130: 56% rage avatar, focused_rage(3)
3:05.292 slam Fluffy_Pillow 87.6/130: 67% rage avatar, focused_rage(3)
3:05.744 focused_rage Fluffy_Pillow 59.6/130: 46% rage avatar, focused_rage(3)
3:06.613 mortal_strike Fluffy_Pillow 59.6/130: 46% rage avatar, focused_rage(3)
3:07.062 focused_rage Fluffy_Pillow 46.6/130: 36% rage avatar, focused_rage
3:07.936 slam Fluffy_Pillow 71.8/130: 55% rage avatar, focused_rage
3:08.380 focused_rage Fluffy_Pillow 43.8/130: 34% rage avatar, focused_rage(2)
3:09.260 slam Fluffy_Pillow 43.8/130: 34% rage avatar, focused_rage(2)
3:09.698 focused_rage Fluffy_Pillow 15.8/130: 12% rage avatar, focused_rage(3)
3:10.583 colossus_smash Fluffy_Pillow 52.1/130: 40% rage avatar, focused_rage(3)
3:11.016 focused_rage Fluffy_Pillow 40.1/130: 31% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:11.906 battle_cry Fluffy_Pillow 40.1/130: 31% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
3:11.906 mortal_strike Fluffy_Pillow 40.1/130: 31% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
3:12.334 focused_rage Fluffy_Pillow 55.1/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
3:13.227 slam Fluffy_Pillow 55.1/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
3:13.652 focused_rage Fluffy_Pillow 55.1/130: 42% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:14.550 slam Fluffy_Pillow 92.2/130: 71% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
3:14.970 focused_rage Fluffy_Pillow 92.2/130: 71% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:15.874 slam Fluffy_Pillow 92.2/130: 71% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:16.288 focused_rage Fluffy_Pillow 92.2/130: 71% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
3:17.197 mortal_strike Fluffy_Pillow 129.3/130: 99% rage avatar, focused_rage(3)
3:17.606 focused_rage Fluffy_Pillow 116.3/130: 89% rage avatar, focused_rage
3:18.517 slam Fluffy_Pillow 116.3/130: 89% rage avatar, focused_rage
3:18.924 focused_rage Fluffy_Pillow 88.3/130: 68% rage avatar, focused_rage(2)
3:19.839 colossus_smash Fluffy_Pillow 88.3/130: 68% rage avatar, focused_rage(2)
3:20.242 focused_rage Fluffy_Pillow 101.5/130: 78% rage focused_rage(3), precise_strikes, shattered_defenses
3:21.161 mortal_strike Fluffy_Pillow 101.5/130: 78% rage focused_rage(3), precise_strikes, shattered_defenses
3:21.560 focused_rage Fluffy_Pillow 98.1/130: 75% rage focused_rage
3:22.483 slam Fluffy_Pillow 98.1/130: 75% rage focused_rage
3:22.878 focused_rage Fluffy_Pillow 70.1/130: 54% rage focused_rage(2)
3:23.805 colossus_smash Fluffy_Pillow 95.3/130: 73% rage focused_rage(2)
3:24.196 focused_rage Fluffy_Pillow 83.3/130: 64% rage focused_rage(3), precise_strikes, shattered_defenses
3:25.127 mortal_strike Fluffy_Pillow 83.3/130: 64% rage focused_rage(3), precise_strikes, shattered_defenses
3:25.514 focused_rage Fluffy_Pillow 79.9/130: 61% rage focused_rage
3:26.448 colossus_smash Fluffy_Pillow 105.1/130: 81% rage focused_rage
3:26.832 focused_rage Fluffy_Pillow 93.1/130: 72% rage focused_rage(2), precise_strikes, shattered_defenses
3:27.771 mortal_strike Fluffy_Pillow 93.1/130: 72% rage focused_rage(2), precise_strikes, shattered_defenses
3:28.150 focused_rage Fluffy_Pillow 89.7/130: 69% rage focused_rage
3:29.094 slam Fluffy_Pillow 89.7/130: 69% rage focused_rage
3:29.468 focused_rage Fluffy_Pillow 61.7/130: 47% rage focused_rage(2)
3:30.417 colossus_smash Fluffy_Pillow 86.9/130: 67% rage focused_rage(2)
3:30.786 focused_rage Fluffy_Pillow 74.9/130: 58% rage focused_rage(3), precise_strikes, shattered_defenses
3:31.742 mortal_strike Fluffy_Pillow 74.9/130: 58% rage focused_rage(3), precise_strikes, shattered_defenses
3:32.104 focused_rage Fluffy_Pillow 71.5/130: 55% rage focused_rage
3:33.065 colossus_smash Fluffy_Pillow 96.7/130: 74% rage focused_rage
3:33.422 focused_rage Fluffy_Pillow 84.7/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
3:34.388 heroic_leap Fluffy_Pillow 84.7/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
3:34.388 mortal_strike Fluffy_Pillow 84.7/130: 65% rage focused_rage(2), precise_strikes, shattered_defenses
3:34.740 focused_rage Fluffy_Pillow 81.3/130: 63% rage focused_rage
3:35.711 slam Fluffy_Pillow 81.3/130: 63% rage focused_rage
3:36.058 focused_rage Fluffy_Pillow 78.5/130: 60% rage focused_rage(2), horrific_appendages
3:37.033 slam Fluffy_Pillow 78.5/130: 60% rage focused_rage(2), horrific_appendages
3:37.376 focused_rage Fluffy_Pillow 50.5/130: 39% rage focused_rage(3), horrific_appendages
3:38.358 colossus_smash Fluffy_Pillow 50.5/130: 39% rage focused_rage(3), horrific_appendages
3:38.694 focused_rage Fluffy_Pillow 38.5/130: 30% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:39.680 battle_cry Fluffy_Pillow 63.7/130: 49% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:39.680 mortal_strike Fluffy_Pillow 63.7/130: 49% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
3:40.012 focused_rage Fluffy_Pillow 78.7/130: 61% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
3:41.003 colossus_smash Fluffy_Pillow 78.7/130: 61% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
3:41.330 focused_rage Fluffy_Pillow 78.7/130: 61% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
3:42.325 mortal_strike Fluffy_Pillow 115.7/130: 89% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, horrific_appendages
3:42.648 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
3:43.648 slam Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, horrific_appendages
3:43.966 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, horrific_appendages
3:44.971 colossus_smash Fluffy_Pillow 130.0/130: 100% rage focused_rage(2), horrific_appendages
3:45.284 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:46.294 mortal_strike Fluffy_Pillow 130.0/130: 100% rage focused_rage(3), precise_strikes, shattered_defenses, horrific_appendages
3:46.602 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage, horrific_appendages
3:47.616 colossus_smash Fluffy_Pillow 118.0/130: 91% rage focused_rage, horrific_appendages
3:47.920 focused_rage Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
3:48.938 mortal_strike Fluffy_Pillow 130.0/130: 100% rage focused_rage(2), precise_strikes, shattered_defenses
3:49.238 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage
3:50.258 colossus_smash Fluffy_Pillow 118.0/130: 91% rage focused_rage
3:50.556 focused_rage Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
3:51.581 mortal_strike Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
3:51.874 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage
3:52.904 colossus_smash Fluffy_Pillow 118.0/130: 91% rage focused_rage
3:53.192 focused_rage Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
3:54.226 mortal_strike Fluffy_Pillow 106.0/130: 82% rage focused_rage(2), precise_strikes, shattered_defenses
3:54.510 focused_rage Fluffy_Pillow 102.6/130: 79% rage focused_rage
3:55.549 slam Fluffy_Pillow 127.8/130: 98% rage focused_rage
3:55.828 focused_rage Fluffy_Pillow 99.8/130: 77% rage focused_rage(2)
3:56.870 slam Fluffy_Pillow 99.8/130: 77% rage focused_rage(2)
3:57.146 focused_rage Fluffy_Pillow 71.8/130: 55% rage focused_rage(3)
3:58.191 warbreaker Fluffy_Pillow 97.0/130: 75% rage focused_rage(3)
3:58.464 focused_rage Fluffy_Pillow 85.0/130: 65% rage focused_rage(3), precise_strikes, shattered_defenses
3:59.515 mortal_strike Fluffy_Pillow 85.0/130: 65% rage focused_rage(3), precise_strikes, shattered_defenses
3:59.782 focused_rage Fluffy_Pillow 81.6/130: 63% rage focused_rage
4:00.837 slam Fluffy_Pillow 81.6/130: 63% rage focused_rage
4:01.100 focused_rage Fluffy_Pillow 53.6/130: 41% rage focused_rage(2)
4:02.160 slam Fluffy_Pillow 78.8/130: 61% rage focused_rage(2)
4:02.418 focused_rage Fluffy_Pillow 50.8/130: 39% rage focused_rage(3)
4:03.482 colossus_smash Fluffy_Pillow 50.8/130: 39% rage focused_rage(3)
4:03.736 focused_rage Fluffy_Pillow 38.8/130: 30% rage focused_rage(3), precise_strikes, shattered_defenses
4:04.805 heroic_leap Fluffy_Pillow 64.0/130: 49% rage focused_rage(3), precise_strikes, shattered_defenses
4:04.805 mortal_strike Fluffy_Pillow 64.0/130: 49% rage focused_rage(3), precise_strikes, shattered_defenses
4:05.054 focused_rage Fluffy_Pillow 60.6/130: 47% rage focused_rage
4:06.128 colossus_smash Fluffy_Pillow 60.6/130: 47% rage focused_rage
4:06.372 focused_rage Fluffy_Pillow 48.6/130: 37% rage focused_rage(2), precise_strikes, shattered_defenses
4:07.451 focused_rage Fluffy_Pillow 85.8/130: 66% rage focused_rage(2), precise_strikes, shattered_defenses
4:07.690 battle_cry Fluffy_Pillow 73.8/130: 57% rage focused_rage(3), precise_strikes, shattered_defenses
4:07.840 slam Fluffy_Pillow 73.8/130: 57% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
4:09.008 focused_rage Fluffy_Pillow 73.8/130: 57% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
4:09.163 potion Fluffy_Pillow 73.8/130: 57% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
4:09.163 execute Fluffy_Pillow 73.8/130: 57% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, potion_of_the_old_war
4:10.486 mortal_strike Fluffy_Pillow 73.8/130: 57% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, potion_of_the_old_war
4:10.486 focused_rage Fluffy_Pillow 88.8/130: 68% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
4:11.809 execute Fluffy_Pillow 126.2/130: 97% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, potion_of_the_old_war
4:11.809 focused_rage Fluffy_Pillow 126.2/130: 97% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, potion_of_the_old_war
4:13.132 execute Fluffy_Pillow 126.2/130: 97% rage focused_rage(2), potion_of_the_old_war
4:14.453 colossus_smash Fluffy_Pillow 130.0/130: 100% rage focused_rage(2), potion_of_the_old_war
4:15.775 execute Fluffy_Pillow 130.0/130: 100% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
4:17.098 execute Fluffy_Pillow 130.0/130: 100% rage focused_rage(2), potion_of_the_old_war
4:18.421 colossus_smash Fluffy_Pillow 98.0/130: 75% rage focused_rage(2), potion_of_the_old_war
4:19.743 execute Fluffy_Pillow 98.0/130: 75% rage focused_rage(2), precise_strikes, shattered_defenses, potion_of_the_old_war
4:21.065 execute Fluffy_Pillow 110.4/130: 85% rage focused_rage(2), potion_of_the_old_war
4:22.388 execute Fluffy_Pillow 78.4/130: 60% rage focused_rage(2), potion_of_the_old_war
4:23.711 execute Fluffy_Pillow 82.6/130: 64% rage focused_rage(2), potion_of_the_old_war
4:25.033 mortal_strike Fluffy_Pillow 50.6/130: 39% rage focused_rage(2), potion_of_the_old_war
4:26.356 execute Fluffy_Pillow 49.6/130: 38% rage potion_of_the_old_war
4:27.678 execute Fluffy_Pillow 42.8/130: 33% rage potion_of_the_old_war
4:29.001 colossus_smash Fluffy_Pillow 10.8/130: 8% rage potion_of_the_old_war
4:30.000 avatar Fluffy_Pillow 36.0/130: 28% rage avatar, precise_strikes, shattered_defenses, potion_of_the_old_war
4:30.323 execute Fluffy_Pillow 36.0/130: 28% rage avatar, precise_strikes, shattered_defenses, potion_of_the_old_war
4:31.645 mortal_strike Fluffy_Pillow 23.2/130: 18% rage avatar, potion_of_the_old_war
4:32.968 execute Fluffy_Pillow 47.4/130: 36% rage avatar, potion_of_the_old_war
4:34.292 colossus_smash Fluffy_Pillow 15.4/130: 12% rage avatar
4:35.615 arcane_torrent Fluffy_Pillow 15.4/130: 12% rage avatar, precise_strikes, shattered_defenses
4:35.615 battle_cry Fluffy_Pillow 30.4/130: 23% rage avatar, precise_strikes, shattered_defenses
4:35.615 heroic_leap Fluffy_Pillow 30.4/130: 23% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
4:35.615 focused_rage Fluffy_Pillow 30.4/130: 23% rage avatar, corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses
4:35.615 execute Fluffy_Pillow 30.4/130: 23% rage avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses
4:36.933 focused_rage Fluffy_Pillow 67.0/130: 52% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:36.936 execute Fluffy_Pillow 67.0/130: 52% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
4:38.251 focused_rage Fluffy_Pillow 67.0/130: 52% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:38.257 mortal_strike Fluffy_Pillow 67.0/130: 52% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
4:39.569 focused_rage Fluffy_Pillow 119.8/130: 92% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:39.580 execute Fluffy_Pillow 119.8/130: 92% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
4:40.903 colossus_smash Fluffy_Pillow 119.8/130: 92% rage avatar, focused_rage
4:42.224 execute Fluffy_Pillow 119.8/130: 92% rage avatar, focused_rage, precise_strikes, shattered_defenses, horrific_appendages
4:43.547 colossus_smash Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage, horrific_appendages
4:44.870 execute Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage, precise_strikes, shattered_defenses, horrific_appendages
4:46.192 colossus_smash Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage, horrific_appendages
4:47.515 execute Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage, precise_strikes, shattered_defenses, horrific_appendages
4:48.838 execute Fluffy_Pillow 130.0/130: 100% rage avatar, focused_rage, horrific_appendages
4:50.162 execute Fluffy_Pillow 98.0/130: 75% rage focused_rage, horrific_appendages
4:51.484 execute Fluffy_Pillow 66.0/130: 51% rage focused_rage, horrific_appendages
4:52.806 mortal_strike Fluffy_Pillow 59.2/130: 46% rage focused_rage, horrific_appendages
4:54.129 execute Fluffy_Pillow 58.2/130: 45% rage horrific_appendages
4:55.451 colossus_smash Fluffy_Pillow 51.4/130: 40% rage horrific_appendages
4:56.773 execute Fluffy_Pillow 51.4/130: 40% rage precise_strikes, shattered_defenses, horrific_appendages
4:58.097 colossus_smash Fluffy_Pillow 63.8/130: 49% rage horrific_appendages
4:59.423 execute Fluffy_Pillow 63.8/130: 49% rage precise_strikes, shattered_defenses, horrific_appendages
5:00.745 mortal_strike Fluffy_Pillow 51.0/130: 39% rage horrific_appendages

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 27987 26281 14801 (6219)
Agility 6579 6254 0
Stamina 42257 42257 26247
Intellect 5328 5003 0
Spirit 2 2 0
Health 2535420 2535420 0
Rage 130 130 0
Crit 18.49% 18.49% 4370
Haste 13.75% 13.75% 4470
Damage / Heal Versatility 2.81% 2.81% 1124
Attack Power 27987 26281 0
Mastery 81.32% 79.18% 11055
Armor 4353 4353 4353
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 883.00
Local Head Warhelm of the Obsidian Aspect
ilevel: 880, stats: { 593 Armor, +1715 Str, +2573 Sta, +793 Crit, +668 Haste }
Local Neck Zealous Timestone Pendant
ilevel: 880, stats: { +1448 Sta, +1233 Mastery, +822 Haste }, enchant: { +300 Mastery }
Local Shoulders Shoulderplates of the Obsidian Aspect
ilevel: 880, stats: { 547 Armor, +1287 Str, +1930 Sta, +759 Haste, +336 Crit }
Local Chest Breastplate of the Remembered King
ilevel: 880, stats: { 729 Armor, +2573 Sta, +1715 StrInt, +1012 Mastery, +448 Vers }
Local Waist Gilded Nightborne Waistplate
ilevel: 880, stats: { 410 Armor, +1930 Sta, +1287 StrInt, +759 Mastery, +336 Vers }
Local Legs Legplates of the Obsidian Aspect
ilevel: 880, stats: { 638 Armor, +1715 Str, +2573 Sta, +918 Crit, +542 Haste }
Local Feet Leystone-Toe Kickers
ilevel: 880, stats: { 501 Armor, +1930 Sta, +1287 StrInt, +665 Mastery, +430 Haste }
Local Wrists Jagged Carapace Wristclamps
ilevel: 880, stats: { 319 Armor, +1448 Sta, +965 StrInt, +481 Mastery, +340 Vers }
Local Hands Archavon's Heavy Hand
ilevel: 895, stats: { 471 Armor, +2219 Sta, +1479 Str, +496 Crit, +662 Haste }
Local Finger1 Ring of Exclusive Servitude
ilevel: 880, stats: { +1448 Sta, +1350 Mastery, +704 Crit }, enchant: { +200 Mastery }
Local Finger2 Ring of the Scoured Clan
ilevel: 880, stats: { +1448 Sta, +1467 Mastery, +587 Haste }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Trinket2 Terrorbound Nexus
ilevel: 880, stats: { +1043 Mastery }
Local Back Greatcloak of the Obsidian Aspect
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +516 Mastery, +305 Crit }, enchant: { +200 Str }
Local Main Hand Strom'kar, the Warbreaker
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }

Talents

Level
15 Dauntless (Arms Warrior) Overpower (Arms Warrior) Sweeping Strikes (Arms Warrior)
30 Shockwave (Arms Warrior) Storm Bolt (Arms Warrior) Double Time
45 Fervor of Battle (Arms Warrior) Rend (Arms Warrior) Avatar
60 Second Wind Bounding Stride Defensive Stance (Arms Warrior)
75 In For The Kill (Arms Warrior) Mortal Combo (Arms Warrior) Focused Rage (Arms Warrior)
90 Deadly Calm (Arms Warrior) Trauma (Arms Warrior) Titanic Might (Arms Warrior)
100 Anger Management Opportunity Strikes (Arms Warrior) Ravager (Arms Warrior)

Profile

warrior="Warrior_Arms_T19M"
level=110
race=blood_elf
role=attack
position=back
talents=1332311
artifact=36:140815:141523:140822:0:1136:1:1137:1:1138:1:1139:1:1140:1:1141:1:1142:1:1143:3:1144:3:1145:3:1146:3:1147:3:1148:3:1149:4:1150:5:1151:3:1356:1
spec=arms

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=charge
actions+=/auto_attack
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
actions+=/blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
actions+=/berserking,if=buff.battle_cry.up|target.time_to_die<=11
actions+=/arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
actions+=/battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
actions+=/avatar,if=(buff.bloodlust.up|time>=1)
actions+=/heroic_leap,if=debuff.colossus_smash.up
actions+=/rend,if=remains<gcd
actions+=/focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
actions+=/colossus_smash,if=debuff.colossus_smash.down
actions+=/warbreaker,if=debuff.colossus_smash.down
actions+=/ravager
actions+=/overpower,if=buff.overpower.react
actions+=/run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
actions+=/run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
actions+=/run_action_list,name=execute,if=target.health.pct<=20
actions+=/run_action_list,name=single,if=target.health.pct>20

actions.aoe=mortal_strike
actions.aoe+=/execute,if=buff.stone_heart.react
actions.aoe+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.aoe+=/warbreaker,if=buff.shattered_defenses.down
actions.aoe+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.aoe+=/rend,if=remains<=duration*0.3
actions.aoe+=/bladestorm
actions.aoe+=/cleave
actions.aoe+=/whirlwind,if=rage>=60
actions.aoe+=/shockwave
actions.aoe+=/storm_bolt

actions.cleave=mortal_strike
actions.cleave+=/execute,if=buff.stone_heart.react
actions.cleave+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.cleave+=/warbreaker,if=buff.shattered_defenses.down
actions.cleave+=/focused_rage,if=rage>100|buff.battle_cry_deadly_calm.up
actions.cleave+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.cleave+=/rend,if=remains<=duration*0.3
actions.cleave+=/bladestorm
actions.cleave+=/cleave
actions.cleave+=/whirlwind,if=rage>40|buff.cleave.up
actions.cleave+=/shockwave
actions.cleave+=/storm_bolt

actions.execute=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
actions.execute+=/execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/colossus_smash,if=buff.shattered_defenses.down
actions.execute+=/warbreaker,if=buff.shattered_defenses.down&rage<=30
actions.execute+=/execute,if=buff.shattered_defenses.up&rage>22
actions.execute+=/mortal_strike,if=equipped.archavons_heavy_hand&rage<60
actions.execute+=/execute,if=buff.shattered_defenses.down
actions.execute+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

actions.single=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
actions.single+=/colossus_smash,if=buff.shattered_defenses.down
actions.single+=/warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
actions.single+=/focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
actions.single+=/mortal_strike
actions.single+=/execute,if=buff.stone_heart.react
actions.single+=/slam
actions.single+=/execute,if=equipped.archavons_heavy_hand
actions.single+=/focused_rage,if=equipped.archavons_heavy_hand
actions.single+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

head=warhelm_of_the_obsidian_aspect,id=138357,bonus_id=1806
neck=zealous_timestone_pendant,id=140894,bonus_id=1806,enchant=mark_of_the_trained_soldier
shoulders=shoulderplates_of_the_obsidian_aspect,id=138363,bonus_id=1806
back=greatcloak_of_the_obsidian_aspect,id=138374,bonus_id=1806,enchant=binding_of_strength
chest=breastplate_of_the_remembered_king,id=140913,bonus_id=1806
wrists=jagged_carapace_wristclamps,id=140902,bonus_id=1806
hands=archavons_heavy_hand,id=137060,bonus_id=1811
waist=gilded_nightborne_waistplate,id=140880,bonus_id=1806
legs=legplates_of_the_obsidian_aspect,id=138360,bonus_id=1806
feet=leystonetoe_kickers,id=140884,bonus_id=1806
finger1=ring_of_exclusive_servitude,id=140906,bonus_id=1806,enchant=binding_of_mastery
finger2=ring_of_the_scoured_clan,id=140897,bonus_id=1806,enchant=binding_of_mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1806
trinket2=terrorbound_nexus,id=137406,bonus_id=1806
main_hand=stromkar_the_warbreaker,id=128910,bonus_id=750,gem_id=140815/137377/139257,relic_id=1806/1806/1806

# Gear Summary
# gear_ilvl=882.73
# gear_strength=14801
# gear_stamina=26247
# gear_crit_rating=4370
# gear_haste_rating=4470
# gear_mastery_rating=11055
# gear_versatility_rating=1124
# gear_armor=4353
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

Warrior_Fury_T19M : 465148 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
465147.7 465147.7 355.9 / 0.077% 61664.8 / 13.3% 50398.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.2 9.2 Rage 0.00% 57.0 100.0% 100%
Talents
  • 15: Endless Rage (Fury Warrior)
  • 30: Storm Bolt (Fury Warrior)
  • 45: Avatar
  • 60: Bounding Stride
  • 75: Massacre (Fury Warrior)
  • 90: Inner Rage (Fury Warrior)
  • 100: Dragon Roar (Fury Warrior)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Warrior_Fury_T19M 465148
auto_attack_mh 50610 10.9% 225.9 1.33sec 67260 50661 Direct 225.9 46341 99743 67259 40.1% 1.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 225.95 225.95 0.00 0.00 1.3276 0.0000 15197081.25 22341148.95 31.98 50660.65 50660.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 133.00 58.86% 46341.44 31711 61309 46347.86 44883 48327 6163555 9061009 31.98
crit 90.57 40.08% 99743.37 63422 141011 99800.95 94380 106724 9033526 13280139 31.98
miss 2.38 1.05% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 25310 5.4% 225.9 1.33sec 33636 25335 Direct 225.9 23172 49866 33635 40.1% 1.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 225.95 225.95 0.00 0.00 1.3276 0.0000 7599846.79 11172494.66 31.98 25334.68 25334.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.91 58.83% 23171.86 15855 30654 23174.91 22283 24041 3079883 4527720 31.98
crit 90.64 40.12% 49866.05 31711 70505 49895.39 47294 53945 4519964 6644775 31.98
miss 2.39 1.06% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bloodthirst 33293 7.2% 50.9 5.23sec 196616 176938 Direct 50.9 129212 265229 196619 49.6% 0.0%  

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.87 50.87 0.00 0.00 1.1112 0.0000 10001395.91 14702999.34 31.98 176937.57 176937.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.66 50.44% 129212.33 90031 174063 129328.95 114110 141426 3315512 4874117 31.98
crit 25.21 49.56% 265228.55 180061 400346 265291.99 234052 292877 6685883 9828882 31.98
 
 

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.enrage.down|rage<50
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:
  • description:Assault the target in a bloodthirsty craze, dealing ${$sw2*$<mult>} Physical damage and restoring {$117313s1=4}% of your health. |cFFFFFFFFGenerates ${$m3/10} Rage.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.01
 
Dragon Roar 6744 1.4% 13.7 22.68sec 147783 132475 Direct 13.7 0 147783 147783 100.0% 0.0%  

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.70 13.70 0.00 0.00 1.1156 0.0000 2024621.31 2024621.31 0.00 132475.38 132475.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 13.70 100.00% 147782.90 101697 188426 147828.26 131834 161605 2024621 2024621 0.00
 
 

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:Damage done increased by {$s2=20}%.
  • description:Roar explosively, dealing $m1 damage to all enemies within $A1 yards and increasing all damage you deal by {$s2=20}% for {$d=6 seconds}. Dragon Roar ignores all armor and always critically strikes.
 
Execute 67747 (101615) 14.6% (21.9%) 43.6 6.92sec 702190 615884 Direct 43.6 299548 624892 468159 51.8% 0.0%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.55 43.55 0.00 0.00 1.1401 0.0000 20389800.21 29974937.69 31.98 615884.09 615884.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.98 48.18% 299547.70 149257 793572 298455.63 225343 400646 6285222 9239872 31.98
crit 22.57 51.82% 624892.14 298515 1858401 622439.77 465106 812764 14104578 20735066 31.98
 
 

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.13
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2))|buff.stone_heart.react
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
    Execute Off-Hand 33868 7.3% 0.0 0.00sec 0 0 Direct 43.6 149899 312226 234036 51.8% 0.0%  

Stats details: execute_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 43.55 0.00 0.00 0.0000 0.0000 10193155.96 14984904.78 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.98 48.17% 149898.86 74630 396795 149418.42 110912 197668 3144663 4622953 31.98
crit 22.58 51.83% 312225.75 149261 929222 311044.01 227852 405015 7048493 10361952 31.98
 
 

Action details: execute_offhand

Static Values
  • id:163558
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.13
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:163558
  • name:Execute Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc5308=Attempt to finish off a wounded foe, causing ${$sw2+$163558sw2} Physical damage. Only usable on enemies that have less than 20% health.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Fel-Crazed Rage 1451 0.3% 2.9 129.18sec 151997 0 Direct 2.9 77895 156393 152137 94.6% 0.0%  

Stats details: felcrazed_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 2.87 0.00 0.00 0.0000 0.0000 436209.88 436209.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.16 5.42% 77894.90 54356 105091 12111.68 0 105091 12112 12112 0.00
crit 2.71 94.58% 156392.75 108712 241708 155207.55 119583 189383 424098 424098 0.00
 
 

Action details: felcrazed_rage

Static Values
  • id:225777
  • school:shadow
  • resource:none
  • range:8.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225777
  • name:Fel-Crazed Rage
  • school:shadow
  • tooltip:
  • description:{$@spelldesc225141=Enter a fel-crazed rage, dealing {$225777s1=29114 to 32178} Shadow damage to a random nearby enemy every ${$t1}.2 sec for {$d=3 seconds}. You cannot move or use abilities during your rage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:50927.68
  • base_dd_max:56288.48
 
Furious Slash 10590 2.3% 27.7 8.68sec 114826 103498 Direct 27.7 84156 178127 114827 32.6% 0.0%  

Stats details: furious_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.71 27.71 0.00 0.00 1.1095 0.0000 3181322.34 4676845.19 31.98 103498.03 103498.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.66 67.36% 84155.77 58710 113508 84170.54 75243 92010 1570600 2308931 31.98
crit 9.04 32.64% 178126.77 117419 261068 178539.67 0 244042 1610722 2367914 31.97
 
 

Action details: furious_slash

Static Values
  • id:100130
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
Spelldata
  • id:100130
  • name:Furious Slash
  • school:physical
  • tooltip:
  • description:Aggressively strike with your off-hand weapon for ${$sw3*$<mult>} Physical damage.$?a231824[ Increases your Bloodthirst critical strike chance by {$206333s1=15}% until it next deals a critical strike, stacking up to {$206333u=6} times.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.93
 
Mark of the Hidden Satyr 6732 1.4% 19.4 15.48sec 104208 0 Direct 19.4 71556 155826 104210 38.7% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.40 19.40 0.00 0.00 0.0000 0.0000 2021849.37 2021849.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.88 61.25% 71555.71 50191 97037 71506.24 55104 86255 850389 850389 0.00
crit 7.52 38.75% 155826.23 100381 223186 155706.27 0 223186 1171461 1171461 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Odyn's Fury 0 (25477) 0.0% (5.5%) 7.2 44.31sec 1058155 970017

Stats details: odyns_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.23 0.00 0.00 0.00 1.0910 0.0000 0.00 0.00 0.00 970017.26 970017.26
 
 

Action details: odyns_fury

Static Values
  • id:205545
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up&buff.enrage.up
Spelldata
  • id:205545
  • name:Odyn's Fury
  • school:physical
  • tooltip:
  • description:Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.
 
    Odyn's Fury (_mh) 20250 4.4% 0.0 0.00sec 0 0 Direct 7.2 0 434179 434179 100.0% 0.0%  
Periodic 28.7 53006 112588 102547 83.1% 0.0% 9.5%

Stats details: odyns_fury_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.23 28.69 28.69 0.0000 1.0000 6082500.73 6082500.73 0.00 211978.14 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 7.23 100.00% 434179.11 366254 527406 434163.67 410205 505431 3139931 3139931 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.8 16.85% 53006.10 31389 60687 53285.29 0 60687 256309 256309 0.00
crit 23.9 83.15% 112587.93 62778 139579 112686.91 101614 130560 2686261 2686261 0.00
 
 

Action details: odyns_fury_mh

Static Values
  • id:205546
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205546
  • name:Odyn's Fury
  • school:fire
  • tooltip:Suffering $o3 Fire damage over {$d=4 seconds}.
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.000000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
    Odyn's Fury (_oh) 5227 1.1% 0.0 0.00sec 0 0 Direct 7.2 0 217090 217090 100.0% 0.0%  

Stats details: odyns_fury_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 7.23 0.00 0.00 0.0000 0.0000 1569965.43 1569965.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 7.23 100.00% 217089.55 183127 263703 217081.84 205102 252715 1569965 1569965 0.00
 
 

Action details: odyns_fury_oh

Static Values
  • id:205547
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205547
  • name:Odyn's Fury
  • school:fire
  • tooltip:
  • description:{$@spelldesc205545=Unleashes the fiery power Odyn bestowed the |cFFFFCC99Warswords|r, dealing ${$205546sw2+$205547sw2} Fire damage and an additional $205546o3 Fire damage over {$205546d=4 seconds} to all enemies within $205546A2 yards.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
Potion of the Old War 26513 5.6% 27.6 11.08sec 284284 0 Direct 27.6 180265 403550 284284 46.6% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.57 27.57 0.00 0.00 0.0000 0.0000 7836968.53 11521086.07 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.72 53.41% 180264.66 117183 226559 180203.58 155357 209396 2654279 3902041 31.98
crit 12.84 46.59% 403549.55 234366 521087 404571.15 338172 507493 5182690 7619045 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Raging Blow 0 (94115) 0.0% (20.2%) 61.9 4.71sec 457123 410194

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.85 0.00 0.00 0.00 1.1144 0.0000 0.00 0.00 0.00 410194.29 410194.29
 
 

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.juggernaut.down&buff.enrage.up
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r
 
    Raging Blow (_oh) 31361 6.7% 0.0 0.00sec 0 0 Direct 61.9 108075 231081 152321 36.0% 0.0%  

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 61.85 0.00 0.00 0.0000 0.0000 9421732.90 13850839.82 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.61 64.03% 108075.35 73955 142983 108110.31 101318 115180 4280343 6292509 31.98
crit 22.25 35.97% 231080.85 147909 328860 231487.99 207221 263988 5141390 7558331 31.98
 
 

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.95
 
    Raging Blow (_mh) 62755 13.5% 0.0 0.00sec 0 0 Direct 61.9 216160 462066 304798 36.0% 0.0%  

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 61.85 0.00 0.00 0.0000 0.0000 18853369.54 27716239.06 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.56 63.95% 216160.22 147909 285965 216224.91 202447 229848 8550782 12570459 31.98
crit 22.30 36.05% 462065.65 295819 657720 462881.75 422350 522753 10302588 15145780 31.98
 
 

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:
  • description:{$@spelldesc85288=A mighty blow with both weapons that deals a total of ${($96103sw2+$85384sw2)*$<mult>} Physical damage.$?a215573[][ Only usable while Enraged.] |cFFFFFFFFGenerates ${$m2/10} Rage.|r}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.95
 
Rampage 0 (71445) 0.0% (15.4%) 49.4 6.12sec 434836 301374

Stats details: rampage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.35 0.00 0.00 0.00 1.4429 0.0000 0.00 0.00 0.00 301373.90 301373.90
 
 

Action details: rampage

Static Values
  • id:184367
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:2.0000
  • min_gcd:0.7500
  • base_cost:85.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.meat_cleaver.up
Spelldata
  • id:184367
  • name:Rampage
  • school:physical
  • tooltip:
  • description:Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.
 
    Rampage (1) 6175 1.3% 0.0 0.00sec 0 0 Direct 49.4 25948 55366 37581 39.5% 0.0%  

Stats details: rampage1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.35 0.00 0.00 0.0000 0.0000 1854701.30 2726586.59 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.83 60.45% 25948.41 18565 35893 25946.82 23451 28293 774166 1138098 31.98
crit 19.52 39.55% 55365.55 37130 82554 55404.71 46658 64394 1080535 1588489 31.98
 
 

Action details: rampage1

Static Values
  • id:218617
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:218617
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.62
 
    Rampage (2) 9783 2.1% 0.0 0.00sec 0 0 Direct 49.3 41305 87833 59586 39.3% 0.0%  

Stats details: rampage2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.31 0.00 0.00 0.0000 0.0000 2938065.72 4319234.91 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.93 60.71% 41305.18 37607 54154 41317.58 38950 44452 1236431 1817671 31.98
crit 19.37 39.29% 87832.83 75214 124555 87923.27 79438 98771 1701635 2501564 31.98
 
 

Action details: rampage2

Static Values
  • id:184707
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184707
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.87
 
    Rampage (3) 12952 2.8% 0.0 0.00sec 0 0 Direct 49.3 54655 116292 78984 39.5% 0.0%  

Stats details: rampage3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.26 0.00 0.00 0.0000 0.0000 3890560.36 5719492.25 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.81 60.53% 54654.74 49851 71786 54663.58 51347 59475 1629494 2395511 31.98
crit 19.44 39.47% 116291.55 99703 165108 116418.44 105186 134120 2261066 3323982 31.98
 
 

Action details: rampage3

Static Values
  • id:184709
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:184709
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.24
 
    Rampage (4) 19649 4.2% 0.0 0.00sec 0 0 Direct 49.1 82578 176795 120103 39.8% 0.0%  

Stats details: rampage4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.14 0.00 0.00 0.0000 0.0000 5901999.09 8676497.72 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.57 60.17% 82577.87 75433 108623 82595.62 77445 88843 2441784 3589653 31.98
crit 19.57 39.83% 176794.89 150866 249834 177029.65 159271 198219 3460215 5086844 31.98
 
 

Action details: rampage4

Static Values
  • id:201364
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201364
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
    Rampage (5) 22886 4.9% 0.0 0.00sec 0 0 Direct 49.1 96233 205982 139902 39.8% 0.0%  

Stats details: rampage5

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 49.14 0.00 0.00 0.0000 0.0000 6874303.45 10105877.22 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.58 60.21% 96233.49 87896 126570 96254.67 89714 101959 2847046 4185427 31.98
crit 19.55 39.79% 205981.91 175792 291111 206253.21 183635 239780 4027258 5920450 31.98
 
 

Action details: rampage5

Static Values
  • id:201363
  • school:physical
  • resource:none
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:201363
  • name:Rampage
  • school:physical
  • tooltip:
  • description:{$@spelldesc184367=Enrages you and unleashes a series of 5 brutal strikes over 2 sec for a total of ${$218617sw1+$184707sw1+$184709sw1+$201364sw1+$201363sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.19
 
Rend Flesh 11254 2.4% 45.3 6.66sec 74623 0 Periodic 132.6 17413 37960 25508 39.4% 0.0% 85.9%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.34 0.00 132.64 132.64 0.0000 1.9472 3383378.17 3383378.17 0.00 13099.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.4 60.60% 17412.60 6 23852 17414.84 16081 18621 1399619 1399619 0.00
crit 52.3 39.40% 37959.93 17 54859 37990.18 34247 41843 1983759 1983759 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:12167.02
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Warrior_Fury_T19M
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_T19M
  • harmful:false
  • if_expr:
 
Avatar 4.1 86.06sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 7.4 43.65sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:50.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Berserking 2.0 181.28sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.battle_cry.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Charge 1.0 0.00sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_T19M
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_T19M
  • harmful:false
  • if_expr:
 
Heroic Leap 12.0 26.36sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Avatar 4.1 0.0 85.9sec 86.1sec 26.05% 26.05% 0.0(0.0) 3.7

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:26.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 7.4 0.0 43.3sec 43.6sec 12.29% 12.29% 0.0(0.0) 7.3

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:12.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Berserking 2.0 0.0 199.8sec 181.0sec 6.77% 8.47% 0.0(0.0) 2.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking (_) 6.2 65.9 47.0sec 3.6sec 27.76% 27.76% 0.0(0.0) 5.7

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_berserking_
  • max_stacks:12
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03

Stack Uptimes

  • berserking__1:2.06%
  • berserking__2:2.04%
  • berserking__3:2.03%
  • berserking__4:2.02%
  • berserking__5:2.01%
  • berserking__6:2.00%
  • berserking__7:1.99%
  • berserking__8:1.98%
  • berserking__9:1.97%
  • berserking__10:1.95%
  • berserking__11:1.94%
  • berserking__12:5.76%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:200953
  • name:Berserking
  • tooltip:Attack speed and critical strike chance increased by {$s1=3}%.
  • description:{$@spelldesc200845=Rampage and Execute have a chance to activate Berserking, increasing your attack speed and critical strike chance by {$200953s1=3}% every $200951t sec for {$200951d=12 seconds}.}
  • max_stacks:12
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 17.88% 0.0(0.0) 1.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Dragon Roar 13.7 0.0 22.7sec 22.7sec 27.10% 27.10% 0.0(0.0) 13.4

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_dragon_roar
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • dragon_roar_1:27.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118000
  • name:Dragon Roar
  • tooltip:Damage done increased by {$s2=20}%.
  • description:Roar explosively, dealing $m1 damage to all enemies within $A1 yards and increasing all damage you deal by {$s2=20}% for {$d=6 seconds}. Dragon Roar ignores all armor and always critically strikes.
  • max_stacks:0
  • duration:6.00
  • cooldown:25.00
  • default_chance:0.00%
Enrage 15.1 59.4 18.8sec 4.0sec 92.58% 94.43% 59.4(59.4) 14.2

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:5.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • enrage_1:92.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184362
  • name:Enrage
  • tooltip:Attack speed increased by {$s1=100}% and damage taken increased by {$s2=20}%.
  • description:{$@spelldesc184361=Bloodthirst critical strikes $?a206320[or activating Berserker Rage ][]will Enrage you, increasing your attack speed by {$184362s1=100}% and damage you take by {$184362s2=20}% for {$184362d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Juggernaut 13.7 29.8 19.1sec 6.9sec 50.10% 68.42% 0.0(0.0) 12.7

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_juggernaut
  • max_stacks:99
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05

Stack Uptimes

  • juggernaut_1:23.31%
  • juggernaut_2:7.13%
  • juggernaut_3:2.57%
  • juggernaut_4:1.26%
  • juggernaut_5:0.85%
  • juggernaut_6:0.77%
  • juggernaut_7:0.75%
  • juggernaut_8:0.74%
  • juggernaut_9:0.74%
  • juggernaut_10:0.74%
  • juggernaut_11:0.75%
  • juggernaut_12:0.76%
  • juggernaut_13:0.75%
  • juggernaut_14:0.76%
  • juggernaut_15:0.76%
  • juggernaut_16:0.76%
  • juggernaut_17:0.75%
  • juggernaut_18:0.75%
  • juggernaut_19:0.76%
  • juggernaut_20:0.74%
  • juggernaut_21:0.70%
  • juggernaut_22:0.64%
  • juggernaut_23:0.56%
  • juggernaut_24:0.46%
  • juggernaut_25:0.37%
  • juggernaut_26:0.29%
  • juggernaut_27:0.22%
  • juggernaut_28:0.16%
  • juggernaut_29:0.12%
  • juggernaut_30:0.08%
  • juggernaut_31:0.05%
  • juggernaut_32:0.04%
  • juggernaut_33:0.02%
  • juggernaut_34:0.01%
  • juggernaut_35:0.01%
  • juggernaut_36:0.00%
  • juggernaut_37:0.00%
  • juggernaut_38:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201009
  • name:Juggernaut
  • tooltip:Execute damage increased by {$s1=5}%.
  • description:{$@spelldesc200875=Execute increases damage dealt by Execute by {$201009s1=5}% for {$201009d=6 seconds}, stacking up to {$201009u=99} times.}
  • max_stacks:99
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Massacre 22.9 22.3 13.5sec 6.7sec 19.50% 19.50% 22.3(22.3) 0.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_massacre
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • massacre_1:19.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206316
  • name:Massacre
  • tooltip:Rampage costs no Rage.
  • description:{$@spelldesc206315=Execute critical strikes reduce the Rage cost of your next Rampage by {$206316s1=100}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Odyn's Champion 8.8 1.0 32.1sec 28.4sec 18.78% 15.91% 1.0(1.0) 8.6

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_odyns_champion
  • max_stacks:1
  • duration:6.00
  • cooldown:0.10
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • odyns_champion_1:18.78%

Trigger Attempt Success

  • trigger_pct:20.07%

Spelldata details

  • id:200986
  • name:Odyn's Champion
  • tooltip:All special ability uses will reduce the cooldown of all abilities by {$200872s1=1} sec.
  • description:{$@spelldesc200872=When you use Rampage, Odyn has a chance to declare you the Champion of the Valarjar for {$200986d=6 seconds}, causing all your offensive abilities to reduce the cooldown of all your abilities by {$s1=1} sec.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 261.5sec 0.0sec 16.20% 16.20% 0.0(0.0) 1.9

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:16.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Sense Death 6.5 0.0 38.7sec 37.7sec 10.10% 10.10% 0.0(0.0) 1.2

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_sense_death
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • sense_death_1:10.10%

Trigger Attempt Success

  • trigger_pct:14.84%

Spelldata details

  • id:200979
  • name:Sense Death
  • tooltip:Your next Execute will cost 0 rage.
  • description:{$@spelldesc200863=Execute has a {$h=15}% chance to make your next Execute cost no Rage.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Stone Heart 22.2 1.2 13.6sec 13.0sec 5.88% 5.88% 1.2(1.2) 0.0

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_stone_heart
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stone_heart_1:5.88%

Trigger Attempt Success

  • trigger_pct:2.03%

Spelldata details

  • id:225947
  • name:Stone Heart
  • tooltip:Execute costs no Rage and can be used on any target.
  • description:{$@spelldesc207767=Your attacks have a chance to make your next Execute cost no $?s12712[initial ][]Rage$?s12712[, consume no extra Rage,][] and be usable on any target, regardless of health level.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Taste for Blood 22.3 5.4 10.8sec 8.7sec 42.96% 42.96% 0.0(0.0) 5.2

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_taste_for_blood
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • taste_for_blood_1:35.64%
  • taste_for_blood_2:6.53%
  • taste_for_blood_3:0.75%
  • taste_for_blood_4:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206333
  • name:Taste for Blood
  • tooltip:Critical strike chance of Bloodthirst increased by {$s1=15}%.
  • description:Furious Slash increases the critical strike chance of Bloodthirst by {$s1=15}%.
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Warrior_Fury_T19M
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Heroic Leap0.7540.0011.5512.5610.00010.521
Battle Cry1.6860.0014.7060.5810.0008.978
Avatar5.2390.00116.0446.2650.00034.957
Bloodthirst1.8950.00574.33894.49538.418181.756
Odyn's Fury5.7390.001130.02917.2940.000140.781
Dragon Roar1.6360.00120.1598.1420.00028.268

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Fury_T19M
execute Rage 43.6 471.4 10.8 10.8 64873.6
rampage Rage 49.4 2299.6 46.6 46.6 9331.9
Resource Gains Type Count Total Average Overflow
charge Rage 1.00 35.00 (1.25%) 35.00 0.00 0.00%
bloodthirst Rage 50.87 486.47 (17.36%) 9.56 22.22 4.37%
raging_blow Rage 61.86 297.00 (10.60%) 4.80 12.28 3.97%
melee_main_hand Rage 223.57 1348.17 (48.11%) 6.03 127.40 8.63%
melee_off_hand Rage 223.56 635.56 (22.68%) 2.84 102.18 13.85%
Resource RPS-Gain RPS-Loss
Health 9271.11 0.00
Rage 9.32 9.22
Combat End Resource Mean Min Max
Rage 31.24 0.10 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 9.4%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Warrior_Fury_T19M Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Warrior_Fury_T19M Damage Per Second
Count 7499
Mean 465147.75
Minimum 405006.99
Maximum 534854.13
Spread ( max - min ) 129847.14
Range [ ( max - min ) / 2 * 100% ] 13.96%
Standard Deviation 15722.4954
5th Percentile 440369.07
95th Percentile 492305.17
( 95th Percentile - 5th Percentile ) 51936.10
Mean Distribution
Standard Deviation 181.5598
95.00% Confidence Intervall ( 464791.89 - 465503.60 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4388
0.1 Scale Factor Error with Delta=300 2110214
0.05 Scale Factor Error with Delta=300 8440858
0.01 Scale Factor Error with Delta=300 211021459
Priority Target DPS
Sample Data Warrior_Fury_T19M Priority Target Damage Per Second
Count 7499
Mean 465147.75
Minimum 405006.99
Maximum 534854.13
Spread ( max - min ) 129847.14
Range [ ( max - min ) / 2 * 100% ] 13.96%
Standard Deviation 15722.4954
5th Percentile 440369.07
95th Percentile 492305.17
( 95th Percentile - 5th Percentile ) 51936.10
Mean Distribution
Standard Deviation 181.5598
95.00% Confidence Intervall ( 464791.89 - 465503.60 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4388
0.1 Scale Factor Error with Delta=300 2110214
0.05 Scale Factor Error with Delta=300 8440858
0.01 Scale Factor Error with Delta=300 211021459
DPS(e)
Sample Data Warrior_Fury_T19M Damage Per Second (Effective)
Count 7499
Mean 465147.75
Minimum 405006.99
Maximum 534854.13
Spread ( max - min ) 129847.14
Range [ ( max - min ) / 2 * 100% ] 13.96%
Damage
Sample Data Warrior_Fury_T19M Damage
Count 7499
Mean 139652828.25
Minimum 100743485.32
Maximum 184824623.22
Spread ( max - min ) 84081137.90
Range [ ( max - min ) / 2 * 100% ] 30.10%
DTPS
Sample Data Warrior_Fury_T19M Damage Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Warrior_Fury_T19M Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Warrior_Fury_T19M Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Warrior_Fury_T19M Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Warrior_Fury_T19M Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Warrior_Fury_T19M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Warrior_Fury_T19MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Warrior_Fury_T19M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 1.00 auto_attack
6 1.00 charge
7 0.00 run_action_list,name=movement,if=movement.distance>5
8 11.96 heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
9 2.87 use_item,name=draught_of_souls,if=(spell_targets.whirlwind>1|!raid_event.adds.exists)&((talent.bladestorm.enabled&cooldown.bladestorm.remains=0)|buff.battle_cry.up|target.time_to_die<25)
A 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
B 7.44 battle_cry,if=(cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))
C 4.09 avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
0.00 bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
0.00 blood_fury,if=buff.battle_cry.up
D 2.00 berserking,if=buff.battle_cry.up
0.00 arcane_torrent,if=rage<rage.max-40
E 0.00 call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
F 0.00 call_action_list,name=aoe,if=spell_targets.whirlwind>3
G 0.00 call_action_list,name=single_target
actions.single_target
# count action,conditions
0.00 bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
I 20.95 execute,if=(artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2))|buff.stone_heart.react
J 45.45 rampage,if=rage=100&(target.health.pct>20|target.health.pct<20&!talent.massacre.enabled)|buff.massacre.react&buff.enrage.remains<1
0.00 berserker_rage,if=talent.outburst.enabled&cooldown.odyns_fury.remains=0&buff.enrage.down
K 13.70 dragon_roar,if=cooldown.odyns_fury.remains>=10|cooldown.odyns_fury.remains<=3
L 7.23 odyns_fury,if=buff.battle_cry.up&buff.enrage.up
M 3.90 rampage,if=buff.enrage.down&buff.juggernaut.down
0.00 furious_slash,if=talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
N 35.58 raging_blow,if=buff.juggernaut.down&buff.enrage.up
0.00 whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
O 22.60 execute,if=talent.inner_rage.enabled|!talent.inner_rage.enabled&rage>50
P 7.89 bloodthirst,if=buff.enrage.down
Q 2.93 raging_blow,if=buff.enrage.down
0.00 execute,if=artifact.juggernaut.enabled
R 23.35 raging_blow
S 42.98 bloodthirst
T 27.71 furious_slash
U 0.00 call_action_list,name=bladestorm
0.00 bloodbath,if=buff.frothing_berserker.up|(rage>80&!talent.frothing_berserker.enabled)

Sample Sequence

0124568B9CDIKJLRSTJNSTNSTJNSTNSTJNSTNSTJKNST8NSIJRJSRTSNJSNTSBLKNJSNT8SQTPMIRSTRSTNJIKRJSNJIRSI8QPTRJSNBCLSNJKNSTQMIIOJIRST8QJSNTSNKSJNISRTSJIRSJB89ILJJKNSTQPTJNSIIR8SJRKSNTSJNSTNPJBCDLNSIRK8JJNSIRPJIRSJRSTJNSTN8KJNSTNBPLNJSNTSIRJJRSKNPM8NSTNIOOOJROSIJOOOJKORJB9ACILO8JOOOJOOOJIKOJOOOJ8OROJO

Sample Sequence Table

time name target resources buffs
Pre flask Warrior_Fury_T19M 0.0/100: 0% rage
Pre food Warrior_Fury_T19M 0.0/100: 0% rage
Pre augmentation Warrior_Fury_T19M 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% rage potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% rage potion_of_the_old_war
0:00.000 charge Fluffy_Pillow 9.9/100: 10% rage bloodlust, stone_heart, potion_of_the_old_war
0:00.000 heroic_leap Fluffy_Pillow 44.9/100: 45% rage bloodlust, stone_heart, potion_of_the_old_war
0:00.000 battle_cry Fluffy_Pillow 44.9/100: 45% rage bloodlust, stone_heart, potion_of_the_old_war
0:00.000 use_item_draught_of_souls Fluffy_Pillow 44.9/100: 45% rage bloodlust, battle_cry, stone_heart, potion_of_the_old_war
0:00.000 avatar Fluffy_Pillow 44.9/100: 45% rage bloodlust, battle_cry, stone_heart, potion_of_the_old_war
0:00.000 berserking Fluffy_Pillow 44.9/100: 45% rage bloodlust, avatar, battle_cry, stone_heart, potion_of_the_old_war
0:00.000 execute Fluffy_Pillow 44.9/100: 45% rage bloodlust, berserking, avatar, battle_cry, stone_heart, potion_of_the_old_war
0:00.787 dragon_roar Fluffy_Pillow 44.9/100: 45% rage bloodlust, berserking, massacre, avatar, juggernaut, battle_cry, potion_of_the_old_war
0:01.574 rampage Fluffy_Pillow 44.9/100: 45% rage bloodlust, berserking, massacre, avatar, dragon_roar, juggernaut, battle_cry, potion_of_the_old_war
0:02.623 odyns_fury Fluffy_Pillow 54.8/100: 55% rage bloodlust, berserking, avatar, dragon_roar, enrage, juggernaut, battle_cry, potion_of_the_old_war
0:03.413 raging_blow Fluffy_Pillow 64.7/100: 65% rage bloodlust, berserking, avatar, dragon_roar, enrage, juggernaut, battle_cry, potion_of_the_old_war
0:04.201 bloodthirst Fluffy_Pillow 79.6/100: 80% rage bloodlust, berserking, avatar, dragon_roar, enrage, juggernaut, battle_cry, potion_of_the_old_war
0:04.989 furious_slash Fluffy_Pillow 99.5/100: 99% rage bloodlust, berserking, avatar, dragon_roar, enrage, juggernaut, battle_cry, potion_of_the_old_war
0:05.777 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, berserking, avatar, dragon_roar, enrage, taste_for_blood, juggernaut, potion_of_the_old_war
0:06.827 raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, berserking, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:07.614 bloodthirst Fluffy_Pillow 39.8/100: 40% rage bloodlust, berserking, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:08.403 furious_slash Fluffy_Pillow 49.8/100: 50% rage bloodlust, berserking, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:09.189 raging_blow Fluffy_Pillow 59.7/100: 60% rage bloodlust, berserking, avatar, enrage, taste_for_blood(2), potion_of_the_old_war
0:09.976 bloodthirst Fluffy_Pillow 74.6/100: 75% rage bloodlust, berserking, avatar, enrage, taste_for_blood(2), potion_of_the_old_war
0:10.876 furious_slash Fluffy_Pillow 94.5/100: 94% rage bloodlust, avatar, enrage, potion_of_the_old_war
0:11.781 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:12.988 raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:13.894 bloodthirst Fluffy_Pillow 39.8/100: 40% rage bloodlust, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:14.800 furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:15.707 raging_blow Fluffy_Pillow 69.6/100: 70% rage bloodlust, avatar, enrage, taste_for_blood(2), potion_of_the_old_war
0:16.612 bloodthirst Fluffy_Pillow 74.6/100: 75% rage bloodlust, avatar, enrage, taste_for_blood(2), potion_of_the_old_war
0:17.516 furious_slash Fluffy_Pillow 94.5/100: 94% rage bloodlust, avatar, enrage, potion_of_the_old_war
0:18.420 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:19.627 raging_blow Fluffy_Pillow 24.9/100: 25% rage bloodlust, avatar, enrage, taste_for_blood, potion_of_the_old_war
0:20.534 bloodthirst Fluffy_Pillow 39.8/100: 40% rage bloodlust, enrage, taste_for_blood, potion_of_the_old_war
0:21.440 furious_slash Fluffy_Pillow 59.7/100: 60% rage bloodlust, enrage, potion_of_the_old_war
0:22.345 raging_blow Fluffy_Pillow 69.6/100: 70% rage bloodlust, enrage, taste_for_blood, potion_of_the_old_war
0:23.251 bloodthirst Fluffy_Pillow 84.5/100: 84% rage bloodlust, enrage, taste_for_blood
0:24.156 furious_slash Fluffy_Pillow 94.5/100: 94% rage bloodlust, enrage, taste_for_blood
0:25.061 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, taste_for_blood(2)
0:26.267 dragon_roar Fluffy_Pillow 24.9/100: 25% rage bloodlust, enrage, taste_for_blood(2), berserking_
0:27.173 raging_blow Fluffy_Pillow 34.8/100: 35% rage bloodlust, dragon_roar, enrage, taste_for_blood(2), berserking_(2)
0:28.078 bloodthirst Fluffy_Pillow 49.7/100: 50% rage bloodlust, dragon_roar, enrage, taste_for_blood(2), berserking_(3)
0:28.984 furious_slash Fluffy_Pillow 69.6/100: 70% rage bloodlust, dragon_roar, enrage, berserking_(3)
0:29.892 heroic_leap Fluffy_Pillow 79.5/100: 79% rage bloodlust, dragon_roar, enrage, taste_for_blood, berserking_(4)
0:30.000 raging_blow Fluffy_Pillow 79.5/100: 79% rage bloodlust, dragon_roar, enrage, taste_for_blood, berserking_(4)
0:30.907 bloodthirst Fluffy_Pillow 94.4/100: 94% rage bloodlust, dragon_roar, enrage, taste_for_blood, berserking_(5)
0:31.813 execute Fluffy_Pillow 100.0/100: 100% rage bloodlust, dragon_roar, enrage, taste_for_blood, berserking_(6), stone_heart
0:32.720 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, massacre, enrage, taste_for_blood, sense_death, juggernaut, berserking_(7)
0:33.927 raging_blow Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, taste_for_blood, sense_death, juggernaut, berserking_(8)
0:34.833 rampage Fluffy_Pillow 100.0/100: 100% rage bloodlust, enrage, taste_for_blood, sense_death, juggernaut, berserking_(9)
0:36.041 bloodthirst Fluffy_Pillow 34.8/100: 35% rage bloodlust, enrage, taste_for_blood, sense_death, juggernaut, berserking_(10)
0:36.946 raging_blow Fluffy_Pillow 54.7/100: 55% rage bloodlust, enrage, taste_for_blood, sense_death, juggernaut, berserking_(11)
0:37.850 furious_slash Fluffy_Pillow 69.6/100: 70% rage bloodlust, enrage, sense_death, berserking_(12)
0:38.755 bloodthirst Fluffy_Pillow 79.5/100: 79% rage bloodlust, enrage, taste_for_blood, sense_death, berserking_(12)
0:39.661 raging_blow Fluffy_Pillow 99.4/100: 99% rage bloodlust, enrage, sense_death, berserking_(12)
0:40.737 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, sense_death
0:42.242 bloodthirst Fluffy_Pillow 24.9/100: 25% rage enrage, sense_death, odyns_champion
0:43.418 raging_blow Fluffy_Pillow 44.8/100: 45% rage enrage, sense_death, odyns_champion
0:44.595 furious_slash Fluffy_Pillow 49.8/100: 50% rage enrage, odyns_champion
0:45.773 bloodthirst Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood, odyns_champion
0:46.000 battle_cry Fluffy_Pillow 69.7/100: 70% rage enrage, odyns_champion, battle_cry
0:46.948 odyns_fury Fluffy_Pillow 79.6/100: 80% rage enrage, odyns_champion, battle_cry
0:48.124 dragon_roar Fluffy_Pillow 89.5/100: 89% rage enrage, battle_cry
0:49.301 raging_blow Fluffy_Pillow 99.4/100: 99% rage dragon_roar, enrage, battle_cry
0:50.479 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage, battle_cry
0:51.984 bloodthirst Fluffy_Pillow 24.9/100: 25% rage dragon_roar, enrage
0:53.162 raging_blow Fluffy_Pillow 34.9/100: 35% rage dragon_roar, enrage
0:54.340 furious_slash Fluffy_Pillow 49.8/100: 50% rage enrage
0:55.518 heroic_leap Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood
0:55.518 bloodthirst Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood
0:56.695 raging_blow Fluffy_Pillow 76.3/100: 76% rage taste_for_blood
0:57.873 furious_slash Fluffy_Pillow 81.3/100: 81% rage taste_for_blood
0:59.049 bloodthirst Fluffy_Pillow 81.3/100: 81% rage taste_for_blood(2)
1:00.227 rampage Fluffy_Pillow 91.3/100: 91% rage taste_for_blood(2)
1:01.730 execute Fluffy_Pillow 16.2/100: 16% rage enrage, taste_for_blood(2), stone_heart
1:02.906 raging_blow Fluffy_Pillow 16.2/100: 16% rage enrage, taste_for_blood(2), sense_death, juggernaut
1:04.082 bloodthirst Fluffy_Pillow 31.1/100: 31% rage enrage, taste_for_blood(2), sense_death, juggernaut
1:05.257 furious_slash Fluffy_Pillow 51.0/100: 51% rage enrage, sense_death, juggernaut
1:06.434 raging_blow Fluffy_Pillow 60.9/100: 61% rage enrage, taste_for_blood, sense_death, juggernaut
1:07.611 bloodthirst Fluffy_Pillow 75.8/100: 76% rage enrage, taste_for_blood, sense_death, juggernaut
1:08.787 furious_slash Fluffy_Pillow 95.7/100: 96% rage enrage, sense_death
1:09.963 raging_blow Fluffy_Pillow 95.7/100: 96% rage enrage, taste_for_blood, sense_death
1:11.140 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, sense_death
1:12.645 execute Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, sense_death, stone_heart
1:13.823 dragon_roar Fluffy_Pillow 34.8/100: 35% rage massacre, enrage, taste_for_blood, juggernaut
1:14.999 raging_blow Fluffy_Pillow 44.7/100: 45% rage massacre, dragon_roar, enrage, taste_for_blood, juggernaut
1:16.176 rampage Fluffy_Pillow 59.6/100: 60% rage massacre, dragon_roar, enrage, taste_for_blood, juggernaut
1:17.681 bloodthirst Fluffy_Pillow 69.5/100: 70% rage dragon_roar, enrage, juggernaut
1:18.860 raging_blow Fluffy_Pillow 89.4/100: 89% rage dragon_roar, enrage
1:20.036 rampage Fluffy_Pillow 100.0/100: 100% rage enrage
1:21.541 execute Fluffy_Pillow 24.9/100: 25% rage enrage, stone_heart
1:22.718 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, juggernaut
1:23.895 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, juggernaut
1:25.072 execute Fluffy_Pillow 59.7/100: 60% rage enrage, juggernaut, stone_heart
1:26.250 heroic_leap Fluffy_Pillow 69.6/100: 70% rage sense_death, juggernaut(2)
1:26.250 raging_blow Fluffy_Pillow 69.6/100: 70% rage sense_death, juggernaut(2)
1:27.425 bloodthirst Fluffy_Pillow 74.6/100: 75% rage sense_death, juggernaut(2)
1:28.602 furious_slash Fluffy_Pillow 94.5/100: 94% rage enrage, sense_death, juggernaut(2)
1:29.778 raging_blow Fluffy_Pillow 94.5/100: 94% rage enrage, taste_for_blood, sense_death, juggernaut(2)
1:30.955 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, sense_death, juggernaut(2)
1:32.460 bloodthirst Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, sense_death, berserking_
1:33.637 raging_blow Fluffy_Pillow 44.8/100: 45% rage enrage, taste_for_blood, sense_death, berserking_(2)
1:34.813 battle_cry Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood, sense_death, berserking_(3)
1:35.000 avatar Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood, sense_death, battle_cry, berserking_(4)
1:35.000 odyns_fury Fluffy_Pillow 59.7/100: 60% rage avatar, enrage, taste_for_blood, sense_death, battle_cry, berserking_(4)
1:36.175 bloodthirst Fluffy_Pillow 69.6/100: 70% rage avatar, enrage, taste_for_blood, sense_death, battle_cry, berserking_(5)
1:37.352 raging_blow Fluffy_Pillow 89.5/100: 89% rage avatar, enrage, battle_cry, berserking_(6)
1:38.529 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, enrage, battle_cry, berserking_(7)
1:40.031 dragon_roar Fluffy_Pillow 24.9/100: 25% rage avatar, enrage, berserking_(9)
1:41.206 raging_blow Fluffy_Pillow 44.7/100: 45% rage avatar, dragon_roar, enrage, berserking_(10)
1:42.381 bloodthirst Fluffy_Pillow 59.6/100: 60% rage avatar, dragon_roar, enrage, berserking_(11)
1:43.557 furious_slash Fluffy_Pillow 79.5/100: 79% rage avatar, dragon_roar, enrage, berserking_(12)
1:44.734 raging_blow Fluffy_Pillow 82.8/100: 83% rage avatar, dragon_roar, taste_for_blood, berserking_(12)
1:45.909 rampage Fluffy_Pillow 87.8/100: 88% rage avatar, dragon_roar, taste_for_blood, berserking_(12)
1:47.414 execute Fluffy_Pillow 12.7/100: 13% rage avatar, enrage, taste_for_blood, stone_heart
1:48.591 execute Fluffy_Pillow 22.6/100: 23% rage massacre, avatar, enrage, taste_for_blood, sense_death, juggernaut, stone_heart
1:49.768 execute Fluffy_Pillow 32.5/100: 32% rage massacre, avatar, enrage, taste_for_blood, juggernaut(2), stone_heart
1:50.946 rampage Fluffy_Pillow 42.4/100: 42% rage massacre, avatar, enrage, taste_for_blood, juggernaut(3)
1:52.451 execute Fluffy_Pillow 52.3/100: 52% rage avatar, enrage, juggernaut(3), stone_heart
1:53.627 raging_blow Fluffy_Pillow 62.2/100: 62% rage avatar, enrage, juggernaut(4)
1:54.803 bloodthirst Fluffy_Pillow 67.2/100: 67% rage avatar, enrage, juggernaut(4)
1:55.979 furious_slash Fluffy_Pillow 87.1/100: 87% rage enrage, juggernaut(4)
1:57.157 heroic_leap Fluffy_Pillow 97.0/100: 97% rage taste_for_blood, juggernaut(4)
1:57.157 raging_blow Fluffy_Pillow 97.0/100: 97% rage taste_for_blood, juggernaut(4)
1:58.335 rampage Fluffy_Pillow 100.0/100: 100% rage taste_for_blood, juggernaut(4)
1:59.840 bloodthirst Fluffy_Pillow 15.0/100: 15% rage enrage, taste_for_blood
2:01.015 raging_blow Fluffy_Pillow 34.9/100: 35% rage enrage, taste_for_blood
2:02.193 furious_slash Fluffy_Pillow 49.8/100: 50% rage enrage, taste_for_blood
2:03.370 bloodthirst Fluffy_Pillow 59.7/100: 60% rage enrage, taste_for_blood(2)
2:04.547 raging_blow Fluffy_Pillow 69.7/100: 70% rage enrage
2:05.725 dragon_roar Fluffy_Pillow 84.6/100: 85% rage enrage
2:06.902 bloodthirst Fluffy_Pillow 94.5/100: 94% rage dragon_roar, enrage
2:08.078 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage
2:09.581 raging_blow Fluffy_Pillow 24.9/100: 25% rage dragon_roar, enrage
2:10.757 execute Fluffy_Pillow 39.8/100: 40% rage dragon_roar, enrage, stone_heart
2:11.931 bloodthirst Fluffy_Pillow 49.7/100: 50% rage enrage, juggernaut, berserking_
2:13.108 raging_blow Fluffy_Pillow 59.7/100: 60% rage enrage, juggernaut, berserking_(2)
2:14.285 furious_slash Fluffy_Pillow 74.6/100: 75% rage enrage, juggernaut, berserking_(3)
2:15.461 bloodthirst Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood, juggernaut, berserking_(4)
2:16.638 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, juggernaut, berserking_(5)
2:18.143 execute Fluffy_Pillow 24.9/100: 25% rage enrage, odyns_champion, berserking_(7), stone_heart
2:19.320 raging_blow Fluffy_Pillow 34.8/100: 35% rage massacre, enrage, juggernaut, odyns_champion, berserking_(8)
2:20.499 bloodthirst Fluffy_Pillow 59.6/100: 60% rage massacre, enrage, juggernaut, odyns_champion, berserking_(9)
2:21.674 rampage Fluffy_Pillow 79.5/100: 79% rage massacre, enrage, juggernaut, odyns_champion, berserking_(10)
2:21.674 battle_cry Fluffy_Pillow 79.5/100: 79% rage enrage, juggernaut, odyns_champion, battle_cry, berserking_(10)
2:23.179 heroic_leap Fluffy_Pillow 89.4/100: 89% rage enrage, juggernaut, odyns_champion, battle_cry, berserking_(12), stone_heart
2:23.179 use_item_draught_of_souls Fluffy_Pillow 89.4/100: 89% rage enrage, juggernaut, odyns_champion, battle_cry, berserking_(12), stone_heart
2:23.179 execute Fluffy_Pillow 89.4/100: 89% rage enrage, juggernaut, odyns_champion, battle_cry, berserking_(12), stone_heart
2:24.355 odyns_fury Fluffy_Pillow 99.3/100: 99% rage massacre, enrage, juggernaut(2), odyns_champion, battle_cry, berserking_(12)
2:25.532 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, enrage, juggernaut(2), odyns_champion, battle_cry, berserking_(12)
2:27.037 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, juggernaut(2), odyns_champion
2:28.542 dragon_roar Fluffy_Pillow 24.9/100: 25% rage enrage, juggernaut(2), odyns_champion
2:29.718 raging_blow Fluffy_Pillow 34.8/100: 35% rage dragon_roar, enrage
2:30.894 bloodthirst Fluffy_Pillow 49.7/100: 50% rage dragon_roar, enrage
2:32.070 furious_slash Fluffy_Pillow 69.6/100: 70% rage dragon_roar, enrage
2:33.247 raging_blow Fluffy_Pillow 79.5/100: 79% rage dragon_roar, taste_for_blood
2:34.423 bloodthirst Fluffy_Pillow 84.5/100: 84% rage dragon_roar, taste_for_blood
2:35.600 furious_slash Fluffy_Pillow 94.5/100: 94% rage enrage
2:36.778 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood
2:38.283 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, odyns_champion
2:39.461 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, odyns_champion
2:40.636 execute Fluffy_Pillow 59.7/100: 60% rage enrage, odyns_champion, stone_heart
2:41.812 execute Fluffy_Pillow 69.6/100: 70% rage enrage, juggernaut, odyns_champion, stone_heart
2:42.989 raging_blow Fluffy_Pillow 79.5/100: 79% rage enrage, sense_death, juggernaut(2), odyns_champion
2:44.165 heroic_leap Fluffy_Pillow 94.4/100: 94% rage enrage, sense_death, juggernaut(2)
2:44.165 bloodthirst Fluffy_Pillow 94.4/100: 94% rage enrage, sense_death, juggernaut(2)
2:45.343 rampage Fluffy_Pillow 100.0/100: 100% rage sense_death, juggernaut(2)
2:46.846 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, sense_death, juggernaut(2)
2:48.023 dragon_roar Fluffy_Pillow 39.8/100: 40% rage enrage, sense_death
2:49.199 bloodthirst Fluffy_Pillow 49.7/100: 50% rage dragon_roar, enrage, sense_death
2:50.374 raging_blow Fluffy_Pillow 69.6/100: 70% rage dragon_roar, enrage, sense_death
2:51.551 furious_slash Fluffy_Pillow 84.5/100: 84% rage dragon_roar, enrage, sense_death
2:52.726 bloodthirst Fluffy_Pillow 94.4/100: 94% rage dragon_roar, enrage, taste_for_blood, sense_death
2:53.904 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage
2:55.408 raging_blow Fluffy_Pillow 34.8/100: 35% rage enrage, berserking_
2:56.585 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, berserking_(2)
2:57.761 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, berserking_(3)
2:58.936 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, berserking_(5)
3:00.111 bloodthirst Fluffy_Pillow 84.5/100: 84% rage taste_for_blood, berserking_(6)
3:01.290 rampage Fluffy_Pillow 100.0/100: 100% rage taste_for_blood, berserking_(7)
3:01.674 battle_cry Fluffy_Pillow 15.0/100: 15% rage enrage, taste_for_blood, battle_cry, berserking_(7)
3:01.774 avatar Fluffy_Pillow 15.0/100: 15% rage avatar, enrage, taste_for_blood, battle_cry, berserking_(7)
3:02.795 berserking Fluffy_Pillow 15.0/100: 15% rage avatar, enrage, taste_for_blood, odyns_champion, battle_cry, berserking_(8)
3:02.795 odyns_fury Fluffy_Pillow 15.0/100: 15% rage berserking, avatar, enrage, taste_for_blood, odyns_champion, battle_cry, berserking_(8)
3:03.820 raging_blow Fluffy_Pillow 24.9/100: 25% rage berserking, avatar, enrage, taste_for_blood, odyns_champion, battle_cry, berserking_(9)
3:04.843 bloodthirst Fluffy_Pillow 49.7/100: 50% rage berserking, avatar, enrage, taste_for_blood, odyns_champion, battle_cry, berserking_(10)
3:05.866 execute Fluffy_Pillow 69.6/100: 70% rage berserking, avatar, enrage, odyns_champion, battle_cry, berserking_(11), stone_heart
3:06.889 raging_blow Fluffy_Pillow 79.5/100: 79% rage berserking, massacre, avatar, enrage, juggernaut, odyns_champion, berserking_(12)
3:07.911 dragon_roar Fluffy_Pillow 94.4/100: 94% rage berserking, massacre, avatar, enrage, juggernaut, odyns_champion, berserking_(12)
3:09.048 heroic_leap Fluffy_Pillow 100.0/100: 100% rage berserking, massacre, avatar, dragon_roar, enrage, juggernaut
3:09.048 rampage Fluffy_Pillow 100.0/100: 100% rage berserking, massacre, avatar, dragon_roar, enrage, juggernaut
3:10.410 rampage Fluffy_Pillow 100.0/100: 100% rage berserking, avatar, dragon_roar, enrage, juggernaut
3:11.911 raging_blow Fluffy_Pillow 34.8/100: 35% rage berserking, avatar, dragon_roar, enrage
3:12.954 bloodthirst Fluffy_Pillow 39.8/100: 40% rage avatar, dragon_roar, enrage
3:14.131 execute Fluffy_Pillow 59.7/100: 60% rage avatar, enrage, stone_heart
3:15.308 raging_blow Fluffy_Pillow 69.6/100: 70% rage avatar, enrage, juggernaut
3:16.486 bloodthirst Fluffy_Pillow 84.5/100: 84% rage avatar, juggernaut
3:17.662 rampage Fluffy_Pillow 100.0/100: 100% rage avatar, juggernaut, stone_heart
3:19.165 execute Fluffy_Pillow 15.0/100: 15% rage avatar, enrage, juggernaut, odyns_champion, stone_heart
3:20.343 raging_blow Fluffy_Pillow 24.9/100: 25% rage massacre, avatar, enrage, juggernaut(2), odyns_champion
3:21.519 bloodthirst Fluffy_Pillow 29.9/100: 30% rage massacre, avatar, enrage, juggernaut(2), odyns_champion
3:22.695 rampage Fluffy_Pillow 49.8/100: 50% rage massacre, enrage, juggernaut(2), odyns_champion
3:24.201 raging_blow Fluffy_Pillow 59.7/100: 60% rage enrage, juggernaut(2), odyns_champion, berserking_
3:25.376 bloodthirst Fluffy_Pillow 74.6/100: 75% rage enrage, berserking_(2)
3:26.552 furious_slash Fluffy_Pillow 94.5/100: 94% rage enrage, berserking_(3)
3:27.730 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, taste_for_blood, berserking_(5)
3:29.236 raging_blow Fluffy_Pillow 24.9/100: 25% rage enrage, taste_for_blood, berserking_(6)
3:30.412 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage, taste_for_blood, berserking_(7)
3:31.588 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage, berserking_(8)
3:32.765 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood, berserking_(10)
3:33.941 heroic_leap Fluffy_Pillow 84.5/100: 84% rage enrage, taste_for_blood, berserking_(11)
3:34.048 dragon_roar Fluffy_Pillow 94.4/100: 94% rage enrage, taste_for_blood, berserking_(11)
3:35.225 rampage Fluffy_Pillow 100.0/100: 100% rage dragon_roar, enrage, taste_for_blood, berserking_(12)
3:36.728 raging_blow Fluffy_Pillow 24.9/100: 25% rage dragon_roar, enrage, taste_for_blood, berserking_(12)
3:37.906 bloodthirst Fluffy_Pillow 39.8/100: 40% rage dragon_roar, enrage, taste_for_blood
3:39.083 furious_slash Fluffy_Pillow 59.7/100: 60% rage dragon_roar, enrage, taste_for_blood
3:40.259 raging_blow Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood(2)
3:41.435 battle_cry Fluffy_Pillow 84.5/100: 84% rage taste_for_blood(2)
3:41.435 bloodthirst Fluffy_Pillow 84.5/100: 84% rage taste_for_blood(2), battle_cry
3:42.611 odyns_fury Fluffy_Pillow 94.5/100: 94% rage enrage, battle_cry
3:43.787 raging_blow Fluffy_Pillow 94.5/100: 94% rage enrage, battle_cry
3:44.965 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, battle_cry
3:46.469 bloodthirst Fluffy_Pillow 24.9/100: 25% rage enrage
3:47.644 raging_blow Fluffy_Pillow 44.8/100: 45% rage enrage
3:48.821 furious_slash Fluffy_Pillow 59.7/100: 60% rage enrage
3:49.999 bloodthirst Fluffy_Pillow 69.6/100: 70% rage enrage, taste_for_blood
3:51.178 execute Fluffy_Pillow 89.5/100: 89% rage enrage, stone_heart
3:52.354 raging_blow Fluffy_Pillow 99.4/100: 99% rage massacre, enrage, juggernaut
3:53.532 rampage Fluffy_Pillow 100.0/100: 100% rage massacre, enrage, juggernaut
3:55.036 rampage Fluffy_Pillow 100.0/100: 100% rage enrage, juggernaut
3:56.541 raging_blow Fluffy_Pillow 34.8/100: 35% rage enrage, juggernaut
3:57.716 bloodthirst Fluffy_Pillow 39.8/100: 40% rage enrage
3:58.892 dragon_roar Fluffy_Pillow 59.7/100: 60% rage enrage
4:00.224 raging_blow Fluffy_Pillow 69.6/100: 70% rage dragon_roar, enrage
4:01.402 bloodthirst Fluffy_Pillow 84.5/100: 84% rage dragon_roar
4:02.577 rampage Fluffy_Pillow 94.5/100: 94% rage dragon_roar
4:04.080 heroic_leap Fluffy_Pillow 19.4/100: 19% rage dragon_roar, enrage
4:04.080 raging_blow Fluffy_Pillow 19.4/100: 19% rage dragon_roar, enrage
4:05.256 bloodthirst Fluffy_Pillow 34.3/100: 34% rage enrage
4:06.433 furious_slash Fluffy_Pillow 54.2/100: 54% rage enrage
4:07.610 raging_blow Fluffy_Pillow 54.2/100: 54% rage enrage, taste_for_blood
4:08.784 execute Fluffy_Pillow 69.1/100: 69% rage taste_for_blood
4:09.962 execute Fluffy_Pillow 50.7/100: 51% rage taste_for_blood, juggernaut
4:11.138 execute Fluffy_Pillow 25.7/100: 26% rage taste_for_blood, juggernaut(2)
4:12.314 execute Fluffy_Pillow 4.0/100: 4% rage massacre, taste_for_blood, sense_death, juggernaut(3)
4:13.491 rampage Fluffy_Pillow 4.0/100: 4% rage massacre, taste_for_blood, juggernaut(4)
4:14.996 raging_blow Fluffy_Pillow 13.9/100: 14% rage enrage, juggernaut(4)
4:16.170 execute Fluffy_Pillow 28.8/100: 29% rage enrage, juggernaut(4)
4:17.347 bloodthirst Fluffy_Pillow 3.8/100: 4% rage massacre, enrage, juggernaut(5)
4:18.523 execute Fluffy_Pillow 23.7/100: 24% rage massacre, enrage, juggernaut(5), stone_heart
4:19.697 rampage Fluffy_Pillow 33.6/100: 34% rage massacre, sense_death, juggernaut(6)
4:21.202 execute Fluffy_Pillow 43.5/100: 43% rage enrage, sense_death, juggernaut(6)
4:22.379 execute Fluffy_Pillow 53.4/100: 53% rage enrage, juggernaut(7)
4:23.557 execute Fluffy_Pillow 38.3/100: 38% rage massacre, enrage, juggernaut(8)
4:24.734 rampage Fluffy_Pillow 23.2/100: 23% rage massacre, enrage, juggernaut(9)
4:26.240 dragon_roar Fluffy_Pillow 33.1/100: 33% rage enrage, juggernaut(9)
4:27.417 execute Fluffy_Pillow 43.0/100: 43% rage dragon_roar, enrage, juggernaut(9)
4:28.596 raging_blow Fluffy_Pillow 18.0/100: 18% rage massacre, dragon_roar, enrage, juggernaut(10), berserking_
4:29.771 rampage Fluffy_Pillow 32.9/100: 33% rage massacre, dragon_roar, enrage, juggernaut(10), berserking_(2)
4:31.274 battle_cry Fluffy_Pillow 42.8/100: 43% rage dragon_roar, enrage, juggernaut(10), berserking_(3)
4:31.435 use_item_draught_of_souls Fluffy_Pillow 42.8/100: 43% rage dragon_roar, enrage, juggernaut(10), battle_cry, berserking_(4)
4:31.435 potion Fluffy_Pillow 42.8/100: 43% rage dragon_roar, enrage, juggernaut(10), battle_cry, berserking_(4)
4:31.435 avatar Fluffy_Pillow 42.8/100: 43% rage dragon_roar, enrage, juggernaut(10), battle_cry, berserking_(4), potion_of_the_old_war
4:31.435 execute Fluffy_Pillow 42.8/100: 43% rage avatar, dragon_roar, enrage, juggernaut(10), battle_cry, berserking_(4), potion_of_the_old_war
4:32.611 odyns_fury Fluffy_Pillow 27.7/100: 28% rage massacre, avatar, enrage, juggernaut(11), battle_cry, berserking_(5), potion_of_the_old_war
4:33.787 execute Fluffy_Pillow 37.6/100: 38% rage massacre, avatar, enrage, juggernaut(11), battle_cry, berserking_(6), potion_of_the_old_war
4:34.964 heroic_leap Fluffy_Pillow 22.5/100: 22% rage massacre, avatar, enrage, juggernaut(12), battle_cry, berserking_(7), potion_of_the_old_war
4:34.964 rampage Fluffy_Pillow 22.5/100: 22% rage massacre, avatar, enrage, juggernaut(12), battle_cry, berserking_(7), potion_of_the_old_war
4:36.469 execute Fluffy_Pillow 42.3/100: 42% rage avatar, enrage, juggernaut(12), berserking_(9), potion_of_the_old_war
4:37.646 execute Fluffy_Pillow 27.2/100: 27% rage massacre, avatar, enrage, sense_death, juggernaut(13), berserking_(10), potion_of_the_old_war
4:38.822 execute Fluffy_Pillow 37.1/100: 37% rage massacre, avatar, enrage, sense_death, juggernaut(14), berserking_(11), potion_of_the_old_war
4:39.998 rampage Fluffy_Pillow 47.0/100: 47% rage massacre, avatar, enrage, sense_death, juggernaut(15), berserking_(12), potion_of_the_old_war
4:41.505 execute Fluffy_Pillow 56.9/100: 57% rage avatar, enrage, sense_death, juggernaut(15), odyns_champion, berserking_(12), potion_of_the_old_war
4:42.681 execute Fluffy_Pillow 66.8/100: 67% rage massacre, avatar, enrage, juggernaut(16), odyns_champion, potion_of_the_old_war
4:43.858 execute Fluffy_Pillow 51.7/100: 52% rage massacre, avatar, enrage, juggernaut(17), odyns_champion, potion_of_the_old_war
4:45.035 rampage Fluffy_Pillow 36.6/100: 37% rage massacre, avatar, enrage, juggernaut(18), odyns_champion, potion_of_the_old_war
4:46.540 execute Fluffy_Pillow 46.5/100: 46% rage avatar, enrage, juggernaut(18), odyns_champion, stone_heart, potion_of_the_old_war
4:47.718 dragon_roar Fluffy_Pillow 56.4/100: 56% rage avatar, enrage, juggernaut(19), berserking_, potion_of_the_old_war
4:48.896 execute Fluffy_Pillow 66.3/100: 66% rage avatar, dragon_roar, enrage, juggernaut(19), berserking_(2), potion_of_the_old_war
4:50.073 rampage Fluffy_Pillow 51.2/100: 51% rage massacre, avatar, dragon_roar, enrage, juggernaut(20), berserking_(3), potion_of_the_old_war
4:51.577 execute Fluffy_Pillow 61.1/100: 61% rage dragon_roar, enrage, juggernaut(20), odyns_champion, berserking_(5), potion_of_the_old_war
4:52.755 execute Fluffy_Pillow 46.0/100: 46% rage massacre, dragon_roar, enrage, juggernaut(21), odyns_champion, berserking_(6), potion_of_the_old_war
4:53.932 execute Fluffy_Pillow 30.9/100: 31% rage massacre, enrage, juggernaut(22), odyns_champion, berserking_(7), potion_of_the_old_war
4:55.109 rampage Fluffy_Pillow 15.8/100: 16% rage massacre, enrage, juggernaut(23), odyns_champion, berserking_(8), potion_of_the_old_war
4:56.615 heroic_leap Fluffy_Pillow 25.7/100: 26% rage enrage, juggernaut(23), odyns_champion, berserking_(10)
4:56.615 execute Fluffy_Pillow 25.7/100: 26% rage enrage, juggernaut(23), odyns_champion, berserking_(10)
4:57.789 raging_blow Fluffy_Pillow 10.6/100: 11% rage massacre, enrage, juggernaut(24), berserking_(11)
4:58.965 execute Fluffy_Pillow 25.5/100: 25% rage massacre, enrage, juggernaut(24), berserking_(12)
5:00.141 rampage Fluffy_Pillow 20.3/100: 20% rage massacre, enrage, sense_death, juggernaut(25), berserking_(12)
5:01.645 execute Fluffy_Pillow 30.2/100: 30% rage enrage, sense_death, juggernaut(25)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 30956 29250 17625 (4389)
Agility 6579 6254 0
Stamina 51209 51209 27995
Intellect 5321 4996 0
Spirit 1 1 0
Health 3072540 3072540 0
Rage 100 100 0
Crit 24.43% 24.43% 6802
Haste 27.98% 27.98% 9093
Damage / Heal Versatility 1.39% 1.39% 558
Attack Power 30956 29250 0
Mastery 30.35% 28.85% 4414
Armor 4262 4262 4262
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 879.00
Local Head Warhelm of the Obsidian Aspect
ilevel: 870, stats: { 580 Armor, +1563 Str, +2345 Sta, +763 Crit, +643 Haste }
Local Neck Radiant String of Scorpid Eyes
ilevel: 870, stats: { +1319 Sta, +1074 Haste, +905 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Shoulderplates of the Obsidian Aspect
ilevel: 870, stats: { 535 Armor, +1172 Str, +1758 Sta, +731 Haste, +324 Crit }
Local Chest Chestplate of the Obsidian Aspect
ilevel: 870, stats: { 713 Armor, +1563 Str, +2345 Sta, +945 Haste, +462 Crit }
Local Waist Waistplate of Nameless Horror
ilevel: 880, stats: { 410 Armor, +1930 Sta, +1287 StrInt, +665 Haste, +430 Crit }
Local Legs Legplates of the Obsidian Aspect
ilevel: 870, stats: { 624 Armor, +1563 Str, +2345 Sta, +885 Crit, +523 Haste }
Local Feet Immaculately Polished Boots
ilevel: 870, stats: { 490 Armor, +1758 Sta, +1172 StrInt, +731 Haste, +324 Mastery }
Local Wrists Dragonbone Wristclamps
ilevel: 880, stats: { 319 Armor, +1447 Sta, +965 StrInt, +551 Mastery, +270 Haste }
Local Hands Gauntlets of the Obsidian Aspect
ilevel: 870, stats: { 446 Armor, +1172 Str, +1758 Sta, +731 Haste, +324 Vers }
Local Finger1 Ring of Braided Stems
ilevel: 870, stats: { +1319 Sta, +1188 Haste, +791 Mastery }, enchant: { +200 Mastery }
Local Finger2 Ayala's Stone Heart
ilevel: 895, stats: { +1665 Sta, +1397 Crit, +776 Mastery }, enchant: { +200 Mastery }
Local Trinket1 Ursoc's Rending Paw
ilevel: 880, stats: { +1631 Str }
Local Trinket2 Draught of Souls
ilevel: 870, stats: { +1005 Haste }
Local Back Astromancer's Greatcloak
ilevel: 880, stats: { 145 Armor, +965 StrAgiInt, +1448 Sta, +587 Haste, +234 Vers }, enchant: { +200 Str }
Local Main Hand Warswords of the Valarjar
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }, relics: { +52 ilevels, +52 ilevels, +52 ilevels }
Local Off Hand Warswords of the Valarjar
ilevel: 906, weapon: { 11308 - 16964, 3.6 }, stats: { +2186 Str, +3279 Sta, +818 Crit, +786 Mastery }

Talents

Level
15 War Machine (Fury Warrior) Endless Rage (Fury Warrior) Fresh Meat (Fury Warrior)
30 Shockwave (Fury Warrior) Storm Bolt (Fury Warrior) Double Time
45 Wrecking Ball (Fury Warrior) Outburst Avatar
60 Furious Charge (Fury Warrior) Bounding Stride Warpaint (Fury Warrior)
75 Massacre (Fury Warrior) Frothing Berserker (Fury Warrior) Carnage (Fury Warrior)
90 Bloodbath (Fury Warrior) Frenzy (Fury Warrior) Inner Rage (Fury Warrior)
100 Bladestorm (Fury Warrior) Reckless Abandon (Fury Warrior) Dragon Roar (Fury Warrior)

Profile

warrior="Warrior_Fury_T19M"
level=110
race=troll
role=attack
position=back
talents=2232133
artifact=35:139256:139262:139255:0:980:1:981:1:982:1:984:1:985:1:986:1:987:1:988:4:989:4:990:4:991:3:992:3:993:3:994:3:995:3:996:3:1357:1
spec=fury

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/charge
actions+=/run_action_list,name=movement,if=movement.distance>5
actions+=/heroic_leap,if=(raid_event.movement.distance>25&raid_event.movement.in>45)|!raid_event.movement.exists
actions+=/use_item,name=draught_of_souls,if=(spell_targets.whirlwind>1|!raid_event.adds.exists)&((talent.bladestorm.enabled&cooldown.bladestorm.remains=0)|buff.battle_cry.up|target.time_to_die<25)
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<30
actions+=/battle_cry,if=(cooldown.odyns_fury.remains=0&(cooldown.bloodthirst.remains=0|(buff.enrage.remains>cooldown.bloodthirst.remains)))
actions+=/avatar,if=buff.battle_cry.up|(target.time_to_die<(cooldown.battle_cry.remains+10))
actions+=/bloodbath,if=buff.dragon_roar.up|(!talent.dragon_roar.enabled&(buff.battle_cry.up|cooldown.battle_cry.remains>10))
actions+=/blood_fury,if=buff.battle_cry.up
actions+=/berserking,if=buff.battle_cry.up
actions+=/arcane_torrent,if=rage<rage.max-40
actions+=/call_action_list,name=two_targets,if=spell_targets.whirlwind=2|spell_targets.whirlwind=3
actions+=/call_action_list,name=aoe,if=spell_targets.whirlwind>3
actions+=/call_action_list,name=single_target

actions.aoe=bloodthirst,if=buff.enrage.down|rage<50
actions.aoe+=/call_action_list,name=bladestorm
actions.aoe+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.aoe+=/whirlwind,if=buff.enrage.up
actions.aoe+=/dragon_roar
actions.aoe+=/rampage,if=buff.meat_cleaver.up
actions.aoe+=/bloodthirst
actions.aoe+=/whirlwind

actions.bladestorm=bladestorm,if=buff.enrage.remains>2&(raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets)

actions.movement=heroic_leap

actions.single_target=bloodthirst,if=buff.fujiedas_fury.up&buff.fujiedas_fury.remains<2
actions.single_target+=/execute,if=(artifact.juggernaut.enabled&(!buff.juggernaut.up|buff.juggernaut.remains<2))|buff.stone_heart.react
actions.single_target+=/rampage,if=rage=100&(target.health.pct>20|target.health.pct<20&!talent.massacre.enabled)|buff.massacre.react&buff.enrage.remains<1
actions.single_target+=/berserker_rage,if=talent.outburst.enabled&cooldown.odyns_fury.remains=0&buff.enrage.down
actions.single_target+=/dragon_roar,if=cooldown.odyns_fury.remains>=10|cooldown.odyns_fury.remains<=3
actions.single_target+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.single_target+=/rampage,if=buff.enrage.down&buff.juggernaut.down
actions.single_target+=/furious_slash,if=talent.frenzy.enabled&(buff.frenzy.down|buff.frenzy.remains<=3)
actions.single_target+=/raging_blow,if=buff.juggernaut.down&buff.enrage.up
actions.single_target+=/whirlwind,if=buff.wrecking_ball.react&buff.enrage.up
actions.single_target+=/execute,if=talent.inner_rage.enabled|!talent.inner_rage.enabled&rage>50
actions.single_target+=/bloodthirst,if=buff.enrage.down
actions.single_target+=/raging_blow,if=buff.enrage.down
actions.single_target+=/execute,if=artifact.juggernaut.enabled
actions.single_target+=/raging_blow
actions.single_target+=/bloodthirst
actions.single_target+=/furious_slash
actions.single_target+=/call_action_list,name=bladestorm
actions.single_target+=/bloodbath,if=buff.frothing_berserker.up|(rage>80&!talent.frothing_berserker.enabled)

actions.two_targets=whirlwind,if=buff.meat_cleaver.down
actions.two_targets+=/call_action_list,name=bladestorm
actions.two_targets+=/rampage,if=buff.enrage.down|(rage=100&buff.juggernaut.down)|buff.massacre.up
actions.two_targets+=/bloodthirst,if=buff.enrage.down
actions.two_targets+=/odyns_fury,if=buff.battle_cry.up&buff.enrage.up
actions.two_targets+=/raging_blow,if=talent.inner_rage.enabled&spell_targets.whirlwind=2
actions.two_targets+=/whirlwind,if=spell_targets.whirlwind>2
actions.two_targets+=/dragon_roar
actions.two_targets+=/bloodthirst
actions.two_targets+=/whirlwind

head=warhelm_of_the_obsidian_aspect,id=138357,bonus_id=3443
neck=radiant_string_of_scorpid_eyes,id=140898,bonus_id=3443,enchant=mark_of_the_hidden_satyr
shoulders=shoulderplates_of_the_obsidian_aspect,id=138363,bonus_id=3443
back=astromancers_greatcloak,id=140909,bonus_id=1806,enchant=binding_of_strength
chest=chestplate_of_the_obsidian_aspect,id=138351,bonus_id=3443
wrists=dragonbone_wristclamps,id=138218,bonus_id=1806
hands=gauntlets_of_the_obsidian_aspect,id=138354,bonus_id=3443
waist=waistplate_of_nameless_horror,id=139227,bonus_id=1806
legs=legplates_of_the_obsidian_aspect,id=138360,bonus_id=3443
feet=immaculately_polished_boots,id=140904,bonus_id=3443
finger1=ring_of_braided_stems,id=140896,bonus_id=3443,enchant=binding_of_mastery
finger2=ayalas_stone_heart,id=137052,bonus_id=1811,enchant=binding_of_mastery
trinket1=ursocs_rending_paw,id=139328,bonus_id=1806
trinket2=draught_of_souls,id=140808,bonus_id=3443
main_hand=warswords_of_the_valarjar,id=128908,bonus_id=751,gem_id=139256/139262/139255,relic_id=1806/1806/1806
off_hand=warswords_of_the_valarjar,id=134553

# Gear Summary
# gear_ilvl=878.56
# gear_strength=17625
# gear_stamina=27995
# gear_crit_rating=6802
# gear_haste_rating=9093
# gear_mastery_rating=4414
# gear_versatility_rating=558
# gear_armor=4262
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

Simulation & Raid Information

Iterations: 7501
Threads: 2
Confidence: 95.00%
Fight Length: 227 - 378 ( 300.6 )

Performance:
Total Events Processed: 505290843
Max Event Queue: 511
Sim Seconds: 2255133
CPU Seconds: 1036.7400
Physical Seconds: 522.5914
Speed Up: 2175

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Hunter_BM_T19M Hunter_BM_T19M a_murder_of_crows 131894 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.33sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M crow_peck 131900 8181273 27212 17.07 74278 151398 0.0 85.6 27.7% 0.0% 0.0% 0.0% 0.00sec 12027247 300.64sec
Hunter_BM_T19M Hunter_BM_T19M aspect_of_the_wild 193530 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 127.40sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M auto_shot 0 5069435 16862 24.51 29929 62392 122.8 122.8 35.0% 0.0% 0.0% 0.0% 2.46sec 7452549 300.64sec
Hunter_BM_T19M Hunter_BM_T19M bestial_wrath 19574 0 0 0.00 0 0 8.9 0.0 0.0% 0.0% 0.0% 0.0% 35.37sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M cobra_shot 193455 11514755 38300 13.97 117246 241841 70.2 70.0 37.9% 0.0% 0.0% 0.0% 4.25sec 16927780 300.64sec
Hunter_BM_T19M Hunter_BM_T19M deadly_grace 188091 3653599 12153 5.69 99498 202995 28.5 28.5 27.7% 0.0% 0.0% 0.0% 3.23sec 3653599 300.64sec
Hunter_BM_T19M Hunter_BM_T19M dire_beast 120679 0 0 0.00 0 0 34.2 0.0 0.0% 0.0% 0.0% 0.0% 8.87sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast dire_beast_melee 0 7437562 32259 47.73 32044 64093 183.4 183.4 26.5% 0.0% 0.0% 0.0% 1.64sec 10933921 230.56sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast stomp 201754 7274451 31551 8.91 168162 336547 34.2 34.2 26.3% 0.0% 0.0% 0.0% 8.87sec 10694133 230.56sec
Hunter_BM_T19M Hunter_BM_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M kill_command 34026 0 0 0.00 0 0 73.3 0.0 0.0% 0.0% 0.0% 0.0% 4.10sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_cat kill_command 83381 26877978 89401 14.63 260492 530424 73.3 73.3 39.3% 0.0% 0.0% 0.0% 4.10sec 39513173 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_cat jaws_of_thunder 197162 5382530 17903 5.86 183464 0 29.3 29.3 0.0% 0.0% 0.0% 0.0% 10.11sec 5382530 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_hati kill_command 83381 8178127 27202 14.63 87201 176217 73.3 73.3 27.3% 0.0% 0.0% 0.0% 4.10sec 12022621 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_hati jaws_of_thunder 197162 1632466 5430 5.85 55724 0 29.3 29.3 0.0% 0.0% 0.0% 0.0% 10.11sec 1632466 300.64sec
Hunter_BM_T19M Hunter_BM_T19M pepper_breath ticks -225622 1173817 3913 13.93 16974 0 14.0 69.6 0.0% 0.0% 0.0% 0.0% 21.17sec 1173817 300.64sec
Hunter_BM_T19M Hunter_BM_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M titans_thunder 207068 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 61.04sec 0 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_cat titans_thunder ticks -207068 1683048 5610 8.50 30795 62525 5.4 42.5 27.8% 0.0% 0.0% 0.0% 61.04sec 1683048 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 2134008 7113 8.10 41246 82396 5.1 40.5 27.8% 0.0% 0.0% 0.0% 63.92sec 2134008 230.56sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 197146 657 0.76 41326 82602 0.5 3.8 26.3% 0.0% 0.0% 0.0% 110.30sec 197146 47.51sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 21790 73 0.08 41214 82361 0.1 0.4 26.6% 0.0% 0.0% 0.0% 0.00sec 21790 10.67sec
Hunter_BM_T19M Hunter_BM_T19M_dire_beast titans_thunder ticks -207068 3003 10 0.01 41891 80512 0.0 0.1 25.0% 0.0% 0.0% 0.0% 0.00sec 3003 8.19sec
Hunter_BM_T19M Hunter_BM_T19M_hati titans_thunder ticks -207068 2145545 7152 8.50 39349 79892 5.4 42.5 27.5% 0.0% 0.0% 0.0% 61.04sec 2145545 300.64sec
Hunter_BM_T19M Hunter_BM_T19M tormenting_cyclone 221857 1689876 5621 14.29 18552 37544 10.4 71.6 26.6% 0.0% 0.0% 0.0% 27.74sec 1689876 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_cat claw 16827 6394214 21268 20.10 45572 93522 100.7 100.7 37.4% 0.0% 0.0% 0.0% 3.00sec 9400101 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_cat melee 0 6397193 21278 40.15 22850 46602 201.2 201.2 37.7% 0.0% 0.0% 0.0% 1.49sec 9404480 300.64sec
Hunter_BM_T19M Hunter_BM_T19M_hati hati_melee 0 6821786 22691 36.69 29222 59131 182.9 183.9 26.3% 0.0% 0.0% 0.0% 1.64sec 10028671 300.64sec
Hunter_MM_T19M Hunter_MM_T19M aimed_shot 19434 44548870 148178 18.27 325693 775662 91.7 91.6 35.8% 0.0% 0.0% 0.0% 3.26sec 65491058 300.64sec
Hunter_MM_T19M Hunter_MM_T19M legacy_of_the_windrunners 19434 7643651 25424 16.38 62302 149057 0.0 82.1 35.6% 0.0% 0.0% 0.0% 0.00sec 11236891 300.64sec
Hunter_MM_T19M Hunter_MM_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_MM_T19M Hunter_MM_T19M auto_shot 0 4829215 16063 23.82 29694 65695 119.4 119.4 29.9% 0.0% 0.0% 0.0% 2.52sec 7099404 300.64sec
Hunter_MM_T19M Hunter_MM_T19M barrage ticks -120360 12831507 42772 43.65 44086 93380 13.7 218.2 29.8% 0.0% 0.0% 0.0% 22.85sec 18863531 300.64sec
Hunter_MM_T19M Hunter_MM_T19M deadly_grace 188091 4320339 14370 6.76 79173 204942 33.9 33.9 38.4% 0.0% 0.0% 0.0% 8.96sec 4320339 300.64sec
Hunter_MM_T19M Hunter_MM_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_MM_T19M Hunter_MM_T19M marked_shot 185901 16338907 54346 5.78 375348 844111 29.0 29.0 40.2% 0.0% 0.0% 0.0% 10.42sec 24019741 300.64sec
Hunter_MM_T19M Hunter_MM_T19M call_of_the_hunter 191070 1198193 3985 2.41 70835 163027 12.1 12.1 30.8% 0.0% 0.0% 0.0% 46.78sec 1761457 300.64sec
Hunter_MM_T19M Hunter_MM_T19M pepper_breath ticks -225622 1223503 4078 14.52 16973 0 14.6 72.6 0.0% 0.0% 0.0% 0.0% 20.24sec 1223503 300.64sec
Hunter_MM_T19M Hunter_MM_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_MM_T19M Hunter_MM_T19M sidewinders 214579 5187712 17255 6.60 114546 255814 33.1 33.1 29.9% 0.0% 0.0% 0.0% 9.14sec 5187712 300.64sec
Hunter_MM_T19M Hunter_MM_T19M tormenting_cyclone 221857 1565741 5208 14.97 15351 33693 10.9 75.0 30.1% 0.0% 0.0% 0.0% 26.71sec 1565741 300.64sec
Hunter_MM_T19M Hunter_MM_T19M trueshot 193526 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 157.41sec 0 300.64sec
Hunter_MM_T19M Hunter_MM_T19M windburst 204147 8319822 27673 2.83 440680 933322 13.2 14.2 29.5% 0.0% 0.0% 0.0% 21.88sec 12230926 300.64sec
Hunter_SV_T19M Hunter_SV_T19M aspect_of_the_eagle 186289 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 49.06sec 0 300.64sec
Hunter_SV_T19M Hunter_SV_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_SV_T19M Hunter_SV_T19M auto_attack_mh 0 5675265 18877 20.81 37484 74984 104.3 104.3 45.2% 0.0% 0.0% 0.0% 2.88sec 8343177 300.64sec
Hunter_SV_T19M Hunter_SV_T19M talon_strike 203525 1524805 5072 4.15 50469 100907 20.8 20.8 45.3% 0.0% 0.0% 0.0% 26.45sec 2241608 300.64sec
Hunter_SV_T19M Hunter_SV_T19M cleansed_drakes_breath 222520 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 61.89sec 0 300.64sec
Hunter_SV_T19M Hunter_SV_T19M dragonsfire_grenade 194855 1028181 3420 2.04 100433 0 10.3 10.2 0.0% 0.0% 0.0% 0.0% 30.56sec 5986615 300.64sec
Hunter_SV_T19M Hunter_SV_T19M dragonsfire_grenade ticks -194855 4958435 16528 16.15 42255 84560 10.3 80.8 45.3% 0.0% 0.0% 0.0% 30.56sec 5986615 300.64sec
Hunter_SV_T19M Hunter_SV_T19M explosive_trap 13812 8030691 26712 4.95 223191 446222 24.8 24.8 45.2% 0.0% 0.0% 0.0% 12.37sec 16238482 300.64sec
Hunter_SV_T19M Hunter_SV_T19M explosive_trap ticks -13812 8207791 27359 48.66 23225 46451 24.8 243.3 45.3% 0.0% 0.0% 0.0% 12.37sec 16238482 300.64sec
Hunter_SV_T19M Hunter_SV_T19M flanking_strike 202800 7865121 26161 5.91 167907 335925 29.6 29.6 58.3% 0.0% 0.0% 0.0% 9.78sec 11562473 300.64sec
Hunter_SV_T19M Hunter_SV_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_SV_T19M Hunter_SV_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_SV_T19M Hunter_SV_T19M fury_of_the_eagle ticks -203415 8922128 29740 11.77 104291 208479 6.6 58.8 45.4% 0.0% 0.0% 0.0% 47.89sec 13116373 300.64sec
Hunter_SV_T19M Hunter_SV_T19M harpoon 190925 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_SV_T19M Hunter_SV_T19M lacerate 185855 1625349 5406 5.03 44345 88755 25.2 25.2 45.2% 0.0% 0.0% 0.0% 11.86sec 14103020 300.64sec
Hunter_SV_T19M Hunter_SV_T19M lacerate ticks -185855 11713603 39045 57.60 27993 55984 25.2 288.0 45.3% 0.0% 0.0% 0.0% 11.86sec 14103020 300.64sec
Hunter_SV_T19M Hunter_SV_T19M mongoose_bite 190928 13804630 45917 8.97 210893 423165 44.9 44.9 45.4% 0.0% 0.0% 0.0% 6.61sec 20294113 300.64sec
Hunter_SV_T19M Hunter_SV_T19M on_the_trail ticks -204081 2452940 8176 60.03 8172 0 0.0 300.1 0.0% 0.0% 0.0% 0.0% 0.00sec 2452940 300.64sec
Hunter_SV_T19M Hunter_SV_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_SV_T19M Hunter_SV_T19M potion_of_the_old_war 188028 4778877 15895 4.66 140905 282060 23.4 23.4 45.1% 0.0% 0.0% 0.0% 3.79sec 7025402 300.64sec
Hunter_SV_T19M Hunter_SV_T19M raptor_strike 186270 8563693 28484 9.83 119621 239244 49.3 49.3 45.3% 0.0% 0.0% 0.0% 6.12sec 12589440 300.64sec
Hunter_SV_T19M Hunter_SV_T19M snake_hunter 201078 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 95.59sec 0 300.64sec
Hunter_SV_T19M Hunter_SV_T19M summon_pet 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Hunter_SV_T19M Hunter_SV_T19M_cat claw 16827 3488095 11602 20.10 22325 44627 100.7 100.7 55.2% 0.0% 0.0% 0.0% 3.00sec 5127830 300.64sec
Hunter_SV_T19M Hunter_SV_T19M_cat flanking_strike 204740 3540742 11777 5.91 71103 142210 29.6 29.6 68.3% 0.0% 0.0% 0.0% 9.78sec 5205227 300.64sec
Hunter_SV_T19M Hunter_SV_T19M_cat melee 0 4165168 13854 47.33 11306 22611 237.1 237.1 55.4% 0.0% 0.0% 0.0% 1.26sec 6123191 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M aegwynns_ascendance 187677 1145688 3811 0.66 345043 0 3.3 3.3 0.0% 0.0% 0.0% 0.0% 98.54sec 1145688 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_barrage 44425 3262992 10853 1.94 262351 525301 9.8 9.7 27.7% 0.0% 0.0% 0.0% 27.16sec 3262992 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_blast 30451 46492169 154642 19.44 374075 750611 96.4 97.4 27.4% 0.0% 0.0% 0.0% 3.11sec 46492169 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_explosion 1449 668155 2222 0.51 205332 409031 2.6 2.6 27.5% 0.0% 0.0% 0.0% 68.13sec 668155 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_missiles ticks -5143 36329835 121099 55.09 103800 207614 46.0 275.4 27.4% 0.0% 0.0% 0.0% 6.32sec 36329835 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.16sec 0 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.27sec 0 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M deadly_grace 188091 6363129 21165 7.86 126715 253644 39.4 39.4 27.5% 0.0% 0.0% 0.0% 5.94sec 6363129 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M evocation 12051 0 0 0.00 0 0 3.3 0.0 0.0% 0.0% 0.0% 0.0% 98.10sec 0 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M mark_of_aluneth ticks -224968 2939142 9797 6.20 74453 148771 5.2 31.0 27.4% 0.0% 0.0% 0.0% 62.26sec 2939142 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M mark_of_aluneth_explosion 210726 2714858 9030 1.04 407246 818892 5.2 5.2 27.4% 0.0% 0.0% 0.0% 62.19sec 2714858 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M mark_of_the_hidden_satyr 191259 3135969 10431 4.23 116090 231436 21.2 21.2 27.5% 0.0% 0.0% 0.0% 14.06sec 3135969 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M nether_tempest ticks -114923 6387047 21290 84.38 11874 23751 25.8 421.9 27.5% 0.0% 0.0% 0.0% 11.62sec 6387047 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M nether_tempest_aoe ticks -114954 6389038 21297 0.00 11939 23870 421.9 0.0 27.4% 0.0% 0.0% 0.0% 0.70sec 6389038 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M plague_swarm ticks -221812 5084220 16947 14.39 55414 110853 16.9 72.0 27.5% 0.0% 0.0% 0.0% 17.60sec 5084220 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M rune_of_power 116011 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 35.31sec 0 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M summon_arcane_familiar 205022 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M supernova 157980 2293194 7628 1.88 190591 381492 9.4 9.4 27.4% 0.0% 0.0% 0.0% 31.06sec 2293194 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M tormenting_cyclone 221857 2207786 7344 17.33 19971 39915 12.6 86.8 27.4% 0.0% 0.0% 0.0% 23.06sec 2207786 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M touch_of_the_magi 210833 3660913 12177 1.66 440520 0 8.3 8.3 0.0% 0.0% 0.0% 0.0% 33.93sec 3660913 300.64sec
Mage_Arcane_T19M Mage_Arcane_T19M_arcane_familiar arcane_assault 205235 3172697 10553 29.46 16868 33750 148.2 147.6 27.4% 0.0% 0.0% 0.0% 2.04sec 3172697 300.64sec
Mage_Fire_T19M Mage_Fire_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Fire_T19M Mage_Fire_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 238.34sec 0 300.64sec
Mage_Fire_T19M Mage_Fire_T19M blast_furance ticks -194522 1375905 4586 44.50 3040 7888 36.4 222.5 64.9% 0.0% 0.0% 0.0% 8.33sec 1375905 300.64sec
Mage_Fire_T19M Mage_Fire_T19M combustion 190319 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 79.55sec 0 300.64sec
Mage_Fire_T19M Mage_Fire_T19M deadly_grace 188091 5518794 18357 4.90 94632 262774 24.6 24.6 77.4% 0.0% 0.0% 0.0% 4.62sec 5518794 300.64sec
Mage_Fire_T19M Mage_Fire_T19M fire_blast 108853 7925580 26362 7.25 0 218024 36.4 36.4 100.0% 0.0% 0.0% 0.0% 8.33sec 7925580 300.64sec
Mage_Fire_T19M Mage_Fire_T19M fireball 133 10965051 36472 15.09 79214 175903 75.7 75.6 68.1% 0.0% 0.0% 0.0% 3.68sec 10965051 300.64sec
Mage_Fire_T19M Mage_Fire_T19M flame_on 205029 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 76.48sec 0 300.64sec
Mage_Fire_T19M Mage_Fire_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Fire_T19M Mage_Fire_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Fire_T19M Mage_Fire_T19M ignite ticks -12846 26401900 88006 59.87 88190 0 224.1 299.4 0.0% 0.0% 0.0% 0.0% 1.35sec 26401900 300.64sec
Mage_Fire_T19M Mage_Fire_T19M maddening_whispers 222050 6268146 20849 0.46 730373 2738528 2.3 2.3 100.0% 0.0% 0.0% 0.0% 160.10sec 6268146 300.64sec
Mage_Fire_T19M Mage_Fire_T19M mark_of_the_hidden_satyr 191259 3360896 11179 3.39 98058 251482 17.0 17.0 64.9% 0.0% 0.0% 0.0% 17.56sec 3360896 300.64sec
Mage_Fire_T19M Mage_Fire_T19M phoenix_reborn 215773 1073298 3570 4.97 21640 55053 24.9 24.9 64.2% 0.0% 0.0% 0.0% 11.70sec 1073298 300.64sec
Mage_Fire_T19M Mage_Fire_T19M phoenixs_flames 194466 5894471 19606 2.70 0 435308 13.6 13.5 100.0% 0.0% 0.0% 0.0% 22.92sec 5894471 300.64sec
Mage_Fire_T19M Mage_Fire_T19M phoenixs_flames_splash 224637 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 22.95sec 0 300.64sec
Mage_Fire_T19M Mage_Fire_T19M plague_swarm ticks -221812 5829531 19432 12.25 48424 120833 13.5 61.3 64.6% 0.0% 0.0% 0.0% 21.75sec 5829531 300.64sec
Mage_Fire_T19M Mage_Fire_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Fire_T19M Mage_Fire_T19M pyroblast 11366 52171289 173532 19.55 272964 621622 97.2 97.9 74.5% 0.0% 0.0% 0.0% 3.08sec 52171289 300.64sec
Mage_Fire_T19M Mage_Fire_T19M rune_of_power 116011 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 37.78sec 0 300.64sec
Mage_Fire_T19M Mage_Fire_T19M scorch 2948 53916 179 0.14 0 76779 0.7 0.7 100.0% 0.0% 0.0% 0.0% 145.80sec 53916 300.64sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_arcane_blast 0 334945 1114 0.09 671842 1405401 0.4 0.4 10.2% 0.0% 0.0% 0.0% 318.49sec 334945 300.64sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_fireball 0 196136 652 0.09 383869 807357 0.5 0.5 9.7% 0.0% 0.0% 0.0% 318.84sec 400060 300.64sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_fireball ticks 0 203924 680 0.75 54549 0 0.5 3.7 0.0% 0.0% 0.0% 0.0% 318.84sec 400060 300.64sec
Mage_Fire_T19M Mage_Fire_T19M sorcerous_frostbolt 0 317444 1056 0.09 633451 1342125 0.5 0.5 9.4% 0.0% 0.0% 0.0% 318.62sec 317444 300.64sec
Mage_Fire_T19M Mage_Fire_T19M unstable_magic_explosion 157976 1372333 4565 3.78 72531 0 18.9 18.9 0.0% 0.0% 0.0% 0.0% 14.21sec 1372333 300.64sec
Mage_Fire_T19M Mage_Fire_T19M wanton_sorcery 222276 0 0 0.00 0 0 1.4 0.0 0.0% 0.0% 0.0% 0.0% 318.47sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.59sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M blizzard ticks -190356 2468666 8229 13.26 25391 50450 8.4 66.3 47.3% 0.0% 0.0% 0.0% 11.68sec 2468666 300.64sec
Mage_Frost_T19M Mage_Frost_T19M comet_storm 153595 0 0 0.00 0 0 9.1 0.0 0.0% 0.0% 0.0% 0.0% 32.93sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M comet_storm_projectile 153596 4046223 13459 12.64 48606 97182 63.6 63.4 31.4% 0.0% 0.0% 0.0% 4.28sec 4046223 300.64sec
Mage_Frost_T19M Mage_Frost_T19M deadly_grace 188091 6207159 20646 8.09 116548 232973 40.5 40.5 31.4% 0.0% 0.0% 0.0% 2.17sec 6207159 300.64sec
Mage_Frost_T19M Mage_Frost_T19M ebonbolt 214634 3126687 10400 1.17 405182 810547 5.9 5.9 31.2% 0.0% 0.0% 0.0% 52.09sec 3126687 300.64sec
Mage_Frost_T19M Mage_Frost_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M flurry 44614 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 23.79sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M flurry_bolt 228354 6357854 21147 6.76 110363 220805 33.9 33.9 70.0% 0.0% 0.0% 0.0% 7.46sec 6357854 300.64sec
Mage_Frost_T19M Mage_Frost_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M frost_bomb 112948 0 0 0.00 0 0 16.6 0.0 0.0% 0.0% 0.0% 0.0% 17.69sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M frost_bomb_explosion 113092 6396589 21276 13.18 71413 140720 66.0 66.0 36.7% 0.0% 0.0% 0.0% 4.29sec 6396589 300.64sec
Mage_Frost_T19M Mage_Frost_T19M frostbolt 116 11484112 38198 15.12 98699 195864 75.1 75.8 54.4% 0.0% 0.0% 0.0% 3.68sec 11484112 300.64sec
Mage_Frost_T19M Mage_Frost_T19M icicle 148022 5310698 17664 17.77 59658 0 89.5 89.0 0.0% 0.0% 0.0% 0.0% 3.21sec 5310698 300.64sec
Mage_Frost_T19M Mage_Frost_T19M frozen_orb 84714 0 0 0.00 0 0 5.1 0.0 0.0% 0.0% 0.0% 0.0% 61.66sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M frozen_orb_bolt ticks -84721 1617759 5393 0.00 12262 24511 0.0 0.0 31.6% 0.0% 0.0% 0.0% 0.00sec 1617759 300.64sec
Mage_Frost_T19M Mage_Frost_T19M ice_lance 30455 20706302 68873 13.94 100697 337092 70.1 69.9 82.8% 0.0% 0.0% 0.0% 4.07sec 20706302 300.64sec
Mage_Frost_T19M Mage_Frost_T19M ice_nova 157997 6091691 20262 2.07 431471 824118 10.4 10.4 39.8% 0.0% 0.0% 0.0% 28.93sec 6091691 300.64sec
Mage_Frost_T19M Mage_Frost_T19M icy_veins 12472 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 149.86sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M maddening_whispers 222050 3586950 11931 0.57 955551 1890615 2.9 2.9 31.4% 0.0% 0.0% 0.0% 115.84sec 3586950 300.64sec
Mage_Frost_T19M Mage_Frost_T19M mark_of_the_hidden_satyr 191259 3170035 10544 4.27 112576 224887 21.4 21.4 31.6% 0.0% 0.0% 0.0% 14.15sec 3170035 300.64sec
Mage_Frost_T19M Mage_Frost_T19M plague_swarm ticks -221812 5335717 17786 15.16 53573 107039 17.2 75.8 31.5% 0.0% 0.0% 0.0% 17.44sec 5335717 300.64sec
Mage_Frost_T19M Mage_Frost_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M ray_of_frost ticks -205021 29922808 99743 17.33 262777 525171 4.5 86.6 31.5% 0.0% 0.0% 0.0% 72.62sec 29922808 300.64sec
Mage_Frost_T19M Mage_Frost_T19M rune_of_power 116011 0 0 0.00 0 0 8.9 0.0 0.0% 0.0% 0.0% 0.0% 36.88sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_arcane_blast 0 395975 1317 0.10 724455 1484624 0.5 0.5 9.3% 0.0% 0.0% 0.0% 302.75sec 395975 300.64sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_fireball 0 220372 733 0.10 414605 825050 0.5 0.5 11.5% 0.0% 0.0% 0.0% 302.80sec 589786 300.64sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_fireball ticks 0 369414 1231 1.17 63250 0 0.5 5.8 0.0% 0.0% 0.0% 0.0% 302.80sec 589786 300.64sec
Mage_Frost_T19M Mage_Frost_T19M sorcerous_frostbolt 0 369965 1231 0.10 687050 1359914 0.5 0.5 9.0% 0.0% 0.0% 0.0% 302.45sec 369965 300.64sec
Mage_Frost_T19M Mage_Frost_T19M time_warp 80353 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 261.97sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M wanton_sorcery 222276 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 302.79sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M water_elemental 31687 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Mage_Frost_T19M Mage_Frost_T19M_water_elemental water_jet ticks -135029 1440186 4801 7.23 30323 60618 9.1 36.2 31.4% 0.0% 0.0% 0.0% 31.75sec 1440186 300.64sec
Mage_Frost_T19M Mage_Frost_T19M_water_elemental waterbolt 31707 12493000 41554 32.78 57860 115671 165.2 164.2 31.5% 0.0% 0.0% 0.0% 1.81sec 12493000 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M arcane_torrent 155145 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.58sec 0 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M blade_of_justice 184575 11417684 37977 9.77 188408 376584 48.9 48.9 23.9% 0.0% 0.0% 0.0% 6.11sec 16785076 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M blessing_of_might_proc 205729 10455883 34778 32.47 64256 0 189.3 162.7 0.0% 0.0% 0.0% 0.0% 1.99sec 10455883 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M brutal_haymaker 214169 736506 2450 0.96 123357 246745 4.8 4.8 24.2% 0.0% 0.0% 0.0% 53.65sec 1082734 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M brutal_haymaker_vulnerability 228784 2623397 8726 10.22 51251 0 53.1 51.2 0.0% 0.0% 0.0% 0.0% 4.09sec 2623397 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M cleansed_drakes_breath 222520 0 0 0.00 0 0 3.1 0.0 0.0% 0.0% 0.0% 0.0% 63.20sec 0 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M crusade 231895 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.42sec 0 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M crusader_strike 35395 15137556 50350 21.20 92546 184965 106.2 106.2 54.1% 0.0% 0.0% 0.0% 2.81sec 22253641 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M echoed_verdict 224266 5816517 19347 17.70 52888 105717 88.7 88.7 24.0% 0.0% 0.0% 0.0% 3.38sec 5816517 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M greater_blessing_of_might 203528 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M judgment 20271 8875125 29520 6.88 207700 415541 34.5 34.5 24.0% 0.0% 0.0% 0.0% 8.82sec 8875125 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M judgment_aoe 228288 0 0 0.00 0 0 34.5 0.0 0.0% 0.0% 0.0% 0.0% 8.82sec 0 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M melee 0 5655367 18811 25.33 35926 71887 126.9 126.9 24.0% 0.0% 0.0% 0.0% 2.36sec 8313925 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M potion_of_the_old_war 188028 7515221 24997 7.34 164781 329173 36.8 36.8 24.1% 0.0% 0.0% 0.0% 4.04sec 11048087 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M shield_of_vengeance 184662 0 0 0.76 0 0 3.8 3.8 23.3% 0.0% 0.0% 0.0% 90.00sec 2613911 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M shield_of_vengeance_proc 184689 3527319 11733 0.72 788584 1567151 3.8 3.6 23.9% 0.0% 0.0% 0.0% 89.46sec 3527319 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M templars_verdict 85256 55069999 183173 17.71 500540 1001760 88.7 88.7 24.0% 0.0% 0.0% 0.0% 3.38sec 55069999 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M wake_of_ashes 205273 2440931 8119 1.95 201090 402798 9.8 9.8 24.1% 0.0% 0.0% 0.0% 32.47sec 4899087 300.64sec
Paladin_Retribution_T19M Paladin_Retribution_T19M wake_of_ashes ticks -205273 2458156 8194 11.60 34140 68302 9.8 58.0 24.1% 0.0% 0.0% 0.0% 32.47sec 4899087 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.92sec 0 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M deadly_grace 188091 4879184 16229 8.19 95418 190782 41.1 41.0 24.6% 0.0% 0.0% 0.0% 7.47sec 4879184 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M mental_fortitude 194018 0 0 35.39 0 0 177.3 177.3 24.8% 0.0% 0.0% 0.0% 1.68sec 13013879 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M mind_blast 8092 27605604 91821 22.22 198641 397206 110.3 111.3 24.8% 0.0% 0.0% 0.0% 2.71sec 27605604 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M mind_flay ticks -15407 10017909 33393 44.86 35786 71603 76.1 224.3 24.8% 0.0% 0.0% 0.0% 3.89sec 10017909 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M plague_swarm ticks -221812 5280792 17603 16.86 50237 100462 20.5 84.3 24.7% 0.0% 0.0% 0.0% 14.42sec 5280792 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M power_infusion 10060 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 126.19sec 0 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M shadow_word_death 32379 1572587 5231 1.05 240651 481214 5.2 5.2 24.7% 0.0% 0.0% 0.0% 10.69sec 1572587 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M shadow_word_pain 589 165292 550 0.71 36954 73693 3.6 3.6 25.2% 0.0% 0.0% 0.0% 106.91sec 16697203 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M shadow_word_pain ticks -589 16531911 55106 53.00 49985 99928 3.6 265.0 24.8% 0.0% 0.0% 0.0% 106.91sec 16697203 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M sphere_of_insanity 194182 1942441 6461 20.77 18666 0 188.7 104.1 0.0% 0.0% 0.0% 0.0% 1.53sec 0 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M shadowfiend 34433 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 198.60sec 0 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M shadowy_apparitions 78203 1671908 5561 16.82 15894 31792 85.5 84.3 24.8% 0.0% 0.0% 0.0% 3.47sec 1671908 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M tormenting_cyclone 221857 3000704 9981 21.10 22740 45483 15.4 105.7 24.8% 0.0% 0.0% 0.0% 19.06sec 3000704 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M vampiric_touch ticks -34914 20851539 69505 35.46 94318 188490 1.0 177.3 24.7% 0.0% 0.0% 0.0% 200.32sec 20851539 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M void_bolt 205448 19266294 64083 15.06 204575 408979 75.8 75.5 24.8% 0.0% 0.0% 0.0% 3.76sec 19266294 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M void_eruption 228360 1304496 4339 2.91 71693 143482 7.3 14.6 24.7% 0.0% 0.0% 0.0% 42.56sec 1304496 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M void_torrent ticks -205065 6462171 21541 8.04 128772 257416 5.1 40.2 24.9% 0.0% 0.0% 0.0% 62.67sec 6462171 300.64sec
Priest_Shadow_T19M Priest_Shadow_T19M_shadowfiend melee 0 2866559 128055 75.03 82074 164135 28.0 28.0 24.8% 0.0% 0.0% 0.0% 6.96sec 2866559 22.39sec
Priest_Shadow_T19M Priest_Shadow_T19M_shadowfiend shadowcrawl 63619 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 66.49sec 0 22.39sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 3184104 10614 13.03 39147 78294 7.4 65.2 24.8% 0.0% 0.0% 0.0% 38.29sec 3184104 72.40sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 786569 2622 3.22 39147 78294 1.8 16.1 24.7% 0.0% 0.0% 0.0% 86.35sec 786569 17.90sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 466278 1554 1.91 39147 78294 1.1 9.5 25.0% 0.0% 0.0% 0.0% 98.19sec 466278 10.59sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 424594 1415 1.77 39147 78294 1.0 8.8 22.8% 0.0% 0.0% 0.0% 0.00sec 424594 9.81sec
Priest_Shadow_T19M Priest_Shadow_T19M_void_tendril mind_flay_void_tendril ticks -193473 371897 1240 1.80 39147 78294 1.0 9.0 5.6% 0.0% 0.0% 0.0% 0.00sec 371897 10.00sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M berserking 26297 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 261.89sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M deadly_grace 188091 5568168 18521 9.17 97152 194314 46.0 45.9 24.7% 0.0% 0.0% 0.0% 6.41sec 5568168 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M dispersion 47585 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 90.18sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mental_fortitude 194018 0 0 34.93 0 0 175.0 175.0 24.7% 0.0% 0.0% 0.0% 1.69sec 18070592 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mind_blast 8092 26203588 87158 20.53 204263 408383 101.9 102.9 24.7% 0.0% 0.0% 0.0% 2.80sec 26203588 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mind_flay ticks -15407 7699325 25664 34.71 35561 71100 59.3 173.6 24.8% 0.0% 0.0% 0.0% 4.25sec 7699325 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M mindbender 200174 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 64.44sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M plague_swarm ticks -221812 5272776 17576 16.75 50457 100830 20.4 83.8 24.8% 0.0% 0.0% 0.0% 14.36sec 5272776 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadow_word_death 32379 2660813 8850 1.70 249331 498630 8.5 8.5 25.2% 0.0% 0.0% 0.0% 10.74sec 2660813 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadow_word_pain 589 113201 377 0.56 32484 64963 2.8 2.8 24.9% 0.0% 0.0% 0.0% 73.71sec 23303571 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadow_word_pain ticks -589 23190369 77301 52.65 70553 141264 2.8 263.3 24.8% 0.0% 0.0% 0.0% 73.71sec 23303571 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M sphere_of_insanity 194182 2080685 6921 22.45 18500 0 206.8 112.5 0.0% 0.0% 0.0% 0.0% 1.35sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M shadowy_apparitions 78203 1717673 5713 16.71 16425 32844 84.8 83.7 24.9% 0.0% 0.0% 0.0% 3.46sec 1717673 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M surrender_to_madness 193223 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M tormenting_cyclone 221857 3077866 10238 21.10 23322 46668 15.3 105.7 24.8% 0.0% 0.0% 0.0% 18.92sec 3077866 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M vampiric_touch ticks -34914 28971861 96573 35.00 132702 265376 1.2 175.0 24.7% 0.0% 0.0% 0.0% 148.09sec 28971861 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M void_bolt 205448 20708431 68880 15.78 209814 419647 79.2 79.0 24.9% 0.0% 0.0% 0.0% 3.53sec 20708431 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M void_eruption 228360 878171 2921 2.09 67290 134583 5.2 10.5 24.5% 0.0% 0.0% 0.0% 38.83sec 878171 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M void_torrent ticks -205065 4642289 15474 5.67 131344 262571 3.3 28.3 24.8% 0.0% 0.0% 0.0% 78.14sec 4642289 300.64sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_mindbender melee 0 6813755 93905 68.09 66275 132527 82.3 82.3 24.9% 0.0% 0.0% 0.0% 3.27sec 6813755 72.56sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_mindbender shadowcrawl 63619 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 19.43sec 0 72.56sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 2747066 9157 11.24 39147 78294 6.3 56.2 24.8% 0.0% 0.0% 0.0% 40.31sec 2747066 62.46sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 707493 2358 2.90 39147 78294 1.6 14.5 24.5% 0.0% 0.0% 0.0% 84.75sec 707493 16.12sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 458513 1528 1.88 39147 78294 1.0 9.4 24.6% 0.0% 0.0% 0.0% 90.10sec 458513 10.44sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 443876 1480 1.80 39147 78294 1.0 9.0 26.0% 0.0% 0.0% 0.0% 0.00sec 443876 10.00sec
Priest_Shadow_T19M_S2M Priest_Shadow_T19M_S2M_void_tendril mind_flay_void_tendril ticks -193473 548058 1827 1.80 39147 78294 1.0 9.0 55.6% 0.0% 0.0% 0.0% 0.00sec 548058 10.00sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M auto_attack_mh 0 5195619 17282 39.57 21345 42689 198.3 198.3 41.8% 19.1% 0.0% 0.0% 1.52sec 7638053 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M auto_attack_oh 1 2575420 8566 39.20 10658 21325 196.4 196.4 42.0% 19.0% 0.0% 0.0% 1.53sec 3786111 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M blood_fury 20572 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.48sec 0 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M deadly_poison_dot ticks -2818 5449115 18164 19.91 38576 77165 363.6 99.5 41.9% 0.0% 0.0% 0.0% 0.95sec 5449115 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M deadly_poison_instant 113780 12479549 41509 72.37 24255 48504 362.6 362.6 41.9% 0.0% 0.0% 0.0% 0.95sec 12479549 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M envenom 32645 12299224 40910 5.42 319107 637946 27.1 27.1 42.0% 0.0% 0.0% 0.0% 10.81sec 12299224 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M exsanguinate 200806 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 46.52sec 0 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M from_the_shadows 192434 3067558 10203 28.43 15175 30350 142.4 142.4 41.9% 0.0% 0.0% 0.0% 3.77sec 3067558 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M from_the_shadows_driver 192432 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.59sec 0 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M garrote ticks -703 11496399 38321 34.60 46814 93663 20.0 173.0 41.9% 0.0% 0.0% 0.0% 15.46sec 11496399 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M kingsbane ticks -192759 5685446 18951 9.29 86368 172695 6.8 46.4 41.8% 0.0% 0.0% 0.0% 46.52sec 5685446 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M kingsbane_mh 222062 1347912 4483 1.36 139835 279593 6.8 6.8 41.5% 0.0% 0.0% 0.0% 46.52sec 1347912 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M kingsbane_oh 192760 675202 2246 1.36 69952 139719 6.8 6.8 41.8% 0.0% 0.0% 0.0% 46.52sec 675202 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mark_of_the_hidden_satyr 191259 1671859 5561 3.40 69081 138194 17.0 17.0 42.0% 0.0% 0.0% 0.0% 17.54sec 1671859 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mutilate 1329 0 0 0.00 0 0 91.4 0.0 0.0% 0.0% 0.0% 0.0% 3.29sec 0 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mutilate_mh 5374 11711652 38955 18.23 86657 173246 91.4 91.4 48.0% 0.0% 0.0% 0.0% 3.29sec 17217238 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M mutilate_oh 27576 5854072 19472 18.23 43310 86654 91.4 91.4 47.9% 0.0% 0.0% 0.0% 3.29sec 8606041 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M poison_bomb 192660 4931757 16404 6.75 102695 205370 33.8 33.8 42.1% 0.0% 0.0% 0.0% 6.42sec 4931757 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M potion_of_the_old_war 188028 5613785 18673 4.82 163686 327389 24.2 24.2 42.0% 0.0% 0.0% 0.0% 5.38sec 8252795 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M rupture ticks -1943 41175429 137251 41.47 130685 261478 20.6 207.4 51.9% 0.0% 0.0% 0.0% 14.82sec 41175429 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M vanish 1856 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 139.56sec 0 300.64sec
Rogue_Assassination_Exsg_T19M Rogue_Assassination_Exsg_T19M vendetta 79140 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.59sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M agonizing_poison 200803 0 0 0.00 0 0 193.0 0.0 0.0% 0.0% 0.0% 0.0% 1.67sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M auto_attack_mh 0 6440089 21421 38.48 27523 55072 192.8 192.8 40.3% 18.9% 0.0% 0.0% 1.56sec 9467541 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M auto_attack_oh 1 3188590 10606 38.12 13764 27528 191.0 191.0 40.3% 19.0% 0.0% 0.0% 1.57sec 4687529 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M blood_fury 20572 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 124.02sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M envenom 32645 19074489 63445 6.47 419482 839416 32.4 32.4 40.3% 0.0% 0.0% 0.0% 9.12sec 19074489 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M from_the_shadows 192434 5511719 18333 40.70 19265 38525 203.9 203.9 40.3% 0.0% 0.0% 0.0% 2.77sec 5511719 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M from_the_shadows_driver 192432 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 62.01sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M garrote ticks -703 12756476 42522 29.97 60683 121309 17.5 149.8 40.3% 0.0% 0.0% 0.0% 17.83sec 12756476 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M horrific_slam 222168 6148040 20450 23.15 37784 75564 116.0 116.0 40.3% 0.0% 0.0% 0.0% 2.22sec 6148040 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M kingsbane ticks -192759 5231357 17438 9.39 79476 158900 6.9 46.9 40.3% 0.0% 0.0% 0.0% 46.42sec 5231357 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M kingsbane_mh 222062 1761488 5859 1.37 182834 364062 6.9 6.9 40.3% 0.0% 0.0% 0.0% 46.42sec 1761488 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M kingsbane_oh 192760 882585 2936 1.37 91347 182883 6.9 6.9 40.2% 0.0% 0.0% 0.0% 46.42sec 882585 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mark_of_the_hidden_satyr 191259 2136346 7106 3.29 92352 184515 16.5 16.5 40.4% 0.0% 0.0% 0.0% 18.07sec 2136346 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mutilate 1329 0 0 0.00 0 0 77.3 0.0 0.0% 0.0% 0.0% 0.0% 3.89sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mutilate_mh 5374 12469065 41474 15.42 110220 220420 77.3 77.3 46.4% 0.0% 0.0% 0.0% 3.89sec 18330707 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M mutilate_oh 27576 6235727 20741 15.42 55138 110274 77.3 77.3 46.3% 0.0% 0.0% 0.0% 3.89sec 9167109 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M poison_bomb 192660 7433742 24726 7.31 144831 289696 36.6 36.6 40.2% 0.0% 0.0% 0.0% 6.14sec 7433742 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M potion_of_the_old_war 188028 6793543 22597 4.66 207379 414904 23.3 23.3 40.3% 0.0% 0.0% 0.0% 4.24sec 9987152 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M rupture ticks -1943 34650255 115501 29.30 157269 314769 11.8 146.5 50.3% 0.0% 0.0% 0.0% 26.14sec 34650255 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.72sec 0 300.64sec
Rogue_Assassination_T19M Rogue_Assassination_T19M vendetta 79140 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 62.01sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M adrenaline_rush 13750 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 46.63sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M ambush 8676 970429 3228 1.08 124031 248061 5.4 5.4 44.9% 0.0% 0.0% 0.0% 52.22sec 1426623 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M auto_attack_mh 0 7652782 25455 40.77 29364 58728 204.3 204.3 46.5% 19.0% 0.0% 0.0% 1.47sec 11250314 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M auto_attack_oh 1 3750087 12474 39.98 14682 29364 200.3 200.3 46.5% 19.0% 0.0% 0.0% 1.50sec 5512983 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M between_the_eyes 199804 12085940 40200 5.00 204317 817533 25.1 25.1 45.3% 0.0% 0.0% 0.0% 12.01sec 17767476 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M curse_of_the_dreadblades 202665 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 86.97sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M greed 202822 3319697 11042 4.68 96468 192937 23.4 23.4 46.8% 0.0% 0.0% 0.0% 12.59sec 4880268 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M greed_oh 202823 1661148 5525 4.68 48234 96468 23.4 23.4 47.0% 0.0% 0.0% 0.0% 12.59sec 2442044 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M main_gauche 86392 11314618 37635 40.96 37625 75249 205.2 205.2 46.5% 0.0% 0.0% 0.0% 1.47sec 16633560 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M mark_of_the_hidden_satyr 191259 1636134 5442 4.08 54501 109001 20.5 20.5 46.7% 0.0% 0.0% 0.0% 14.61sec 1636134 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M marked_for_death 137619 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 18.83sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M pistol_shot 185763 10515608 34977 5.66 231823 447575 28.4 28.4 64.3% 0.0% 0.0% 0.0% 9.89sec 15458940 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M blunderbuss 202895 19738060 65653 14.96 162626 318401 18.7 75.0 64.6% 0.0% 0.0% 0.0% 15.31sec 29016818 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M potion_of_the_old_war 188028 5231488 17401 5.58 127246 254493 28.0 28.0 47.1% 0.0% 0.0% 0.0% 4.17sec 7690784 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M roll_the_bones 193316 0 0 0.00 0 0 12.3 0.0 0.0% 0.0% 0.0% 0.0% 24.87sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M run_through 2098 36629194 121836 13.37 372174 744609 67.0 67.0 46.9% 0.0% 0.0% 0.0% 4.45sec 53848384 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M saber_slash 193315 27632318 91910 39.32 95724 191448 197.0 197.0 46.5% 0.0% 0.0% 0.0% 1.53sec 40622125 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M shadowmeld 58984 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 138.55sec 0 300.64sec
Rogue_Outlaw_T19M Rogue_Outlaw_T19M vanish 1856 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 52.22sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M auto_attack_mh 0 3344698 11125 31.75 18559 37119 159.1 159.1 32.2% 19.0% 0.0% 0.0% 1.90sec 4917023 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M auto_attack_oh 1 1643280 5466 31.21 9280 18559 156.4 156.4 32.3% 19.0% 0.0% 0.0% 1.93sec 2415777 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M backstab 53 6957149 23141 11.13 94248 188496 52.7 55.8 32.3% 0.0% 0.0% 0.0% 5.07sec 10227668 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M eviscerate 196819 45618105 151734 12.93 477526 955724 61.3 64.8 47.3% 0.0% 0.0% 0.0% 4.86sec 67062935 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M goremaws_bite 209782 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 64.19sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M goremaws_bite_mh 209783 1525518 5074 0.96 242553 466663 4.6 4.8 32.8% 0.0% 0.0% 0.0% 64.19sec 1525518 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M goremaws_bite_oh 209784 730576 2430 0.96 115681 229109 4.6 4.8 32.1% 0.0% 0.0% 0.0% 64.19sec 730576 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M horrific_slam 222168 4222966 14046 23.26 27371 54743 116.6 116.6 32.3% 0.0% 0.0% 0.0% 2.22sec 4222966 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M mark_of_the_hidden_satyr 191259 1423934 4736 3.30 65087 130173 16.6 16.6 32.1% 0.0% 0.0% 0.0% 18.04sec 1423934 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M nightblade ticks -195452 26950498 89835 29.09 140044 280006 17.4 145.4 32.3% 0.0% 0.0% 0.0% 17.15sec 26950498 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M weaponmaster 193536 1573612 5234 1.70 184954 0 8.5 8.5 0.0% 0.0% 0.0% 0.0% 30.92sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M potion_of_the_old_war 188028 4934797 16414 4.71 158050 316100 23.6 23.6 32.3% 0.0% 0.0% 0.0% 9.50sec 7254619 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_blades 121471 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.09sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_blade_mh 121473 1319805 4390 7.31 27286 54572 34.6 36.6 32.1% 0.0% 0.0% 0.0% 6.20sec 1319805 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_blade_offhand 121474 663059 2205 7.34 13643 27286 34.8 36.8 32.2% 0.0% 0.0% 0.0% 6.16sec 663059 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_dance 185313 0 0 0.00 0 0 28.5 0.0 0.0% 0.0% 0.0% 0.0% 10.58sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadow_nova 197800 2578941 8578 6.73 57678 115357 31.9 33.7 32.5% 0.0% 0.0% 0.0% 9.43sec 2578941 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadowmeld 58984 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 122.73sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M shadowstrike 185438 32445814 107921 25.24 181696 363394 119.5 126.5 41.2% 0.0% 0.0% 0.0% 2.52sec 47698420 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M soul_rip 220893 7947858 26436 24.94 48067 96134 125.0 125.0 32.3% 0.0% 0.0% 0.0% 2.51sec 7947858 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M symbols_of_death 212283 0 0 0.00 0 0 16.7 0.0 0.0% 0.0% 0.0% 0.0% 18.75sec 0 300.64sec
Rogue_Subtlety_T19M Rogue_Subtlety_T19M vanish 1856 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 122.27sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M berserking 26297 0 0 0.00 0 0 2.1 0.0 0.0% 0.0% 0.0% 0.0% 180.47sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M deadly_grace 188091 3655679 12159 6.80 80915 161830 34.6 34.0 32.7% 0.0% 0.0% 0.0% 8.87sec 3655679 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M earth_shock 8042 16322964 54293 5.15 424724 1061822 25.8 25.8 32.7% 0.0% 0.0% 0.0% 11.58sec 16322964 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M earthquake 61882 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 23.91sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M earthquake_ 77478 7861083 26147 35.33 29785 74459 177.0 177.0 32.7% 0.0% 0.0% 0.0% 1.54sec 7861083 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M elemental_mastery 16166 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.47sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M fire_elemental 198067 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M flame_shock 188389 1489839 4955 4.08 48866 122184 20.5 20.5 32.7% 0.0% 0.0% 0.0% 15.01sec 10054279 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M flame_shock ticks -188389 8564439 28548 43.15 26655 66637 20.5 215.7 32.6% 0.0% 0.0% 0.0% 15.01sec 10054279 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lava_burst 51505 11656115 38770 8.20 0 283557 41.2 41.1 100.0% 0.0% 0.0% 0.0% 7.30sec 11656115 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lava_burst_overload 77451 3892641 12948 3.34 0 232865 16.8 16.7 100.0% 0.0% 0.0% 0.0% 17.39sec 3892641 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lightning_bolt 188196 19783892 65805 25.83 102623 256391 129.4 129.4 32.7% 0.0% 0.0% 0.0% 2.30sec 19783892 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lightning_bolt_overload 45284 10851369 36094 16.66 87322 217987 83.5 83.5 32.6% 0.0% 0.0% 0.0% 3.98sec 10851369 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M lightning_rod 197568 9590275 31899 34.06 56191 0 170.7 170.7 0.0% 0.0% 0.0% 0.0% 1.79sec 9590275 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M mark_of_the_hidden_satyr 191259 2506020 8335 4.16 90596 181192 20.8 20.8 32.7% 0.0% 0.0% 0.0% 14.42sec 2506020 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M pepper_breath ticks -225622 1397479 4658 16.56 16970 0 16.6 82.8 0.0% 0.0% 0.0% 0.0% 18.01sec 1397479 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M plague_swarm ticks -221812 4297211 14324 14.37 45088 90183 16.7 71.8 32.7% 0.0% 0.0% 0.0% 17.84sec 4297211 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M stormkeeper 205495 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 62.01sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M tormenting_cyclone 221857 1787221 5945 17.12 15689 31377 12.5 85.8 32.8% 0.0% 0.0% 0.0% 23.74sec 1787221 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M totem_mastery 210643 0 0 0.00 0 0 3.2 0.0 0.0% 0.0% 0.0% 0.0% 111.62sec 0 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M volcanic_inferno 205533 972624 3235 6.09 24009 48019 30.5 30.5 32.7% 0.0% 0.0% 0.0% 8.55sec 972624 300.64sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_primal_fire_elemental fire_blast 57984 13293404 125623 29.23 194435 388870 51.5 51.5 32.6% 0.0% 0.0% 0.0% 5.38sec 13293404 105.82sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_primal_fire_elemental immolate 118297 410325 3878 3.06 57610 115221 5.4 5.4 32.0% 0.0% 0.0% 0.0% 60.27sec 2037055 105.82sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_primal_fire_elemental immolate ticks -118297 1626730 5422 12.04 20373 40743 5.4 60.2 32.6% 0.0% 0.0% 0.0% 60.27sec 2037055 105.82sec
Shaman_Elemental_T19M Shaman_Elemental_T19M_greater_lightning_elemental lightning_blast 191726 4539151 107817 60.93 80014 160029 42.8 42.8 32.7% 0.0% 0.0% 0.0% 6.57sec 4539151 42.10sec
Warrior_Arms_T19M Warrior_Arms_T19M arcane_torrent 69179 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 91.25sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M auto_attack_mh 0 8601440 28610 19.82 64408 129256 99.3 99.3 34.2% 0.0% 0.0% 0.0% 3.05sec 12644931 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M avatar 107574 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 90.02sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M battle_cry 1719 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 27.64sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M bladestorm 227847 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 122.12sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M bladestorm_mh 50622 883593 2939 1.23 121162 242273 0.0 6.2 18.6% 0.0% 0.0% 0.0% 0.00sec 1298966 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M colossus_smash 167105 19047313 63355 10.81 275216 541976 54.2 54.2 28.7% 0.0% 0.0% 0.0% 5.61sec 28001355 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M corrupted_blood_of_zakajz ticks -209569 12638063 42127 12.15 207974 0 0.0 60.8 0.0% 0.0% 0.0% 0.0% 0.00sec 12638063 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M execute 163201 18210900 60573 5.20 427240 913020 26.1 26.1 55.8% 0.0% 0.0% 0.0% 2.12sec 26771747 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M focused_rage 207982 0 0 0.00 0 0 196.7 0.0 0.0% 0.0% 0.0% 0.0% 1.48sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M heroic_leap 6544 0 0 0.00 0 0 10.2 0.0 0.0% 0.0% 0.0% 0.0% 30.96sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M horrific_slam 222168 7095577 23601 23.78 44448 89110 119.2 119.2 33.8% 0.0% 0.0% 0.0% 2.18sec 7095577 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M mortal_strike 12294 52655761 175143 12.87 493203 1061814 64.5 64.5 56.9% 0.0% 0.0% 0.0% 4.60sec 77408956 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M potion_of_the_old_war 188028 8726896 29027 4.66 270150 557644 23.4 23.4 35.9% 0.0% 0.0% 0.0% 13.02sec 12829364 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M shadow_wave 215047 5894177 19605 2.61 331901 672309 13.1 13.1 34.9% 0.0% 0.0% 0.0% 19.68sec 5894177 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M slam 1464 17060192 56745 15.76 159021 313448 79.0 79.0 36.9% 0.0% 0.0% 0.0% 3.07sec 25080098 300.64sec
Warrior_Arms_T19M Warrior_Arms_T19M warbreaker 209577 1762447 5862 0.87 303761 625121 4.4 4.4 31.0% 0.0% 0.0% 0.0% 70.27sec 1762447 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M auto_attack_mh 0 15197081 50548 45.09 46341 99743 225.9 225.9 40.1% 1.1% 0.0% 0.0% 1.33sec 22341149 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M auto_attack_oh 1 7599847 25279 45.09 23172 49866 225.9 225.9 40.1% 1.1% 0.0% 0.0% 1.33sec 11172495 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M avatar 107574 0 0 0.00 0 0 4.1 0.0 0.0% 0.0% 0.0% 0.0% 86.06sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M battle_cry 1719 0 0 0.00 0 0 7.4 0.0 0.0% 0.0% 0.0% 0.0% 43.65sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.28sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M bloodthirst 23881 10001396 33267 10.15 129212 265229 50.9 50.9 49.6% 0.0% 0.0% 0.0% 5.23sec 14702999 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M charge 100 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M dragon_roar 118000 2024621 6734 2.73 0 147783 13.7 13.7 100.0% 0.0% 0.0% 0.0% 22.68sec 2024621 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M execute 5308 20389800 67820 8.69 299548 624892 43.6 43.6 51.8% 0.0% 0.0% 0.0% 6.92sec 29974938 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M execute_offhand 163558 10193156 33904 8.69 149899 312226 0.0 43.6 51.8% 0.0% 0.0% 0.0% 0.00sec 14984905 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M felcrazed_rage 225777 436210 1451 0.57 77895 156393 2.9 2.9 94.6% 0.0% 0.0% 0.0% 129.18sec 436210 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M furious_slash 100130 3181322 10582 5.53 84156 178127 27.7 27.7 32.6% 0.0% 0.0% 0.0% 8.68sec 4676845 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M heroic_leap 6544 0 0 0.00 0 0 12.0 0.0 0.0% 0.0% 0.0% 0.0% 26.36sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M mark_of_the_hidden_satyr 191259 2021849 6725 3.87 71556 155826 19.4 19.4 38.7% 0.0% 0.0% 0.0% 15.48sec 2021849 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury 205545 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 44.31sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury_mh 205546 3139931 10444 1.44 0 434179 0.0 7.2 100.0% 0.0% 0.0% 0.0% 0.00sec 6082501 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury_mh ticks -205546 2942570 9809 5.74 53006 112588 0.0 28.7 83.1% 0.0% 0.0% 0.0% 0.00sec 6082501 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M odyns_fury_oh 205547 1569965 5222 1.44 0 217090 0.0 7.2 100.0% 0.0% 0.0% 0.0% 0.00sec 1569965 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M potion_of_the_old_war 188028 7836969 26067 5.50 180265 403550 27.6 27.6 46.6% 0.0% 0.0% 0.0% 11.08sec 11521086 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M raging_blow 85288 0 0 0.00 0 0 61.9 0.0 0.0% 0.0% 0.0% 0.0% 4.71sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M raging_blow_oh 85384 9421733 31338 12.34 108075 231081 0.0 61.9 36.0% 0.0% 0.0% 0.0% 0.00sec 13850840 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M raging_blow_mh 96103 18853370 62710 12.34 216160 462066 0.0 61.9 36.0% 0.0% 0.0% 0.0% 0.00sec 27716239 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage 184367 0 0 0.00 0 0 49.4 0.0 0.0% 0.0% 0.0% 0.0% 6.12sec 0 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage1 218617 1854701 6169 9.85 25948 55366 0.0 49.4 39.5% 0.0% 0.0% 0.0% 0.00sec 2726587 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage2 184707 2938066 9773 9.84 41305 87833 0.0 49.3 39.3% 0.0% 0.0% 0.0% 0.00sec 4319235 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage3 184709 3890560 12941 9.83 54655 116292 0.0 49.3 39.5% 0.0% 0.0% 0.0% 0.00sec 5719492 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage4 201364 5901999 19631 9.81 82578 176795 0.0 49.1 39.8% 0.0% 0.0% 0.0% 0.00sec 8676498 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M rampage5 201363 6874303 22865 9.81 96233 205982 0.0 49.1 39.8% 0.0% 0.0% 0.0% 0.00sec 10105877 300.64sec
Warrior_Fury_T19M Warrior_Fury_T19M rend_flesh ticks -221770 3383378 11278 26.53 17413 37960 45.3 132.6 39.4% 0.0% 0.0% 0.0% 6.66sec 3383378 300.64sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.25% 9.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.18% 9.18% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.46% 10.46% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.44% 11.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.44% 11.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.43% 11.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.51% 11.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.73% 11.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 8.24% 8.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:8.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.31% 5.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Agonizing Poison 1.0 192.0 175.0sec 1.5sec 99.39% 100.00% 187.9(187.9) 0.0

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_agonizing_poison
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • agonizing_poison_1:0.62%
  • agonizing_poison_2:0.60%
  • agonizing_poison_3:0.53%
  • agonizing_poison_4:0.46%
  • agonizing_poison_5:97.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:200803
  • name:Agonizing Poison
  • tooltip:Taking $w1% increased damage from the poisoning Rogue's abilities.
  • description:{$@spelldesc200802=Coats your weapons with a Lethal Poison that lasts for {$d=3600 seconds}. Each strike has a {$h=20}% chance to poison the enemy for {$200803d=12 seconds}, increasing all damage taken from your abilities by ${$200803s1}.1%, stacking up to {$200803u=5} times. Damage bonus increased by Mastery: Potent Poisons.}
  • max_stacks:5
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Blood of the Assassinated 4.0 0.1 61.8sec 60.1sec 13.47% 12.78% 0.1(0.1) 3.9

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:13.47%

Trigger Attempt Success

  • trigger_pct:35.05%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Blood of the Assassinated 6.4 0.8 44.6sec 38.9sec 22.60% 18.97% 0.8(0.8) 6.2

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_blood_of_the_assassinated
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:35.00%
  • default_value:1.00

Stack Uptimes

  • blood_of_the_assassinated_1:22.60%

Trigger Attempt Success

  • trigger_pct:35.06%

Spelldata details

  • id:192925
  • name:Blood of the Assassinated
  • tooltip:Damage taken from Rupture increased by $s1%.
  • description:{$@spelldesc192923=Rupture has a chance to infect your target, increasing damage dealt by your Rupture by $192925s1% for {$192925d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Brutal Haymaker 4.8 0.0 53.8sec 53.8sec 19.27% 19.27% 0.0(0.0) 2.1

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_brutal_haymaker
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:605058.69

Stack Uptimes

  • brutal_haymaker_1:19.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214169
  • name:Brutal Haymaker
  • tooltip:Damage taken from the caster increased by $s2%.
  • description:{$@spelldesc214168=Your melee attacks have a chance to deal $214169s1 Physical damage and increase all damage the target takes from you by $214169s2% for {$214169d=15 seconds}, up to $214169s3 extra damage dealt.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Chilled 2.5 273.7 137.0sec 1.1sec 98.44% 98.44% 273.7(273.7) 1.5

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_chilled
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chilled_1:98.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205708
  • name:Chilled
  • tooltip:Movement speed reduced by $s1%.
  • description:Chilled, reducing movement speed by $s1% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 8.6 49.9 35.5sec 5.2sec 89.95% 90.06% 49.9(49.9) 7.7

Buff details

  • buff initial source:Warrior_Arms_T19M
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:89.95%

Trigger Attempt Success

  • trigger_pct:100.00%
Frost Bomb 16.6 0.0 17.7sec 17.7sec 64.80% 64.80% 32.2(32.2) 15.9

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_frost_bomb
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frost_bomb_1:64.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112948
  • name:Frost Bomb
  • tooltip:The Mage's Ice Lances that hit the target while frozen will cause the Frost Bomb to release a wave of freezing ice that deals $113092s1 Frost damage to the target, $113092s2 Frost damage to all other enemies within $113092A2 yards.
  • description:Places a Frost Bomb on the target for {$d=12 seconds}. Limit 1 target. Your Ice Lances that benefit from Shatter will trigger the release of a wave of freezing ice, dealing $113092s1 Frost damage to the target and $113092s2 Frost damage to all other enemies within $113092A2 yards.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 29.2 0.1 10.3sec 10.3sec 52.46% 100.00% 0.1(0.1) 0.0

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:52.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 26.3 42.6 11.6sec 4.3sec 86.60% 100.00% 42.6(42.6) 25.5

Buff details

  • buff initial source:Paladin_Retribution_T19M
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:86.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Kingsbane 6.9 59.0 46.4sec 4.3sec 44.13% 84.18% 0.0(0.0) 6.4

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:3.29%
  • kingsbane_2:3.62%
  • kingsbane_3:3.55%
  • kingsbane_4:3.58%
  • kingsbane_5:3.63%
  • kingsbane_6:3.76%
  • kingsbane_7:3.81%
  • kingsbane_8:3.73%
  • kingsbane_9:3.42%
  • kingsbane_10:3.05%
  • kingsbane_11:2.54%
  • kingsbane_12:2.01%
  • kingsbane_13:1.50%
  • kingsbane_14:1.06%
  • kingsbane_15:0.70%
  • kingsbane_16:0.42%
  • kingsbane_17:0.25%
  • kingsbane_18:0.11%
  • kingsbane_19:0.06%
  • kingsbane_20:0.03%
  • kingsbane_21:0.01%
  • kingsbane_22:0.00%
  • kingsbane_23:0.00%
  • kingsbane_24:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%. |cFFFFFFFFAwards $s6 combo $lpoint:points;.|r}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Kingsbane 6.8 135.8 46.5sec 2.0sec 43.78% 86.98% 0.0(0.0) 6.4

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_kingsbane
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • kingsbane_1:1.24%
  • kingsbane_2:1.72%
  • kingsbane_3:1.64%
  • kingsbane_4:1.62%
  • kingsbane_5:1.61%
  • kingsbane_6:1.57%
  • kingsbane_7:1.55%
  • kingsbane_8:1.55%
  • kingsbane_9:1.53%
  • kingsbane_10:1.50%
  • kingsbane_11:1.49%
  • kingsbane_12:1.49%
  • kingsbane_13:1.51%
  • kingsbane_14:1.54%
  • kingsbane_15:1.64%
  • kingsbane_16:1.76%
  • kingsbane_17:1.91%
  • kingsbane_18:2.11%
  • kingsbane_19:2.25%
  • kingsbane_20:2.32%
  • kingsbane_21:2.26%
  • kingsbane_22:2.05%
  • kingsbane_23:1.72%
  • kingsbane_24:1.39%
  • kingsbane_25:1.04%
  • kingsbane_26:0.72%
  • kingsbane_27:0.47%
  • kingsbane_28:0.28%
  • kingsbane_29:0.16%
  • kingsbane_30:0.09%
  • kingsbane_31:0.05%
  • kingsbane_32:0.02%
  • kingsbane_33:0.01%
  • kingsbane_34:0.00%
  • kingsbane_35:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192853
  • name:Kingsbane
  • tooltip:Kingsbane Damage increased by $s1%.
  • description:{$@spelldesc192759=Releases lethal poison within |cFFFFCC99The Kingslayers|r and injects it into your target, dealing ${$222062sw1+$192760sw1} Nature damage instantly and an additional $o4 Nature damage over {$d=14 seconds}. Each time you apply a Lethal Poison to a target affected by Kingsbane, Kingsbane damage increases by $192853s1%. |cFFFFFFFFAwards $s6 combo $lpoint:points;.|r}
  • max_stacks:99
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lacerate 8.8 16.5 34.9sec 11.9sec 91.13% 91.13% 16.5(16.5) 8.0

Buff details

  • buff initial source:Hunter_SV_T19M
  • cooldown name:buff_lacerate
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lacerate_1:91.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185855
  • name:Lacerate
  • tooltip:Bleeding for $s1 damage every $t1 sec.
  • description:Tears a bleeding wound in the target, dealing ${$o1+$s2} Physical damage over {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:10.00
  • default_chance:0.00%
Lightning Rod 10.6 28.1 28.7sec 7.6sec 75.46% 80.32% 28.1(28.1) 9.9

Buff details

  • buff initial source:Shaman_Elemental_T19M
  • cooldown name:buff_lightning_rod
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:0.40

Stack Uptimes

  • lightning_rod_1:75.46%

Trigger Attempt Success

  • trigger_pct:29.95%

Spelldata details

  • id:197209
  • name:Lightning Rod
  • tooltip:Casting Shaman's Lightning Bolt and Chain Lightning also deal $210689s2% of their damage to the Lightning Rod.
  • description:{$@spelldesc210689=Your Lightning Bolt and Chain Lightning have a $s1% chance to make the primary target a Lightning Rod for {$197209d=10 seconds}. Lightning Rods take $s2% of all damage you deal with Lightning Bolt and Chain Lightning.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Maddening Whispers 2.4 20.9 158.7sec 10.0sec 4.63% 4.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Fire_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:0.50%
  • maddening_whispers_2:0.45%
  • maddening_whispers_3:0.47%
  • maddening_whispers_4:0.45%
  • maddening_whispers_5:0.47%
  • maddening_whispers_6:0.45%
  • maddening_whispers_7:0.47%
  • maddening_whispers_8:0.59%
  • maddening_whispers_9:0.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222050
  • name:Maddening Whispers
  • tooltip:Deals $222046s1 Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals $s1 Shadow damage.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Maddening Whispers 3.0 26.2 121.0sec 8.8sec 12.16% 12.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_maddening_whispers
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • maddening_whispers_1:5.35%
  • maddening_whispers_2:0.91%
  • maddening_whispers_3:0.79%
  • maddening_whispers_4:0.91%
  • maddening_whispers_5:0.95%
  • maddening_whispers_6:0.91%
  • maddening_whispers_7:0.83%
  • maddening_whispers_8:0.75%
  • maddening_whispers_9:0.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222050
  • name:Maddening Whispers
  • tooltip:Deals $222046s1 Shadow damage when the caster has applied all Maddening Whispers.
  • description:{$@spelldesc222046=Gain {$u=10} stacks of Maddening Whispers. Your damaging spells transfer one Maddening Whisper to the target for {$222046d=30 seconds}. When all Whispers have been applied, each deals $s1 Shadow damage.}
  • max_stacks:10
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Marked for Death 1.7 13.4 149.6sec 18.9sec 99.69% 99.69% 13.4(13.4) 0.7

Buff details

  • buff initial source:Rogue_Outlaw_T19M
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:99.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Surge of Toxins 33.0 11.2 9.1sec 6.8sec 69.14% 70.17% 11.2(11.2) 32.3

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_surge_of_toxins
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • surge_of_toxins_1:69.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192425
  • name:Surge of Toxins
  • tooltip:Damage taken from Poison effects increased by $w1%.
  • description:{$@spelldesc192424=Finishing moves increase Poison damage you deal to the target by $192425s1% for {$192425d=5 seconds}.{$?s200802=false}[ Agonizing Poison's effect is increased by ${$m1/10}.1% increased damage per application on the target.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Surge of Toxins 35.6 12.1 8.5sec 6.3sec 74.36% 100.00% 12.1(12.1) 34.9

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_surge_of_toxins
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • surge_of_toxins_1:74.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:192425
  • name:Surge of Toxins
  • tooltip:Damage taken from Poison effects increased by $w1%.
  • description:{$@spelldesc192424=Finishing moves increase Poison damage you deal to the target by $192425s1% for {$192425d=5 seconds}.{$?s200802=false}[ Agonizing Poison's effect is increased by ${$m1/10}.1% increased damage per application on the target.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Touch of the Magi 8.3 0.0 34.1sec 34.1sec 16.41% 16.41% 0.0(0.0) 8.1

Buff details

  • buff initial source:Mage_Arcane_T19M
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • touch_of_the_magi_1:16.41%

Trigger Attempt Success

  • trigger_pct:10.17%

Spelldata details

  • id:210824
  • name:Touch of the Magi
  • tooltip:Accumulating Damage...
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=6 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
Vendetta 5.3 0.0 62.0sec 62.0sec 33.96% 33.01% 0.0(0.0) 4.9

Buff details

  • buff initial source:Rogue_Assassination_T19M
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:33.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Vendetta 3.6 0.0 93.6sec 93.6sec 23.74% 22.56% 0.0(0.0) 3.5

Buff details

  • buff initial source:Rogue_Assassination_Exsg_T19M
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • vendetta_1:23.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death, increasing damage taken from the Rogue's attacks, and always visible to the Rogue.
  • description:Marks an enemy for death for {$d=20 seconds}, increasing the damage your abilities and auto attacks deal to the target by $s1%, and making the target visible to you even through concealments such as stealth and invisibility.
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Vulnerable (vulnerability) 8.6 67.7 34.7sec 4.0sec 96.02% 99.05% 67.7(67.7) 7.6

Buff details

  • buff initial source:Hunter_MM_T19M
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:96.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Water Jet 9.1 0.0 31.8sec 31.8sec 8.10% 24.00% 0.0(0.0) 0.2

Buff details

  • buff initial source:Mage_Frost_T19M_water_elemental
  • cooldown name:buff_water_jet
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • water_jet_1:8.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:135029
  • name:Water Jet
  • tooltip:Taking $w1 damage every $t1 sec. Frostbolts from the Water Elemental's owner that hit the target will grant a charge of Fingers of Frost.
  • description:Channels a jet of icy water at the target, {$?s198146=false}[slowing the target by $m2% and ][]dealing $o1 Frost damage to the target over {$d=4 seconds}. The Mage's Frostbolts that hit the target while it is being blasted with icy water will grant a charge of Fingers of Frost.
  • max_stacks:0
  • duration:4.00
  • cooldown:25.00
  • default_chance:0.00%
winters_chill 11.3 22.6 23.8sec 7.5sec 5.23% 14.33% 22.6(22.6) 11.2

Buff details

  • buff initial source:Mage_Frost_T19M
  • cooldown name:buff_winters_chill
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • winters_chill_1:5.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 6922214.24
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 12192
death count pct 162.54
avg death time 299.85
min death time 227.38
max death time 378.48
dmg taken 2081435696.27

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7499
Mean 300.64
Minimum 227.38
Maximum 378.48
Spread ( max - min ) 151.10
Range [ ( max - min ) / 2 * 100% ] 25.13%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7499
Mean 6934820.26
Minimum 6504259.51
Maximum 7338027.36
Spread ( max - min ) 833767.84
Range [ ( max - min ) / 2 * 100% ] 6.01%
Standard Deviation 116719.8666
5th Percentile 6739308.71
95th Percentile 7124282.87
( 95th Percentile - 5th Percentile ) 384974.16
Mean Distribution
Standard Deviation 1347.8548
95.00% Confidence Intervall ( 6932178.51 - 6937462.01 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 10
0.1% Error 1088
0.1 Scale Factor Error with Delta=300 116298264
0.05 Scale Factor Error with Delta=300 465193057
0.01 Scale Factor Error with Delta=300 -
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 3753
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 2495358185 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.